F413442

General Info

Members Datasets Scaffolds Average Seq Length
338 207 676 395

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100006576|Ga0068864_1000065763
Length 422
Sequence MVEKQGAAAAAINLTSNNQPMRKICLSVVGLIFVLFSGFAQNSSKDSSNYKSRKLTFEEANFVSSYYRQDGNNSAVTGGIGTEKLSDYSGTFDVKLIKYDKLQRKHDFDIEIGIDHYTSASSDKINPNSISSASHADTRIYPSINWTMENEKKGNTIGAGLSASSEFDYRSLGANVNFAKKTANKNGEFSVKFQAYLDNLKYILPVELRPPAQQNDDIDGNSYPKKSRNSYSASLSYSQIVNQRLQLMLLADFIYQQGYLGLPFHRVYFLDNSLHVENLPDTRLKIPLGFRASYFIGDKMIVKGFYRYYHDDWGLNAHTVELETPVKITPFFSIAPFYRYYNQTAVKYFAPYHNHKLADQYYTSNYDLSKFNSNFFGAGFRIAPPKGVFGNKRINMLELRYGHYKKNNGMHADIVSLHLKFR

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
180 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
181 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
182 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
183 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
184 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
185 2738541283 Pedobacter sp. OK701 Isolate Unclassified
186 2738541302 Pedobacter sp. CF074 Isolate Unclassified
187 2738543023 Pedobacter sp. OK628 Isolate Unclassified
188 2739367651 Pedobacter sp. OK291 Isolate Unclassified
189 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
190 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
191 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
192 2818991437 Pedobacter terrae 518 Isolate Unclassified
193 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
194 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
195 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
196 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
197 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
198 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
199 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
200 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
201 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
202 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
203 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
204 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
205 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
206 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
207 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.12
Metatranscriptomes 0.3
Isolates 8.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 0.59
Rhizosphere 83.14
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100006576 3300005618 Bacteria 9517
2 SwRhRL2b_contig_188096 2162886007 Bacteria 7786
3 SwRhRL2b_contig_2054166 2162886007 Bacteria 4382
4 JGI24735J21928_10000002 3300002067 Bacteria 624895
5 JGI24751J29686_10000335 3300002459 Bacteria 17022
6 JGI25162J39368_1000283 3300002737 Bacteria 47953
7 rootH1_10028597 3300003316 Bacteria 6470
8 rootL2_10240447 3300003322 Bacteria 1844
9 rootH1_10020638 3300003323 Bacteria 25331
10 rootH1_10071036 3300003323 Unclassified 2124
11 rootH1_10206786 3300003323 Bacteria 1734
12 Ga0006562J51391_1007671 3300003578 Bacteria 3845
13 Ga0055529_1009013 3300003763 Bacteria 1319
14 Ga0055536_1000001 3300003781 Bacteria 630663
15 Ga0055530_10007469 3300003791 Bacteria 4590
16 Ga0065714_10002228 3300005288 Bacteria 43581
17 Ga0065714_10064438 3300005288 Bacteria 113441
18 Ga0065704_10000619 3300005289 Bacteria 18504
19 Ga0065704_10072845 3300005289 Bacteria 7935
20 Ga0065712_10068516 3300005290 Bacteria 10145
21 Ga0065712_10094543 3300005290 Unclassified 2251
