F413392

General Info

Members Datasets Scaffolds Average Seq Length
338 199 676 142

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10001150|Ga0070709_100011506
Length 165
Sequence MRKADGKAVGLRSFFALYPLPSTRMRSLLTRRVSFAAAHRYRVAAWSDERNEEVFGLCARPSYHGHSYICDVTVSGEIDPATGMIVDLALLDRILRDEVRERFDHRNINLDVPEFGEGRLVPTGENLARFIYQRVALGLSSAGSAARVTKIIVAEDATLSASYEE

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
183 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
184 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
185 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
189 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
190 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 23.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10001150 3300005434 Bacteria 14553
2 rootH1_10192815 3300003323 Bacteria 1034
3 Ga0070658_10005761 3300005327 Bacteria 10049
4 Ga0070658_10318906 3300005327 Bacteria 1327
5 Ga0070658_10436291 3300005327 Archaea 1128
6 Ga0070683_100000735 3300005329 Bacteria 23965
7 Ga0070683_100075573 3300005329 Unclassified 3148
8 Ga0070690_100297348 3300005330 Unclassified 1156
9 Ga0070666_10360820 3300005335 Bacteria 1041
10 Ga0070680_100003584 3300005336 Bacteria 11593
11 Ga0070680_100484859 3300005336 Bacteria 1057
12 Ga0070680_100676988 3300005336 Bacteria 887
13 Ga0070682_100001462 3300005337 Bacteria 13247
14 Ga0070682_100008410 3300005337 Bacteria 5821
15 Ga0070682_100032426 3300005337 Bacteria 3168
16 Ga0070660_100002151 3300005339 Bacteria 13596
17 Ga0070660_101095379 3300005339 Bacteria 674
18 Ga0070661_100889367 3300005344 Bacteria 735
19 Ga0070661_101386233 3300005344 Unclassified 591
20 Ga0070692_10023603 3300005345 Bacteria 3014
21 Ga0070671_100440954 3300005355 Bacteria 1116
22 Ga0070659_100004277 3300005366 Bacteria 10191
23 Ga0070659_100130760 3300005366 Bacteria 2039
24 Ga0070659_100206034 3300005366 Unclassified 1620
25 Ga0070667_100399643 3300005367 Unclassified 1251
26 Ga0070709_10053272 3300005434 Unclassified 2547
27 Ga0070709_10096854 3300005434 Bacteria 1957
28 Ga0070714_100013071 3300005435 Bacteria 6645
29 Ga0070713_100000149 3300005436 Bacteria 46694
30 Ga0070713_100072085 3300005436 Bacteria 2921
31 Ga0070713_100077896 3300005436 Bacteria 2820
32 Ga0070713_100243825 3300005436 Bacteria 1637
33 Ga0070713_100313726 3300005436 Unclassified 1447
34 Ga0070710_10020199 3300005437 Bacteria 3452
35 Ga0070710_10037514 3300005437 Bacteria 2657
36 Ga0070711_100217142 3300005439 Bacteria 1484
37 Ga0070711_101862582 3300005439 Unclassified 528
38 Ga0070694_100367765 3300005444 Bacteria 1118
39 Ga0070708_101354064 3300005445 Unclassified 664
40 Ga0070663_100392060 3300005455 Archaea 1133
41 Ga0070678_102160091 3300005456 Unclassified 528
42 Ga0070681_10000604 3300005458 Bacteria 29582
43 Ga0070681_10003103 3300005458 Bacteria 15433
44 Ga0070681_10072097 3300005458 Bacteria 3417
45 Ga0070681_10670634 3300005458 Unclassified 952
46 Ga0068867_100255153 3300005459 Bacteria 1427
47 Ga0070707_100754859 3300005468 Bacteria 936
48 Ga0070698_100260247 3300005471 Unclassified 1667
49 Ga0070698_100278887 3300005471 Unclassified 1603
50 Ga0070699_100053043 3300005518 Bacteria 3510
51 Ga0070699_100093187 3300005518 Bacteria 2635
52 Ga0070699_100847378 3300005518 Unclassified 837
