F413341

General Info

Members Datasets Scaffolds Average Seq Length
338 236 676 167

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10002350|rootH1_100023506
Length 161
Sequence VTPHPPPPGLTRFNTLAEPAASTALHEVCASTAWVHHVLKARPYATAEALYDAGETAVHDLDDAGLXXXLAGHPASAREQRGMADADPELRAEMLELNLAYQERFGHVFLICATGLTGAQMRDAARERLGNTPEREREIVRTELGRINRIRLARLVEGDPA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
25 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
26 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
32 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
33 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
34 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
37 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
44 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
45 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
49 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
55 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
56 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
59 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
60 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
160 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
161 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
162 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
169 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
170 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
171 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
172 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
173 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
174 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
175 2643221548 Streptomyces sp. Root55 Isolate Unclassified
176 2643221578 Streptomyces sp. Root63 Isolate Unclassified
177 2643221647 Streptomyces sp. Root369 Isolate Unclassified
178 2643221670 Streptomyces sp. Root431 Isolate Unclassified
179 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
180 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
181 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
182 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
183 2643221714 Streptomyces sp. Root264 Isolate Unclassified
184 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
185 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
186 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
187 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
188 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
189 2808606448 Streptomyces sp. 193411 Isolate Unclassified
190 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
191 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
192 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
193 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
194 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
195 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
196 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
197 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
198 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
199 2862574272 Streptomyces sp. AcE210 Isolate Nodule
200 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
201 2867369537 Streptomyces sp. Z26 Isolate Unclassified
202 2867428634 Streptomyces sp. RP5T Isolate Unclassified
203 2867475112 Streptomyces sp. TM32 Isolate Unclassified
204 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
205 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
206 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
207 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
208 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
209 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
210 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
211 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
212 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
213 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
214 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
215 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
216 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
217 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
218 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
219 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
220 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
221 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
222 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
223 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
224 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
225 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