22 Ga0065712_10120708 3300005290 Bacteria 1674
23 Ga0070658_10292269 3300005327 Bacteria 1389
24 Ga0070676_10041377 3300005328 Bacteria 2672
25 Ga0070683_100004241 3300005329 Bacteria 11758
26 Ga0068869_100013801 3300005334 Bacteria 5384
27 Ga0068869_100055819 3300005334 Bacteria 2879
28 Ga0070666_10010327 3300005335 Bacteria 5840
29 Ga0068868_100001364 3300005338 Bacteria 16821
30 Ga0068868_100001827 3300005338 Bacteria 14639
31 Ga0068868_100197168 3300005338 Bacteria 1677
32 Ga0070661_100008691 3300005344 Bacteria 7029
33 Ga0070668_100012840 3300005347 Bacteria 6235
34 Ga0070668_100018978 3300005347 Bacteria 5168
35 Ga0070669_100005547 3300005353 Bacteria 9112
36 Ga0070675_100055191 3300005354 Bacteria 3270
37 Ga0070675_100073502 3300005354 Bacteria 2839
38 Ga0070675_100111251 3300005354 Unclassified 2317
39 Ga0070674_100004584 3300005356 Bacteria 7895
40 Ga0070674_100048137 3300005356 Unclassified 2925
41 Ga0070673_100010837 3300005364 Bacteria 6194
42 Ga0070673_100033938 3300005364 Bacteria 3856
43 Ga0070673_100170970 3300005364 Unclassified 1855
44 Ga0070688_100032429 3300005365 Bacteria 3149
45 Ga0070688_100066138 3300005365 Unclassified 2300
46 Ga0070659_100000119 3300005366 Bacteria 59333
47 Ga0070659_100027064 3300005366 Bacteria 4415
48 Ga0070667_100008992 3300005367 Bacteria 8269
49 Ga0070667_100036792 3300005367 Bacteria 4104
50 Ga0068867_100019480 3300005459 Unclassified 4834
51 Ga0070685_10001005 3300005466 Bacteria 15141
52 Ga0070706_100373622 3300005467 Bacteria 1328
53 Ga0070698_100266966 3300005471 Bacteria 1643
54 Ga0070684_100007775 3300005535 Bacteria 8357
55 Ga0070684_100060198 3300005535 Bacteria 3320
56 Ga0068853_100003693 3300005539 Bacteria 11746
57 Ga0068853_100016705 3300005539 Bacteria 6044
58 Ga0070672_100073674 3300005543 Unclassified 2722
59 Ga0070672_100102919 3300005543 Unclassified 2318
60 Ga0070686_100022468 3300005544 Unclassified 3757
61 Ga0070686_100044326 3300005544 Bacteria 2795
62 Ga0070664_100005482 3300005564 Bacteria 10188
63 Ga0070664_100057995 3300005564 Bacteria 3293
64 Ga0068857_100037285 3300005577 Bacteria 4306
65 Ga0068854_100132129 3300005578 Unclassified 1907
66 Ga0068856_100060690 3300005614 Bacteria 3736
67 Ga0068859_100033898 3300005617 Bacteria 5126
68 Ga0068859_100036909 3300005617 Bacteria 4905
69 Ga0068859_100039224 3300005617 Bacteria 4751
70 Ga0068859_100057629 3300005617 Bacteria 3913
71 Ga0068859_100070549 3300005617 Bacteria 3529
72 Ga0068864_100060867 3300005618 Bacteria 3269
73 Ga0068861_100068231 3300005719 Bacteria 2747
74 Ga0068861_100105846 3300005719 Unclassified 2246
75 Ga0068861_100107371 3300005719 Bacteria 2232
76 Ga0068851_10050974 3300005834 Bacteria 2102
77 Ga0068870_10016854 3300005840 Bacteria 3502
78 Ga0068870_10017913 3300005840 Bacteria 3410
79 Ga0068863_100004458 3300005841 Bacteria 13803
80 Ga0068863_100008511 3300005841 Bacteria 10020
81 Ga0068863_100055870 3300005841 Unclassified 3738
82 Ga0068863_100057681 3300005841 Bacteria 3674
83 Ga0068860_100008773 3300005843 Bacteria 10074
84 Ga0068860_100014270 3300005843 Bacteria 7790
85 Ga0068860_100038597 3300005843 Bacteria 4568
86 Ga0068862_100190880 3300005844 Bacteria 1843
87 Ga0068862_100219730 3300005844 Bacteria 1720
88 Ga0075366_10021520 3300006195 Bacteria 3749
89 Ga0097621_100136851 3300006237 Bacteria 2090
90 Ga0097621_100232846 3300006237 Bacteria 1608
91 Ga0068871_100008467 3300006358 Bacteria 7400
92 Ga0075428_100051774 3300006844 Unclassified 4503