53 Ga0070679_100005974 3300005530 Bacteria 11315
54 Ga0070679_100011051 3300005530 Bacteria 8588
55 Ga0070679_100030321 3300005530 Bacteria 5341
56 Ga0070679_100070974 3300005530 Bacteria 3473
57 Ga0070679_100145666 3300005530 Bacteria 2346
58 Ga0070679_100420633 3300005530 Unclassified 1282
59 Ga0070679_101094300 3300005530 Bacteria 742
60 Ga0070684_100000446 3300005535 Bacteria 28217
61 Ga0070684_101285453 3300005535 Unclassified 688
62 Ga0070697_100357706 3300005536 Unclassified 1262
63 Ga0068853_100295601 3300005539 Bacteria 1496
64 Ga0068853_100632054 3300005539 Archaea 1018
65 Ga0068853_100703892 3300005539 Bacteria 964
66 Ga0068853_101025476 3300005539 Unclassified 795
67 Ga0070672_100257912 3300005543 Unclassified 1470
68 Ga0070672_100590968 3300005543 Unclassified 966
69 Ga0070695_100335556 3300005545 Bacteria 1128
70 Ga0070695_101374195 3300005545 Bacteria 585
71 Ga0070693_100022304 3300005547 Bacteria 3364
72 Ga0070693_100289487 3300005547 Unclassified 1100
73 Ga0070693_100508096 3300005547 Bacteria 856
74 Ga0068855_100199368 3300005563 Bacteria 2254
75 Ga0068855_100450794 3300005563 Bacteria 1404
76 Ga0068855_101047315 3300005563 Bacteria 855
77 Ga0068855_101078599 3300005563 Unclassified 840
78 Ga0070664_100001694 3300005564 Bacteria 17664
79 Ga0070664_100020920 3300005564 Bacteria 5390
80 Ga0070664_101488002 3300005564 Unclassified 641
81 Ga0068857_100001807 3300005577 Bacteria 17206
82 Ga0068856_100508160 3300005614 Bacteria 1226
83 Ga0068856_100613910 3300005614 Bacteria 1108
84 Ga0068856_101471349 3300005614 Unclassified 695
85 Ga0068852_100033063 3300005616 Bacteria 4290
86 Ga0068852_100417951 3300005616 Bacteria 1322
87 Ga0068852_100648110 3300005616 Archaea 1063
88 Ga0068864_100594988 3300005618 Bacteria 1073
89 Ga0068864_101508587 3300005618 Unclassified 675
90 Ga0068864_102346132 3300005618 Unclassified 540
91 Ga0068861_101402120 3300005719 Unclassified 683
92 Ga0068863_101162961 3300005841 Unclassified 777
93 Ga0068858_100975259 3300005842 Unclassified 830
94 Ga0070717_10005301 3300006028 Bacteria 9401
95 Ga0070717_10540151 3300006028 Unclassified 1055
96 Ga0070716_100670613 3300006173 Unclassified 789
97 Ga0070712_100646083 3300006175 Unclassified 898
98 Ga0075430_100234966 3300006846 Bacteria 1520
99 Ga0075434_100076848 3300006871 Bacteria 3334
100 Ga0075434_100312361 3300006871 Bacteria 1592
101 Ga0075434_100920120 3300006871 Bacteria 889
102 Ga0075434_101050075 3300006871 Bacteria 828
103 Ga0075429_100854991 3300006880 Bacteria 796
104 Ga0075436_100340049 3300006914 Unclassified 1080
105 Ga0075435_100085974 3300007076 Unclassified 2589
106 Ga0075435_100263719 3300007076 Unclassified 1468
107 Ga0075435_100512060 3300007076 Bacteria 1038
108 Ga0105245_10113403 3300009098 Bacteria 2524
109 Ga0105248_10575142 3300009177 Bacteria 1271
110 Ga0105248_11186071 3300009177 Unclassified 863
111 Ga0105238_10151573 3300009551 Bacteria 2293
112 Ga0105238_10731885 3300009551 Bacteria 1002
113 Ga0105239_13570879 3300010375 Bacteria 505
114 Ga0105246_10037331 3300011119 Unclassified 3261
115 Ga0157373_10071531 3300013100 Bacteria 2449
116 Ga0157373_10113220 3300013100 Bacteria 1907
117 Ga0157373_10451824 3300013100 Unclassified 925
118 Ga0157371_10119958 3300013102 Archaea 1870
119 Ga0157371_10288435 3300013102 Bacteria 1186