226 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
227 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
228 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
229 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
230 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
231 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
232 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
233 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
234 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
235 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
236 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.99
Metatranscriptomes 0.59
Isolates 20.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 1.48
Rhizoplane 0
Rhizosphere 69.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10002350 3300003316 Bacteria 15113
2 rootH2_10081632 3300003320 Bacteria 2892
3 rootL2_10150836 3300003322 Bacteria 1292
4 rootH1_10018467 3300003323 Bacteria 3972
5 rootH1_10140438 3300003323 Bacteria 3660
6 JGI25160J50197_1014545 3300003354 Bacteria 2628
7 JGI25160J50197_1014572 3300003354 Bacteria 2624
8 Ga0006562J51391_1057977 3300003578 Bacteria 1960
9 Ga0006562J51391_1057978 3300003578 Bacteria 1446
10 Ga0068856_100418542 3300005614 Bacteria 1360
11 Ga0081455_10139148 3300005937 Bacteria 1888
12 Ga0075368_10003364 3300006042 Bacteria 5330
13 Ga0075363_100052061 3300006048 Bacteria 2185
14 Ga0075367_10100054 3300006178 Bacteria 1771
15 Ga0075370_10034192 3300006353 Bacteria 2849
16 Ga0075370_10171422 3300006353 Bacteria 1276
17 Ga0099826_10117856 3300006948 Bacteria 1569
18 Ga0105246_10044969 3300011119 Bacteria 3004
19 Ga0157369_10273637 3300013105 Bacteria 1759
20 Ga0157375_10693243 3300013308 Bacteria 1172
21 Ga0183367_1001 3300015688 Bacteria 1225545
22 Ga0207426_1004704 3300025302 Bacteria 6533
23 Ga0207426_1006066 3300025302 Bacteria 5335
24 Ga0207647_10068584 3300025904 Bacteria 2147
25 Ga0207702_10114857 3300026078 Bacteria 2400
26 Ga0209282_1166864 3300027666 Bacteria 1046
27 Ga0209813_10012067 3300027866 Bacteria 2273
28 Ga0307517_10021123 3300028786 Bacteria 8250
29 Ga0307515_10000462 3300028794 Bacteria 97164
30 Ga0307515_10097920 3300028794 Bacteria 3578
31 Ga0307511_10001391 3300030521 Bacteria 25565
32 Ga0307511_10044685 3300030521 Bacteria 3675
33 Ga0307511_10135277 3300030521 Bacteria 1469
34 Ga0307512_10012581 3300030522 Bacteria 7983
35 Ga0307512_10019351 3300030522 Bacteria 6199
36 Ga0307512_10171786 3300030522 Bacteria 1241
37 Ga0307513_10024042 3300031456 Bacteria 7098
38 Ga0307513_10299371 3300031456 Bacteria 1376
39 Ga0307513_10446503 3300031456 Bacteria 1018
40 Ga0307509_10040427 3300031507 Bacteria 5071
41 Ga0307509_10065848 3300031507 Bacteria 3803
42 Ga0307408_100803688 3300031548 Bacteria 854
43 Ga0307508_10035601 3300031616 Bacteria 4486
44 Ga0307508_10063645 3300031616 Bacteria 3254
45 Ga0307514_10011432 3300031649 Bacteria 7377
46 Ga0307514_10146443 3300031649 Bacteria 1595
47 Ga0307514_10151921 3300031649 Bacteria 1551
48 Ga0307514_10214279 3300031649 Bacteria 1191
49 Ga0307516_10011882 3300031730 Bacteria 9423
50 Ga0307516_10083625 3300031730 Bacteria 3032
51 Ga0307516_10332474 3300031730 Bacteria 1188
52 Ga0307518_10194672 3300031838 Bacteria 1354
53 Ga0307410_10506464 3300031852 Bacteria 994
54 Ga0307415_101113737 3300032126 Bacteria 740
55 Ga0307507_10006735 3300033179 Bacteria 17289
56 Ga0307507_10232158 3300033179 Bacteria 1221
57 Ga0307507_10249369 3300033179 Bacteria 1149
58 Ga0307507_10415590 3300033179 Bacteria 758
59 Ga0307510_10006986 3300033180 Bacteria 13458
60 Ga0307510_10026676 3300033180 Bacteria 6635
61 Ga0307510_10041625 3300033180 Bacteria 5018
62 Ga0307510_10271039 3300033180 Bacteria 1173
63 Ga0395898_0020224 3300037466 Bacteria 6762
64 Ga0436364_1042148 3300037853 Bacteria 14831
65 Ga0395901_0084748 3300038443 Bacteria 3312
66 Ga0439436_0014335 3300041404 Bacteria 2394
67 Ga0439436_0057976 3300041404 Bacteria 1086
68 Ga0439439_0016269 3300041406 Bacteria 1820
69 Ga0439439_0019242 3300041406 Bacteria 1693
70 Ga0451833_0042948 3300041491 Bacteria 722
71 Ga0451841_0612520 3300041498 Bacteria 755
72 Ga0451849_0069635 3300041505 Bacteria 688
73 Ga0451853_2219811 3300041512 Bacteria 3948
74 Ga0451853_4080923 3300041512 Bacteria 810
75 Ga0439433_0010945 3300041999 Bacteria 1983
76 Ga0439448_0003002 3300042005 Bacteria 4632
77 Ga0439432_010435 3300042006 Bacteria 3214
78 Ga0439449_0002026 3300042007 Bacteria 7973
79 Ga0439449_0021647 3300042007 Bacteria 2407
80 Ga0439450_016534 3300042008 Bacteria 1527
81 Ga0439457_000015 3300042014 Bacteria 36298
82 Ga0439462_0006734 3300042015 Bacteria 2868
83 Ga0439462_0055810 3300042015 Bacteria 1066