93 Ga0075429_100135290 3300006880 Unclassified 2157
94 Ga0068865_100017416 3300006881 Bacteria 4620
95 Ga0097620_100033895 3300006931 Bacteria 5126
96 Ga0097620_100036908 3300006931 Bacteria 4905
97 Ga0097620_100039223 3300006931 Bacteria 4751
98 Ga0097620_100057629 3300006931 Bacteria 3913
99 Ga0097620_100070547 3300006931 Bacteria 3529
100 Ga0105244_10019715 3300009036 Bacteria 3758
101 Ga0105240_10031223 3300009093 Bacteria 6912
102 Ga0105240_10049015 3300009093 Bacteria 5335
103 Ga0111539_10002347 3300009094 Bacteria 25205
104 Ga0111539_10177954 3300009094 Bacteria 2485
105 Ga0105247_10003681 3300009101 Bacteria 9947
106 Ga0105247_10034075 3300009101 Bacteria 3101
107 Ga0114129_10004721 3300009147 Bacteria 19243
108 Ga0105242_10015276 3300009176 Bacteria 5962
109 Ga0105242_10023200 3300009176 Bacteria 4891
110 Ga0105242_10252191 3300009176 Bacteria 1590
111 Ga0105237_10000287 3300009545 Bacteria 69624
112 Ga0105237_10248767 3300009545 Bacteria 1779
113 Ga0105249_10035993 3300009553 Bacteria 4491
114 Ga0105249_10044366 3300009553 Bacteria 4043
115 Ga0105249_10056716 3300009553 Bacteria 3586
116 Ga0105239_10000440 3300010375 Bacteria 60691
117 Ga0105239_10000518 3300010375 Bacteria 55657
118 Ga0105239_10000619 3300010375 Bacteria 50485
119 Ga0105239_10010926 3300010375 Bacteria 10142
120 Ga0105246_10010039 3300011119 Bacteria 5842
121 Ga0157373_10040883 3300013100 Bacteria 3317
122 Ga0157373_10073470 3300013100 Bacteria 2413
123 Ga0157371_10000021 3300013102 Bacteria 301017
124 Ga0157371_10003966 3300013102 Bacteria 13129
125 Ga0157371_10197463 3300013102 Bacteria 1442
126 Ga0157370_10000073 3300013104 Bacteria 109460
127 Ga0157370_10000332 3300013104 Bacteria 59335
128 Ga0157370_10001446 3300013104 Bacteria 29376
129 Ga0157370_10007394 3300013104 Bacteria 11963
130 Ga0157370_10013044 3300013104 Bacteria 8581
131 Ga0157370_10175520 3300013104 Unclassified 1992
132 Ga0157370_10245994 3300013104 Unclassified 1654
133 Ga0157370_10319466 3300013104 Bacteria 1432
134 Ga0157369_10000117 3300013105 Bacteria 111900
135 Ga0157369_10000575 3300013105 Bacteria 48226
136 Ga0157369_10023264 3300013105 Bacteria 6903
137 Ga0157374_10040915 3300013296 Bacteria 4269
138 Ga0157374_10048144 3300013296 Bacteria 3955
139 Ga0157378_10121045 3300013297 Unclassified 2412
140 Ga0157378_10253049 3300013297 Bacteria 1687
141 Ga0163162_10000049 3300013306 Bacteria 122455
142 Ga0163162_10011716 3300013306 Bacteria 8553
143 Ga0163162_10032210 3300013306 Bacteria 5205
144 Ga0157372_10004867 3300013307 Bacteria 14272
145 Ga0157372_10017029 3300013307 Bacteria 7801
146 Ga0157372_10097806 3300013307 Bacteria 3348
147 Ga0157372_10183946 3300013307 Bacteria 2420
148 Ga0163163_10149203 3300014325 Bacteria 2382
149 Ga0163163_10401694 3300014325 Bacteria 1428
150 Ga0157380_10006904 3300014326 Bacteria 8030
151 Ga0157380_10025029 3300014326 Bacteria 4523
152 Ga0157380_10029538 3300014326 Unclassified 4190
153 Ga0182008_10000009 3300014497 Bacteria 331416
154 Ga0182008_10000403 3300014497 Bacteria 33487
155 Ga0157377_10017087 3300014745 Unclassified 3747
156 Ga0157377_10018382 3300014745 Unclassified 3631
157 Ga0157376_10102076 3300014969 Bacteria 2508
158 Ga0182006_1000232 3300015261 Bacteria 52928
159 Ga0182006_1000267 3300015261 Bacteria 47415
160 Ga0182006_1000716 3300015261 Bacteria 22948
161 Ga0182006_1003738 3300015261 Bacteria 7685
162 Ga0182006_1019328 3300015261 Bacteria 2867
163 Ga0182007_10000007 3300015262 Bacteria 376596