120 Ga0157371_11032097 3300013102 Bacteria 628
121 Ga0157369_10046390 3300013105 Bacteria 4722
122 Ga0157369_10404292 3300013105 Archaea 1416
123 Ga0157374_10077049 3300013296 Bacteria 3154
124 Ga0157374_10452769 3300013296 Bacteria 1285
125 Ga0157372_10067525 3300013307 Bacteria 4018
126 Ga0157372_10087741 3300013307 Bacteria 3530
127 Ga0157372_10113707 3300013307 Unclassified 3102
128 Ga0157372_10116665 3300013307 Unclassified 3061
129 Ga0157372_10140122 3300013307 Bacteria 2786
130 Ga0157372_10790722 3300013307 Bacteria 1103
131 Ga0157372_11217512 3300013307 Bacteria 870
132 Ga0157375_10199056 3300013308 Bacteria 2158
133 Ga0157375_10734818 3300013308 Unclassified 1139
134 Ga0182008_10059207 3300014497 Unclassified 1890
135 Ga0182007_10328633 3300015262 Unclassified 568
136 Ga0206353_10058062 3300020082 Bacteria 759
137 Ga0206353_10296359 3300020082 Archaea 739
138 Ga0206353_11288912 3300020082 Unclassified 555
139 Ga0207692_10328840 3300025898 Unclassified 937
140 Ga0207680_10507944 3300025903 Unclassified 859
141 Ga0207699_10005362 3300025906 Bacteria 6145
142 Ga0207699_10043655 3300025906 Bacteria 2606
143 Ga0207699_10092881 3300025906 Bacteria 1898
144 Ga0207699_10109843 3300025906 Bacteria 1765
145 Ga0207645_10754321 3300025907 Bacteria 662
146 Ga0207705_10002963 3300025909 Bacteria 12977
147 Ga0207705_10018679 3300025909 Bacteria 4959
148 Ga0207705_10070389 3300025909 Bacteria 2535
149 Ga0207654_10814480 3300025911 Bacteria 675
150 Ga0207707_10001370 3300025912 Bacteria 22592
151 Ga0207707_10002937 3300025912 Bacteria 15184
152 Ga0207707_10004092 3300025912 Bacteria 12919
153 Ga0207707_10103809 3300025912 Bacteria 2484
154 Ga0207707_10489192 3300025912 Bacteria 1050
155 Ga0207695_10007739 3300025913 Bacteria 13612
156 Ga0207693_10049506 3300025915 Bacteria 3299
157 Ga0207663_10125398 3300025916 Unclassified 1765
158 Ga0207660_10036852 3300025917 Bacteria 3403
159 Ga0207660_10190600 3300025917 Bacteria 1596
160 Ga0207660_10483511 3300025917 Bacteria 1004
161 Ga0207657_10034705 3300025919 Bacteria 4532
162 Ga0207657_10826997 3300025919 Bacteria 715
163 Ga0207649_10014568 3300025920 Bacteria 4404
164 Ga0207649_10134781 3300025920 Unclassified 1682
165 Ga0207649_10268791 3300025920 Unclassified 1235
166 Ga0207652_10007815 3300025921 Bacteria 8590
167 Ga0207652_10019088 3300025921 Bacteria 5633
168 Ga0207652_10225662 3300025921 Archaea 1688
169 Ga0207652_10359920 3300025921 Bacteria 1313
170 Ga0207652_11370397 3300025921 Bacteria 610
171 Ga0207687_11319846 3300025927 Bacteria 620
172 Ga0207700_10000713 3300025928 Bacteria 19212
173 Ga0207700_10102913 3300025928 Bacteria 2282
174 Ga0207700_10240411 3300025928 Bacteria 1543
175 Ga0207700_10254569 3300025928 Bacteria 1501
176 Ga0207664_10095196 3300025929 Unclassified 2449
177 Ga0207664_10184268 3300025929 Bacteria 1794
178 Ga0207644_10627975 3300025931 Unclassified 893
179 Ga0207644_10658047 3300025931 Unclassified 872
180 Ga0207690_10113739 3300025932 Archaea 1953
181 Ga0207665_10250321 3300025939 Bacteria 1309
182 Ga0207691_10069026 3300025940 Unclassified 3193
183 Ga0207691_10284740 3300025940 Unclassified 1422
184 Ga0207661_10000302 3300025944 Bacteria 31330
185 Ga0207661_10106960 3300025944 Bacteria 2359
186 Ga0207661_10220175 3300025944 Bacteria 1677