164 Ga0183373_1001 3300015682 Bacteria 1410374
165 Ga0163161_10000671 3300017792 Bacteria 27332
166 Ga0163161_10001970 3300017792 Bacteria 14895
167 Ga0163161_10023768 3300017792 Bacteria 4326
168 Ga0209437_100024 3300025233 Bacteria 592878
169 Ga0209646_1001726 3300025246 Bacteria 5520
170 Ga0209455_1006228 3300025272 Bacteria 3555
171 Ga0209676_1000008 3300025292 Bacteria 991778
172 Ga0209050_1000343 3300025298 Bacteria 92045
173 Ga0209050_1001952 3300025298 Bacteria 19511
174 Ga0207697_10060815 3300025315 Bacteria 1571
175 Ga0207656_10016169 3300025321 Bacteria 2901
176 Ga0207682_10025019 3300025893 Bacteria 2366
177 Ga0207642_10070750 3300025899 Bacteria 1659
178 Ga0207710_10000898 3300025900 Bacteria 15911
179 Ga0207710_10028995 3300025900 Bacteria 2405
180 Ga0207688_10030857 3300025901 Bacteria 2957
181 Ga0207688_10131305 3300025901 Bacteria 1468
182 Ga0207645_10000266 3300025907 Bacteria 43158
183 Ga0207645_10045800 3300025907 Bacteria 2795
184 Ga0207645_10079104 3300025907 Bacteria 2107
185 Ga0207643_10008981 3300025908 Bacteria 5365
186 Ga0207705_10219677 3300025909 Bacteria 1443
187 Ga0207695_10020429 3300025913 Bacteria 7585
188 Ga0207671_10003995 3300025914 Bacteria 14338
189 Ga0207671_10177033 3300025914 Bacteria 1658
190 Ga0207662_10052419 3300025918 Bacteria 2428
191 Ga0207649_10061634 3300025920 Bacteria 2362
192 Ga0207681_10031657 3300025923 Bacteria 3456
193 Ga0207650_10104347 3300025925 Bacteria 2187
194 Ga0207659_10056945 3300025926 Unclassified 2801
195 Ga0207659_10123427 3300025926 Unclassified 1988
196 Ga0207690_10000465 3300025932 Bacteria 26044
197 Ga0207690_10017965 3300025932 Bacteria 4330
198 Ga0207686_10000655 3300025934 Bacteria 21369
199 Ga0207686_10192285 3300025934 Bacteria 1455
200 Ga0207691_10017517 3300025940 Bacteria 6792
201 Ga0207691_10049852 3300025940 Bacteria 3835
202 Ga0207691_10101996 3300025940 Bacteria 2560
203 Ga0207691_10252753 3300025940 Bacteria 1521
204 Ga0207689_10064906 3300025942 Bacteria 3003
205 Ga0207689_10105311 3300025942 Bacteria 2317
206 Ga0207661_10107089 3300025944 Unclassified 2357
207 Ga0207679_10124603 3300025945 Unclassified 2057
208 Ga0207679_10186507 3300025945 Unclassified 1720
209 Ga0207679_10287731 3300025945 Bacteria 1412
210 Ga0207651_10015616 3300025960 Bacteria 4420
211 Ga0207651_10026739 3300025960 Bacteria 3611
212 Ga0207651_10072934 3300025960 Bacteria 2439
213 Ga0207651_10097474 3300025960 Bacteria 2171
214 Ga0207712_10008426 3300025961 Bacteria 6516
215 Ga0207712_10036743 3300025961 Bacteria 3338
216 Ga0207668_10127248 3300025972 Bacteria 1939
217 Ga0207640_10051586 3300025981 Unclassified 2675
218 Ga0207658_10023048 3300025986 Bacteria 4341
219 Ga0207658_10025555 3300025986 Bacteria 4135
220 Ga0207658_10112738 3300025986 Bacteria 2153
221 Ga0207677_10010982 3300026023 Bacteria 5144
222 Ga0207677_10077737 3300026023 Bacteria 2367
223 Ga0207703_10200618 3300026035 Bacteria 1773
224 Ga0207639_10026016 3300026041 Bacteria 4249
225 Ga0207639_10109330 3300026041 Bacteria 2249
226 Ga0207708_10147987 3300026075 Bacteria 1847
227 Ga0207641_10000810 3300026088 Bacteria 33309
228 Ga0207641_10017153 3300026088 Bacteria 5923
229 Ga0207641_10177464 3300026088 Bacteria 1948
230 Ga0207648_10000356 3300026089 Bacteria 50430
231 Ga0207648_10027382 3300026089 Bacteria 5059
232 Ga0207676_10095530 3300026095 Bacteria 2451
233 Ga0207674_10009917 3300026116 Bacteria 10837
234 Ga0207674_10037862 3300026116 Bacteria 5011
235 Ga0207675_100001377 3300026118 Bacteria 24367