187 Ga0207661_10368458 3300025944 Bacteria 1298
188 Ga0207679_10420541 3300025945 Bacteria 1179
189 Ga0207679_10551833 3300025945 Bacteria 1034
190 Ga0207667_10131173 3300025949 Bacteria 2581
191 Ga0207667_10212926 3300025949 Unclassified 1980
192 Ga0207667_10394174 3300025949 Bacteria 1410
193 Ga0207667_10449756 3300025949 Bacteria 1309
194 Ga0207651_10198441 3300025960 Unclassified 1606
195 Ga0207640_10131313 3300025981 Bacteria 1811
196 Ga0207658_10374623 3300025986 Unclassified 1245
197 Ga0207639_10020579 3300026041 Bacteria 4724
198 Ga0207678_10083400 3300026067 Bacteria 2734
199 Ga0207678_10387303 3300026067 Archaea 1209
200 Ga0207702_10324953 3300026078 Bacteria 1466
201 Ga0207702_11585011 3300026078 Archaea 648
202 Ga0207648_10239948 3300026089 Bacteria 1613
203 Ga0207676_10470085 3300026095 Bacteria 1189
204 Ga0207676_11210460 3300026095 Unclassified 749
205 Ga0207674_10018768 3300026116 Bacteria 7504
206 Ga0207683_11276212 3300026121 Unclassified 680
207 Ga0207698_10274025 3300026142 Bacteria 1557
208 Ga0207698_10429366 3300026142 Bacteria 1270
209 Ga0207698_11960082 3300026142 Archaea 600
210 Ga0307408_100030994 3300031548 Bacteria 3719
211 Ga0307408_101054444 3300031548 Bacteria 752
212 Ga0307405_10023064 3300031731 Bacteria 3530
213 Ga0307413_10000344 3300031824 Bacteria 14717
214 Ga0307413_11368560 3300031824 Unclassified 621
215 Ga0307413_11667368 3300031824 Bacteria 568
216 Ga0307410_10047808 3300031852 Bacteria 2861
217 Ga0307410_10658106 3300031852 Unclassified 879
218 Ga0307410_10669070 3300031852 Bacteria 872
219 Ga0307410_10718524 3300031852 Bacteria 843
220 Ga0307406_10010144 3300031901 Bacteria 5307
221 Ga0307407_10010720 3300031903 Bacteria 4332
222 Ga0307407_10620067 3300031903 Bacteria 807
223 Ga0307412_10008831 3300031911 Bacteria 5770
224 Ga0307409_100102862 3300031995 Bacteria 2374
225 Ga0307416_100078372 3300032002 Bacteria 2779
226 Ga0307416_100150443 3300032002 Bacteria 2134
227 Ga0307416_100634810 3300032002 Bacteria 1151
228 Ga0307414_10020674 3300032004 Bacteria 4108
229 Ga0307411_10009766 3300032005 Bacteria 5069
230 Ga0307415_100065098 3300032126 Bacteria 2538
231 Ga0307415_100548445 3300032126 Unclassified 1020
232 Ga0307415_100900667 3300032126 Bacteria 815
233 Ga0373926_0007211 3300035083 Bacteria 3704
234 Ga0373934_0004528 3300035086 Bacteria 5135
235 Ga0373944_0021990 3300035089 Bacteria 1850
236 Ga0373923_0000392 3300035111 Bacteria 10100
237 Ga0373936_0045282 3300035113 Bacteria 1772
238 Ga0373936_0410562 3300035113 Bacteria 622
239 Ga0373945_0017158 3300035116 Bacteria 2450
240 Ga0373953_0014421 3300035117 Bacteria 2842
241 Ga0373954_0112870 3300035118 Unclassified 1315
242 Ga0373956_0002181 3300035119 Bacteria 8074
243 Ga0373957_0018140 3300035120 Bacteria 2460
244 Ga0373943_0002300 3300035170 Bacteria 8678
245 Ga0373946_0026174 3300035171 Bacteria 2299
246 Ga0373955_0001505 3300035172 Bacteria 9929
247 Ga0373924_0003667 3300035410 Bacteria 5297
248 Ga0373935_0000974 3300035692 Bacteria 15538
249 Ga0373927_0006357 3300035695 Bacteria 8049
250 Ga0373933_0000033 3300035724 Bacteria 84415
251 Ga0373947_0044129 3300035725 Bacteria 2663
252 Ga0373937_0000158 3300036401 Bacteria 65505
253 Ga0373925_0001104 3300037068 Bacteria 24089
254 Ga0395900_1223035 3300037418 Bacteria 666