236 Ga0207675_100005780 3300026118 Bacteria 11828
237 Ga0207675_100025091 3300026118 Bacteria 5548
238 Ga0207675_100110353 3300026118 Bacteria 2595
239 Ga0207675_100219305 3300026118 Bacteria 1832
240 Ga0207683_10028145 3300026121 Bacteria 4859
241 Ga0207683_10051591 3300026121 Bacteria 3604
242 Ga0207683_10056339 3300026121 Unclassified 3447
243 Ga0209974_10030589 3300027876 Bacteria 1784
244 Ga0207428_10150272 3300027907 Bacteria 1773
245 Ga0268264_10023890 3300028381 Bacteria 4986
246 Ga0265327_10001111 3300031251 Bacteria 37197
247 Ga0265327_10080035 3300031251 Bacteria 1616
248 Ga0307513_10028855 3300031456 Bacteria 6336
249 Ga0307509_10044703 3300031507 Bacteria 4783
250 Ga0307408_100003872 3300031548 Bacteria 10189
251 Ga0307408_100009849 3300031548 Bacteria 6300
252 Ga0307516_10144454 3300031730 Bacteria 2146
253 Ga0307405_10000002 3300031731 Bacteria 575196
254 Ga0307410_10000074 3300031852 Bacteria 34345
255 Ga0307406_10014604 3300031901 Bacteria 4522
256 Ga0307412_10000782 3300031911 Bacteria 18379
257 Ga0307412_10207870 3300031911 Bacteria 1491
258 Ga0307414_10000131 3300032004 Bacteria 51831
259 Ga0307414_10001835 3300032004 Bacteria 10977
260 Ga0307414_10181105 3300032004 Unclassified 1695
261 Ga0436365_1743396 3300039437 Bacteria 55864
262 Ga0451798_0037635 3300041458 Bacteria 1501
263 Ga0451577_0060157 3300042876 Bacteria 3387
264 Ga0453683_0090504 3300044673 Bacteria 1918
265 Ga0495638_0000015 3300046460 Bacteria 414645
266 Ga0495651_0051379 3300046462 Bacteria 3178
267 Ga0495650_0000036 3300046471 Bacteria 400633
268 Ga0495606_0000143 3300046507 Bacteria 123231
269 Ga0495606_0004123 3300046507 Bacteria 14756
270 Ga0495610_0000025 3300046512 Bacteria 301208
271 Ga0495610_0001642 3300046512 Bacteria 19658
272 Ga0495610_0001747 3300046512 Bacteria 19026
273 Ga0495616_0008524 3300046513 Bacteria 6062
274 Ga0495643_0011106 3300046522 Bacteria 5505
275 Ga0495648_0010424 3300046524 Bacteria 7079
276 Ga0495648_0011643 3300046524 Bacteria 6608
277 Ga0495654_0000001 3300046530 Bacteria 1513197
278 Ga0495621_0031576 3300046539 Bacteria 1818
279 Ga0495633_0024395 3300046558 Bacteria 2989
280 Ga0495668_0000011 3300046616 Bacteria 472186
281 Ga0495625_0000009 3300046660 Bacteria 404954
282 Ga0495661_0016299 3300046665 Bacteria 4929
283 Ga0495671_0099231 3300046692 Bacteria 1424
284 Ga0495649_0000008 3300046694 Bacteria 483706
285 Ga0495687_005561 3300047443 Bacteria 7988
286 Ga0495686_0008685 3300047472 Bacteria 7416
287 Ga0496116_0000390 3300048919 Bacteria 64244
288 Ga0496121_0000026 3300048924 Bacteria 450157
289 Ga0496124_0125960 3300048927 Bacteria 2040
290 Ga0496125_0000567 3300048928 Bacteria 63543
291 Ga0496126_0000804 3300048929 Bacteria 56196
292 Ga0496126_0002856 3300048929 Bacteria 22579
293 Ga0501249_000001 3300049679 Bacteria 268580
294 Ga0501259_009908 3300049688 Unclassified 1551
295 Ga0501280_000905 3300049776 Bacteria 6315
296 nmdc:mga0k408_30718_c1 3300050493 Bacteria 3064
297 nmdc:mga05p37_2379_c3 3300050507 Bacteria 13704
298 nmdc:mga08y16_72114_c1 3300050511 Unclassified 3599
299 Ga0500578_0000144 3300053086 Bacteria 85335
300 Ga0500583_0000060 3300053092 Bacteria 68112
301 Ga0500641_0000014 3300053096 Bacteria 150696
302 Ga0500641_0000017 3300053096 Bacteria 132678
303 Ga0500641_0025027 3300053096 Bacteria 2307
304 Ga0500658_0000003 3300053134 Bacteria 512506
305 Ga0500568_0000407 3300053139 Bacteria 32843
306 Ga0500604_0000588 3300053151 Bacteria 9971