255 Ga0395905_0858999 3300037471 Bacteria 810
256 Ga0436364_0054899 3300037853 Bacteria 1177
257 Ga0395901_0530847 3300038443 Bacteria 1194
258 Ga0439461_0006582 3300041410 Bacteria 2030
259 Ga0439446_0016947 3300042156 Bacteria 2033
260 Ga0466969_0354185 3300044656 Bacteria 665
261 Ga0466964_0150608 3300044706 Unclassified 1078
262 Ga0466957_0196083 3300044842 Bacteria 1325
263 Ga0466957_0748605 3300044842 Unclassified 692
264 Ga0466959_0053241 3300045049 Unclassified 2959
265 Ga0466959_0212248 3300045049 Bacteria 1345
266 Ga0466958_0343838 3300045836 Bacteria 960
267 Ga0466958_0456293 3300045836 Unclassified 828
268 Ga0466967_0082649 3300045976 Unclassified 2903
269 Ga0495592_0000976 3300046454 Bacteria 19849
270 Ga0495603_0003378 3300046455 Bacteria 9504
271 Ga0495629_0005668 3300046459 Bacteria 9327
272 Ga0495651_0000893 3300046462 Bacteria 23203
273 Ga0495653_0000173 3300046463 Bacteria 53365
274 Ga0495580_0027431 3300046472 Bacteria 4143
275 Ga0495582_0030743 3300046473 Bacteria 2949
276 Ga0495639_0003115 3300046475 Bacteria 7208
277 Ga0495608_0000763 3300046511 Bacteria 22518
278 Ga0495618_0037177 3300046514 Bacteria 3057
279 Ga0495628_0000467 3300046516 Bacteria 37087
280 Ga0495630_0004760 3300046517 Bacteria 9522
281 Ga0495630_0138126 3300046517 Bacteria 1852
282 Ga0495652_0000658 3300046529 Bacteria 40060
283 Ga0495665_0012976 3300046531 Bacteria 4509
284 Ga0495586_0039416 3300046535 Bacteria 2540
285 Ga0495587_0000247 3300046536 Bacteria 39646
286 Ga0495587_0065093 3300046536 Bacteria 2129
287 Ga0495645_0000497 3300046543 Bacteria 27195
288 Ga0495645_0492139 3300046543 Bacteria 768
289 Ga0495667_0000495 3300046559 Bacteria 25140
290 Ga0495634_0036453 3300046642 Bacteria 3364
291 Ga0495635_0000157 3300046663 Bacteria 41636
292 Ga0495635_0334927 3300046663 Bacteria 1011
293 Ga0495588_0043008 3300046674 Unclassified 2310
294 Ga0495657_0000371 3300046675 Bacteria 41627
295 Ga0495599_0000065 3300046678 Bacteria 72906
296 Ga0495623_0000014 3300046679 Bacteria 119814
297 Ga0495646_0000129 3300046680 Bacteria 38041
298 Ga0495658_0000262 3300046683 Bacteria 29829
299 Ga0495658_0885133 3300046683 Unclassified 571
300 Ga0495613_0085557 3300046689 Bacteria 2287
301 Ga0495613_0480637 3300046689 Unclassified 838
302 Ga0495600_0000105 3300046809 Bacteria 46401
303 Ga0495600_0010553 3300046809 Bacteria 5737
304 Ga0495581_0001999 3300047315 Bacteria 11446
305 Ga0495581_0312218 3300047315 Bacteria 919
306 Ga0495604_0000359 3300047317 Bacteria 40820
307 Ga0495604_0105730 3300047317 Bacteria 2060
308 Ga0495674_0000362 3300047319 Bacteria 40383
309 Ga0495680_0003175 3300047322 Bacteria 16358
310 Ga0495675_0004706 3300047444 Bacteria 8291
311 Ga0495684_0000288 3300047471 Bacteria 40827
312 Ga0495593_0000112 3300047673 Bacteria 38250
313 Ga0495593_0160502 3300047673 Unclassified 1135
314 Ga0495602_0002905 3300048088 Bacteria 17568
315 Ga0495614_0000021 3300048089 Bacteria 45062
316 Ga0501295_060376 3300049518 Unclassified 829
317 Ga0501296_049228 3300049519 Unclassified 613
318 Ga0501297_069515 3300049520 Unclassified 553
319 Ga0501303_006678 3300049526 Unclassified 1012
320 Ga0501070_0107221 3300049586 Bacteria 2309
321 Ga0501249_023505 3300049679 Bacteria 1354
322 Ga0501253_056136 3300049683 Bacteria 838
323 Ga0501261_053947 3300049690 Unclassified 666