307 Ga0500622_0000004 3300053156 Bacteria 557587
308 Ga0500622_0000008 3300053156 Bacteria 423636
309 Ga0500584_032153 3300053726 Bacteria 2433
310 2599478096 2599185184 Bacteria 6430550
311 2644008798 2643221600 Bacteria 5530138
312 2644372564 2643221667 Bacteria 5627472
313 2644640781 2643221716 Bacteria 4986332
314 2644683207 2643221725 Bacteria 5087956
315 2738758778 2738541283 Bacteria 7222293
316 2738852231 2738541302 Bacteria 5944758
317 2739300314 2738543023 Bacteria 6767879
318 2739589410 2739367651 Bacteria 6359826
319 2776614292 2775506987 Bacteria 5373360
320 2802652903 2802428842 Bacteria 4926114
321 2817416176 2816332280 Bacteria 5109718
322 2819549360 2818991437 Bacteria 5805520
323 2819679583 2818991460 Bacteria 7595395
324 2849285494 2849281842 Bacteria 6065644
325 2881363345 2881359912 Bacteria 4935907
326 2904421301 2904419702 Bacteria 5166287
327 2919195432 2919191525 Bacteria 5765973
328 2928147484 2928147474 Bacteria 6512076
329 2932083595 2932082852 Bacteria 6563563
330 2958461008 2958458903 Bacteria 5301041
331 2958462970 2958458903 Bacteria 5301041
332 2965320916 2965320100 Bacteria 3975600
333 2977232100 2977232053 Bacteria 5485925
334 2977270996 2977268062 Bacteria 5243061
335 2993374349 2993372514 Bacteria 4214139
336 2993481239 2993480792 Bacteria 4022225
337 8054310218 8054307821 Bacteria 5212224
338 8056442457 8056440228 Bacteria 4946504
339 Ga0068864_100006576
340 SwRhRL2b_contig_188096
341 SwRhRL2b_contig_2054166
342 JGI24735J21928_10000002
343 JGI24751J29686_10000335
344 JGI25162J39368_1000283
345 rootH1_10028597
346 rootL2_10240447
347 rootH1_10020638
348 rootH1_10071036
349 rootH1_10206786
350 Ga0006562J51391_1007671
351 Ga0055529_1009013
352 Ga0055536_1000001
353 Ga0055530_10007469
354 Ga0065714_10002228
355 Ga0065714_10064438
356 Ga0065704_10000619
357 Ga0065704_10072845
358 Ga0065712_10068516
359 Ga0065712_10094543
360 Ga0065712_10120708
361 Ga0070658_10292269
362 Ga0070676_10041377
363 Ga0070683_100004241
364 Ga0068869_100013801
365 Ga0068869_100055819
366 Ga0070666_10010327
367 Ga0068868_100001364
368 Ga0068868_100001827
369 Ga0068868_100197168
370 Ga0070661_100008691
371 Ga0070668_100012840
372 Ga0070668_100018978
373 Ga0070669_100005547
374 Ga0070675_100055191
375 Ga0070675_100073502
376 Ga0070675_100111251
377 Ga0070674_100004584
378 Ga0070674_100048137
379 Ga0070673_100010837
380 Ga0070673_100033938
381 Ga0070673_100170970
382 Ga0070688_100032429
383 Ga0070688_100066138
384 Ga0070659_100000119
385 Ga0070659_100027064
386 Ga0070667_100008992
387 Ga0070667_100036792
388 Ga0068867_100019480
389 Ga0070685_10001005
390 Ga0070706_100373622
391 Ga0070698_100266966
392 Ga0070684_100007775
393 Ga0070684_100060198
394 Ga0068853_100003693
395 Ga0068853_100016705
396 Ga0070672_100073674
397 Ga0070672_100102919
398 Ga0070686_100022468
399 Ga0070686_100044326
400 Ga0070664_100005482
401 Ga0070664_100057995
402 Ga0068857_100037285
403 Ga0068854_100132129
404 Ga0068856_100060690
405 Ga0068859_100033898
406 Ga0068859_100036909
407 Ga0068859_100039224
408 Ga0068859_100057629
409 Ga0068859_100070549
410 Ga0068864_100060867
411 Ga0068861_100068231
412 Ga0068861_100105846
413 Ga0068861_100107371
414 Ga0068851_10050974
415 Ga0068870_10016854
416 Ga0068870_10017913
417 Ga0068863_100004458
418 Ga0068863_100008511
419 Ga0068863_100055870
420 Ga0068863_100057681
421 Ga0068860_100008773
422 Ga0068860_100014270
423 Ga0068860_100038597
424 Ga0068862_100190880
425 Ga0068862_100219730
426 Ga0075366_10021520