324 Ga0501229_017319 3300049706 Unclassified 940
325 nmdc:mga05p37_243301_c1 3300050507 Bacteria 2162
326 nmdc:mga09592_146525_c1 3300050508 Unclassified 2036
327 nmdc:mga0qj67_270281_c1 3300050509 Unclassified 1378
328 nmdc:mga0n895_267427_c1 3300050512 Bacteria 1734
329 nmdc:mga0n895_595611_c1 3300050512 Unclassified 1108
330 nmdc:mga0n895_67334_c1 3300050512 Bacteria 3546
331 nmdc:mga0n895_909477_c1 3300050512 Bacteria 865
332 nmdc:mga0rr50_344186_c1 3300050513 Bacteria 1253
333 nmdc:mga0rr50_477712_c1 3300050513 Bacteria 1058
334 nmdc:mga0rr50_988062_c1 3300050513 Bacteria 717
335 nmdc:mga08x19_189951_c1 3300050514 Bacteria 1405
336 Ga0495601_0005062 3300053077 Bacteria 7650
337 Ga0495612_0000144 3300053078 Bacteria 30143
338 Ga0495619_0001764 3300053085 Bacteria 14393
339 Ga0070709_10001150
340 rootH1_10192815
341 Ga0070658_10005761
342 Ga0070658_10318906
343 Ga0070658_10436291
344 Ga0070683_100000735
345 Ga0070683_100075573
346 Ga0070690_100297348
347 Ga0070666_10360820
348 Ga0070680_100003584
349 Ga0070680_100484859
350 Ga0070680_100676988
351 Ga0070682_100001462
352 Ga0070682_100008410
353 Ga0070682_100032426
354 Ga0070660_100002151
355 Ga0070660_101095379
356 Ga0070661_100889367
357 Ga0070661_101386233
358 Ga0070692_10023603
359 Ga0070671_100440954
360 Ga0070659_100004277
361 Ga0070659_100130760
362 Ga0070659_100206034
363 Ga0070667_100399643
364 Ga0070709_10053272
365 Ga0070709_10096854
366 Ga0070714_100013071
367 Ga0070713_100000149
368 Ga0070713_100072085
369 Ga0070713_100077896
370 Ga0070713_100243825
371 Ga0070713_100313726
372 Ga0070710_10020199
373 Ga0070710_10037514
374 Ga0070711_100217142
375 Ga0070711_101862582
376 Ga0070694_100367765
377 Ga0070708_101354064
378 Ga0070663_100392060
379 Ga0070678_102160091
380 Ga0070681_10000604
381 Ga0070681_10003103
382 Ga0070681_10072097
383 Ga0070681_10670634
384 Ga0068867_100255153
385 Ga0070707_100754859
386 Ga0070698_100260247
387 Ga0070698_100278887
388 Ga0070699_100053043
389 Ga0070699_100093187
390 Ga0070699_100847378
391 Ga0070679_100005974
392 Ga0070679_100011051
393 Ga0070679_100030321
394 Ga0070679_100070974
395 Ga0070679_100145666
396 Ga0070679_100420633
397 Ga0070679_101094300
398 Ga0070684_100000446
399 Ga0070684_101285453
400 Ga0070697_100357706
401 Ga0068853_100295601
402 Ga0068853_100632054
403 Ga0068853_100703892
404 Ga0068853_101025476
405 Ga0070672_100257912
406 Ga0070672_100590968
407 Ga0070695_100335556
408 Ga0070695_101374195
409 Ga0070693_100022304
410 Ga0070693_100289487
411 Ga0070693_100508096
412 Ga0068855_100199368
413 Ga0068855_100450794
414 Ga0068855_101047315
415 Ga0068855_101078599
416 Ga0070664_100001694
417 Ga0070664_100020920
418 Ga0070664_101488002
419 Ga0068857_100001807
420 Ga0068856_100508160
421 Ga0068856_100613910
422 Ga0068856_101471349
423 Ga0068852_100033063
424 Ga0068852_100417951
425 Ga0068852_100648110
426 Ga0068864_100594988
427 Ga0068864_101508587
428 Ga0068864_102346132
429 Ga0068861_101402120
430 Ga0068863_101162961
431 Ga0068858_100975259
432 Ga0070717_10005301
433 Ga0070717_10540151
434 Ga0070716_100670613
435 Ga0070712_100646083
436 Ga0075430_100234966
437 Ga0075434_100076848
438 Ga0075434_100312361
439 Ga0075434_100920120
440 Ga0075434_101050075
441 Ga0075429_100854991
442 Ga0075436_100340049
443 Ga0075435_100085974