427 Ga0097621_100136851
428 Ga0097621_100232846
429 Ga0068871_100008467
430 Ga0075428_100051774
431 Ga0075429_100135290
432 Ga0068865_100017416
433 Ga0097620_100033895
434 Ga0097620_100036908
435 Ga0097620_100039223
436 Ga0097620_100057629
437 Ga0097620_100070547
438 Ga0105244_10019715
439 Ga0105240_10031223
440 Ga0105240_10049015
441 Ga0111539_10002347
442 Ga0111539_10177954
443 Ga0105247_10003681
444 Ga0105247_10034075
445 Ga0114129_10004721
446 Ga0105242_10015276
447 Ga0105242_10023200
448 Ga0105242_10252191
449 Ga0105237_10000287
450 Ga0105237_10248767
451 Ga0105249_10035993
452 Ga0105249_10044366
453 Ga0105249_10056716
454 Ga0105239_10000440
455 Ga0105239_10000518
456 Ga0105239_10000619
457 Ga0105239_10010926
458 Ga0105246_10010039
459 Ga0157373_10040883
460 Ga0157373_10073470
461 Ga0157371_10000021
462 Ga0157371_10003966
463 Ga0157371_10197463
464 Ga0157370_10000073
465 Ga0157370_10000332
466 Ga0157370_10001446
467 Ga0157370_10007394
468 Ga0157370_10013044
469 Ga0157370_10175520
470 Ga0157370_10245994
471 Ga0157370_10319466
472 Ga0157369_10000117
473 Ga0157369_10000575
474 Ga0157369_10023264
475 Ga0157374_10040915
476 Ga0157374_10048144
477 Ga0157378_10121045
478 Ga0157378_10253049
479 Ga0163162_10000049
480 Ga0163162_10011716
481 Ga0163162_10032210
482 Ga0157372_10004867
483 Ga0157372_10017029
484 Ga0157372_10097806
485 Ga0157372_10183946
486 Ga0163163_10149203
487 Ga0163163_10401694
488 Ga0157380_10006904
489 Ga0157380_10025029
490 Ga0157380_10029538
491 Ga0182008_10000009
492 Ga0182008_10000403
493 Ga0157377_10017087
494 Ga0157377_10018382
495 Ga0157376_10102076
496 Ga0182006_1000232
497 Ga0182006_1000267
498 Ga0182006_1000716
499 Ga0182006_1003738
500 Ga0182006_1019328
501 Ga0182007_10000007
502 Ga0183373_1001
503 Ga0163161_10000671
504 Ga0163161_10001970
505 Ga0163161_10023768
506 Ga0209437_100024
507 Ga0209646_1001726
508 Ga0209455_1006228
509 Ga0209676_1000008
510 Ga0209050_1000343
511 Ga0209050_1001952
512 Ga0207697_10060815
513 Ga0207656_10016169
514 Ga0207682_10025019
515 Ga0207642_10070750
516 Ga0207710_10000898
517 Ga0207710_10028995
518 Ga0207688_10030857
519 Ga0207688_10131305
520 Ga0207645_10000266
521 Ga0207645_10045800
522 Ga0207645_10079104
523 Ga0207643_10008981
524 Ga0207705_10219677
525 Ga0207695_10020429
526 Ga0207671_10003995
527 Ga0207671_10177033
528 Ga0207662_10052419
529 Ga0207649_10061634
530 Ga0207681_10031657
531 Ga0207650_10104347
532 Ga0207659_10056945
533 Ga0207659_10123427
534 Ga0207690_10000465
535 Ga0207690_10017965
536 Ga0207686_10000655
537 Ga0207686_10192285
538 Ga0207691_10017517
539 Ga0207691_10049852
540 Ga0207691_10101996
541 Ga0207691_10252753
542 Ga0207689_10064906
543 Ga0207689_10105311
544 Ga0207661_10107089
545 Ga0207679_10124603
546 Ga0207679_10186507
547 Ga0207679_10287731
548 Ga0207651_10015616
549 Ga0207651_10026739
550 Ga0207651_10072934
551 Ga0207651_10097474
552 Ga0207712_10008426
553 Ga0207712_10036743
554 Ga0207668_10127248
555 Ga0207640_10051586
556 Ga0207658_10023048
557 Ga0207658_10025555
558 Ga0207658_10112738
559 Ga0207677_10010982
560 Ga0207677_10077737
561 Ga0207703_10200618
562 Ga0207639_10026016
563 Ga0207639_10109330
564 Ga0207708_10147987
565 Ga0207641_10000810
566 Ga0207641_10017153
567 Ga0207641_10177464
568 Ga0207648_10000356
569 Ga0207648_10027382
570 Ga0207676_10095530
571 Ga0207674_10009917
572 Ga0207674_10037862
573 Ga0207675_100001377
574 Ga0207675_100005780
575 Ga0207675_100025091
576 Ga0207675_100110353
577 Ga0207675_100219305