444 Ga0075435_100263719
445 Ga0075435_100512060
446 Ga0105245_10113403
447 Ga0105248_10575142
448 Ga0105248_11186071
449 Ga0105238_10151573
450 Ga0105238_10731885
451 Ga0105239_13570879
452 Ga0105246_10037331
453 Ga0157373_10071531
454 Ga0157373_10113220
455 Ga0157373_10451824
456 Ga0157371_10119958
457 Ga0157371_10288435
458 Ga0157371_11032097
459 Ga0157369_10046390
460 Ga0157369_10404292
461 Ga0157374_10077049
462 Ga0157374_10452769
463 Ga0157372_10067525
464 Ga0157372_10087741
465 Ga0157372_10113707
466 Ga0157372_10116665
467 Ga0157372_10140122
468 Ga0157372_10790722
469 Ga0157372_11217512
470 Ga0157375_10199056
471 Ga0157375_10734818
472 Ga0182008_10059207
473 Ga0182007_10328633
474 Ga0206353_10058062
475 Ga0206353_10296359
476 Ga0206353_11288912
477 Ga0207692_10328840
478 Ga0207680_10507944
479 Ga0207699_10005362
480 Ga0207699_10043655
481 Ga0207699_10092881
482 Ga0207699_10109843
483 Ga0207645_10754321
484 Ga0207705_10002963
485 Ga0207705_10018679
486 Ga0207705_10070389
487 Ga0207654_10814480
488 Ga0207707_10001370
489 Ga0207707_10002937
490 Ga0207707_10004092
491 Ga0207707_10103809
492 Ga0207707_10489192
493 Ga0207695_10007739
494 Ga0207693_10049506
495 Ga0207663_10125398
496 Ga0207660_10036852
497 Ga0207660_10190600
498 Ga0207660_10483511
499 Ga0207657_10034705
500 Ga0207657_10826997
501 Ga0207649_10014568
502 Ga0207649_10134781
503 Ga0207649_10268791
504 Ga0207652_10007815
505 Ga0207652_10019088
506 Ga0207652_10225662
507 Ga0207652_10359920
508 Ga0207652_11370397
509 Ga0207687_11319846
510 Ga0207700_10000713
511 Ga0207700_10102913
512 Ga0207700_10240411
513 Ga0207700_10254569
514 Ga0207664_10095196
515 Ga0207664_10184268
516 Ga0207644_10627975
517 Ga0207644_10658047
518 Ga0207690_10113739
519 Ga0207665_10250321
520 Ga0207691_10069026
521 Ga0207691_10284740
522 Ga0207661_10000302
523 Ga0207661_10106960
524 Ga0207661_10220175
525 Ga0207661_10368458
526 Ga0207679_10420541
527 Ga0207679_10551833
528 Ga0207667_10131173
529 Ga0207667_10212926
530 Ga0207667_10394174
531 Ga0207667_10449756
532 Ga0207651_10198441
533 Ga0207640_10131313
534 Ga0207658_10374623
535 Ga0207639_10020579
536 Ga0207678_10083400
537 Ga0207678_10387303
538 Ga0207702_10324953
539 Ga0207702_11585011
540 Ga0207648_10239948
541 Ga0207676_10470085
542 Ga0207676_11210460
543 Ga0207674_10018768
544 Ga0207683_11276212
545 Ga0207698_10274025
546 Ga0207698_10429366
547 Ga0207698_11960082
548 Ga0307408_100030994
549 Ga0307408_101054444
550 Ga0307405_10023064
551 Ga0307413_10000344
552 Ga0307413_11368560
553 Ga0307413_11667368
554 Ga0307410_10047808
555 Ga0307410_10658106
556 Ga0307410_10669070
557 Ga0307410_10718524
558 Ga0307406_10010144
559 Ga0307407_10010720
560 Ga0307407_10620067
561 Ga0307412_10008831
562 Ga0307409_100102862
563 Ga0307416_100078372
564 Ga0307416_100150443
565 Ga0307416_100634810
566 Ga0307414_10020674
567 Ga0307411_10009766
568 Ga0307415_100065098
569 Ga0307415_100548445
570 Ga0307415_100900667
571 Ga0373926_0007211
572 Ga0373934_0004528
573 Ga0373944_0021990
574 Ga0373923_0000392
575 Ga0373936_0045282
576 Ga0373936_0410562
577 Ga0373945_0017158
578 Ga0373953_0014421
579 Ga0373954_0112870
580 Ga0373956_0002181
581 Ga0373957_0018140
582 Ga0373943_0002300
583 Ga0373946_0026174
584 Ga0373955_0001505
585 Ga0373924_0003667
586 Ga0373935_0000974
587 Ga0373927_0006357
588 Ga0373933_0000033
589 Ga0373947_0044129
590 Ga0373937_0000158
591 Ga0373925_0001104
592 Ga0395900_1223035
593 Ga0395905_0858999
594 Ga0436364_0054899
595 Ga0395901_0530847
596 Ga0439461_0006582
597 Ga0439446_0016947
598 Ga0466969_0354185
599 Ga0466964_0150608
600 Ga0466957_0196083
601 Ga0466957_0748605
602 Ga0466959_0053241
603 Ga0466959_0212248
604 Ga0466958_0343838
605 Ga0466958_0456293
606 Ga0466967_0082649
607 Ga0495592_0000976
608 Ga0495603_0003378
609 Ga0495629_0005668
610 Ga0495651_0000893
611 Ga0495653_0000173
612 Ga0495580_0027431
613 Ga0495582_0030743
614 Ga0495639_0003115
615 Ga0495608_0000763
616 Ga0495618_0037177
617 Ga0495628_0000467
618 Ga0495630_0004760
619 Ga0495630_0138126
620 Ga0495652_0000658
621 Ga0495665_0012976
622 Ga0495586_0039416
623 Ga0495587_0000247
624 Ga0495587_0065093
625 Ga0495645_0000497
626 Ga0495645_0492139
627 Ga0495667_0000495
628 Ga0495634_0036453
629 Ga0495635_0000157
630 Ga0495635_0334927
631 Ga0495588_0043008
632 Ga0495657_0000371
633 Ga0495599_0000065
634 Ga0495623_0000014
635 Ga0495646_0000129
636 Ga0495658_0000262
637 Ga0495658_0885133
638 Ga0495613_0085557
639 Ga0495613_0480637
640 Ga0495600_0000105
641 Ga0495600_0010553
642 Ga0495581_0001999
643 Ga0495581_0312218
644 Ga0495604_0000359
645 Ga0495604_0105730
646 Ga0495674_0000362
647 Ga0495680_0003175
648 Ga0495675_0004706
649 Ga0495684_0000288
650 Ga0495593_0000112
651 Ga0495593_0160502
652 Ga0495602_0002905
653 Ga0495614_0000021
654 Ga0501295_060376
655 Ga0501296_049228
656 Ga0501297_069515
657 Ga0501303_006678
658 Ga0501070_0107221
659 Ga0501249_023505
660 Ga0501253_056136
661 Ga0501261_053947
662 Ga0501229_017319
663 nmdc:mga05p37_243301_c1
664 nmdc:mga09592_146525_c1
665 nmdc:mga0qj67_270281_c1
666 nmdc:mga0n895_267427_c1
667 nmdc:mga0n895_595611_c1
668 nmdc:mga0n895_67334_c1
669 nmdc:mga0n895_909477_c1
670 nmdc:mga0rr50_344186_c1
671 nmdc:mga0rr50_477712_c1
672 nmdc:mga0rr50_988062_c1
673 nmdc:mga08x19_189951_c1
674 Ga0495601_0005062
675 Ga0495612_0000144
676 Ga0495619_0001764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

28

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9413 1 140
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9383 1 140
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9368 1 141
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.9179 1 140
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.9105 1 140
ID Description Score Start End Superfamily
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9368 1 141 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9269 1 140 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9062 1 141 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8995 3 141 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8986 1 141 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A2V7RV96-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9855 1 107 GO:0046872
GO:0070497
AF-A0A2V7SVC0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9757 1 141 GO:0046872
GO:0070497
AF-A0A7W1ENX6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9753 1 141 GO:0016829
GO:0046872
AF-A0A2E7B139-F1-model_v4 deleted 0.972 1 88
AF-A0A1G0LNT1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9715 1 140 GO:0046872
GO:0070497

Map