578 Ga0207683_10028145
579 Ga0207683_10051591
580 Ga0207683_10056339
581 Ga0209974_10030589
582 Ga0207428_10150272
583 Ga0268264_10023890
584 Ga0265327_10001111
585 Ga0265327_10080035
586 Ga0307513_10028855
587 Ga0307509_10044703
588 Ga0307408_100003872
589 Ga0307408_100009849
590 Ga0307516_10144454
591 Ga0307405_10000002
592 Ga0307410_10000074
593 Ga0307406_10014604
594 Ga0307412_10000782
595 Ga0307412_10207870
596 Ga0307414_10000131
597 Ga0307414_10001835
598 Ga0307414_10181105
599 Ga0436365_1743396
600 Ga0451798_0037635
601 Ga0451577_0060157
602 Ga0453683_0090504
603 Ga0495638_0000015
604 Ga0495651_0051379
605 Ga0495650_0000036
606 Ga0495606_0000143
607 Ga0495606_0004123
608 Ga0495610_0000025
609 Ga0495610_0001642
610 Ga0495610_0001747
611 Ga0495616_0008524
612 Ga0495643_0011106
613 Ga0495648_0010424
614 Ga0495648_0011643
615 Ga0495654_0000001
616 Ga0495621_0031576
617 Ga0495633_0024395
618 Ga0495668_0000011
619 Ga0495625_0000009
620 Ga0495661_0016299
621 Ga0495671_0099231
622 Ga0495649_0000008
623 Ga0495687_005561
624 Ga0495686_0008685
625 Ga0496116_0000390
626 Ga0496121_0000026
627 Ga0496124_0125960
628 Ga0496125_0000567
629 Ga0496126_0000804
630 Ga0496126_0002856
631 Ga0501249_000001
632 Ga0501259_009908
633 Ga0501280_000905
634 nmdc:mga0k408_30718_c1
635 nmdc:mga05p37_2379_c3
636 nmdc:mga08y16_72114_c1
637 Ga0500578_0000144
638 Ga0500583_0000060
639 Ga0500641_0000014
640 Ga0500641_0000017
641 Ga0500641_0025027
642 Ga0500658_0000003
643 Ga0500568_0000407
644 Ga0500604_0000588
645 Ga0500622_0000004
646 Ga0500622_0000008
647 Ga0500584_032153
648 2599478096
649 2644008798
650 2644372564
651 2644640781
652 2644683207
653 2738758778
654 2738852231
655 2739300314
656 2739589410
657 2776614292
658 2802652903
659 2817416176
660 2819549360
661 2819679583
662 2849285494
663 2881363345
664 2904421301
665 2919195432
666 2928147484
667 2932083595
668 2958461008
669 2958462970
670 2965320916
671 2977232100
672 2977270996
673 2993374349
674 2993481239
675 8054310218
676 8056442457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12094

DUF3570

Protein of unknown function (DUF3570)

104

414

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x9k-assembly1.cif.gz_A structure of a e.coli porin 0.6246 36 405
2x9k-assembly1.cif.gz_A structure of a e.coli porin 0.619 36 405
4ctd-assembly1.cif.gz_B x-ray structure of an engineered ompg loop6-deletion 0.6176 42 404
4ctd-assembly1.cif.gz_A x-ray structure of an engineered ompg loop6-deletion 0.6164 42 404
2wvp-assembly1.cif.gz_A synthetically modified ompg 0.6103 42 404
ID Description Score Start End Superfamily
af_Q9M2W6_94_225_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6832 157 323 2.40.160.10
af_Q47534_18_255_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.655 38 404 2.40.160.10
af_Q47534_18_255_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6503 38 404 2.40.160.10
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6176 42 404 2.40.160.40
af_P69434_524_807_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6146 53 405 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A4Q3RGB4-F1-model_v4 DUF3570 domain-containing protein 0.9923 212 406
AF-A0A4Q3NVH1-F1-model_v4 deleted 0.9898 212 406
AF-A0A520DXW1-F1-model_v4 DUF3570 domain-containing protein 0.9883 235 406
AF-A0A381FR98-F1-model_v4 Protein of uncharacterized function (DUF3570) 0.982 143 406
AF-A0A519MNM6-F1-model_v4 DUF3570 domain-containing protein 0.9819 296 406

Map