84 Ga0450894_003043 3300042131 Bacteria 2214
85 Ga0450898_013769 3300042134 Bacteria 1352
86 Ga0450899_000720 3300042135 Bacteria 3762
87 Ga0450903_000505 3300042138 Bacteria 8169
88 Ga0450906_016280 3300042145 Bacteria 1347
89 Ga0439458_0030778 3300042157 Bacteria 1278
90 Ga0450908_028469 3300042184 Bacteria 973
91 Ga0466969_0098020 3300044656 Bacteria 1382
92 Ga0466972_0005187 3300044658 Bacteria 6523
93 Ga0466972_0016387 3300044658 Bacteria 3706
94 Ga0466972_0216482 3300044658 Bacteria 896
95 Ga0466972_0314569 3300044658 Bacteria 731
96 Ga0466965_0093789 3300044683 Bacteria 1529
97 Ga0466965_0182918 3300044683 Bacteria 1106
98 Ga0466966_0045676 3300044684 Bacteria 2799
99 Ga0466961_0042898 3300044693 Bacteria 2898
100 Ga0466961_0107215 3300044693 Bacteria 1759
101 Ga0466963_0146560 3300044694 Bacteria 1638
102 Ga0466964_0155169 3300044706 Bacteria 1065
103 Ga0466971_0026498 3300044719 Bacteria 2591
104 Ga0466970_0012959 3300044765 Bacteria 4270
105 Ga0466960_0008229 3300044901 Bacteria 4265
106 Ga0466959_0079385 3300045049 Bacteria 2366
107 Ga0466959_0183200 3300045049 Bacteria 1464
108 Ga0466967_0052613 3300045976 Bacteria 3575
109 Ga0466967_0061748 3300045976 Bacteria 3325
110 Ga0466967_0258705 3300045976 Bacteria 1665
111 Ga0495592_0016427 3300046454 Bacteria 5615
112 Ga0495592_0054226 3300046454 Bacteria 2971
113 Ga0495603_0000382 3300046455 Bacteria 24174
114 Ga0495603_0016380 3300046455 Bacteria 4483
115 Ga0495603_0044093 3300046455 Bacteria 2661
116 Ga0495590_0075359 3300046457 Bacteria 1187
117 Ga0495629_0004104 3300046459 Bacteria 10930
118 Ga0495629_0025536 3300046459 Bacteria 4197
119 Ga0495629_0029725 3300046459 Bacteria 3874
120 Ga0495629_0312884 3300046459 Bacteria 1074
121 Ga0495638_0058719 3300046460 Bacteria 2383
122 Ga0495638_0104800 3300046460 Bacteria 1686
123 Ga0495651_0057257 3300046462 Bacteria 2992
124 Ga0495651_0078395 3300046462 Bacteria 2499
125 Ga0495582_0013967 3300046473 Bacteria 4424
126 Ga0495605_0023316 3300046474 Bacteria 3257
127 Ga0495662_0001294 3300046476 Bacteria 12378
128 Ga0495662_0159974 3300046476 Bacteria 1109
129 Ga0495662_0225328 3300046476 Bacteria 924
130 Ga0495664_0001315 3300046477 Bacteria 13046
131 Ga0495664_0051474 3300046477 Bacteria 2445
132 Ga0495584_0162223 3300046491 Bacteria 1136
133 Ga0495585_0185637 3300046492 Bacteria 1066
134 Ga0495594_0047150 3300046499 Bacteria 2367
135 Ga0495594_0083779 3300046499 Bacteria 1782
136 Ga0495594_0108340 3300046499 Bacteria 1565
137 Ga0495607_0118604 3300046501 Bacteria 1392
138 Ga0495583_0064053 3300046506 Bacteria 1632
139 Ga0495606_0006724 3300046507 Bacteria 10529
140 Ga0495608_0065273 3300046511 Bacteria 2384
141 Ga0495616_0004005 3300046513 Bacteria 9367
142 Ga0495618_0097252 3300046514 Bacteria 1883
143 Ga0495620_0002850 3300046515 Bacteria 9933
144 Ga0495620_0029053 3300046515 Bacteria 2563
145 Ga0495628_0020761 3300046516 Bacteria 5412
146 Ga0495630_0017652 3300046517 Bacteria 5230
147 Ga0495643_0036650 3300046522 Bacteria 2693
148 Ga0495648_0106656 3300046524 Bacteria 1533
149 Ga0495648_0110592 3300046524 Bacteria 1496
150 Ga0495642_0063333 3300046528 Bacteria 1537
151 Ga0495652_0038240 3300046529 Bacteria 4158
152 Ga0495652_0367889 3300046529 Bacteria 1025
153 Ga0495654_0131917 3300046530 Bacteria 1121
154 Ga0495665_0147776 3300046531 Bacteria 1227
155 Ga0495586_0300456 3300046535 Bacteria 920
156 Ga0495586_0343133 3300046535 Bacteria 857
157 Ga0495587_0004985 3300046536 Bacteria 8690
158 Ga0495597_0121322 3300046542 Bacteria 1089
159 Ga0495645_0123961 3300046543 Bacteria 1817
160 Ga0495645_0231529 3300046543 Bacteria 1237
161 Ga0495622_0070755 3300046557 Bacteria 1610
162 Ga0495622_0182848 3300046557 Bacteria 939
163 Ga0495634_0002434 3300046642 Bacteria 15463
164 Ga0495634_0411002 3300046642 Bacteria 802
165 Ga0495611_0005551 3300046648 Bacteria 5385
166 Ga0495611_0011993 3300046648 Bacteria 3683
167 Ga0495625_0176872 3300046660 Bacteria 1421
168 Ga0495625_0193443 3300046660 Bacteria 1346
169 Ga0495625_0294383 3300046660 Bacteria 1040
170 Ga0495635_0015987 3300046663 Bacteria 5241
171 Ga0495661_0081675 3300046665 Bacteria 1862
172 Ga0495588_0077216 3300046674 Bacteria 1736
173 Ga0495588_0090854 3300046674 Bacteria 1600
174 Ga0495657_0001152 3300046675 Bacteria 23182
175 Ga0495599_0097096 3300046678 Bacteria 1837
176 Ga0495623_0133715 3300046679 Bacteria 1482
177 Ga0495646_0000167 3300046680 Bacteria 32980
178 Ga0495646_0105793 3300046680 Bacteria 1607
179 Ga0495658_0024012 3300046683 Bacteria 3242
180 Ga0495613_0005364 3300046689 Bacteria 9629
181 Ga0495613_0010174 3300046689 Bacteria 6989
182 Ga0495613_0163428 3300046689 Bacteria 1582
183 Ga0495613_0323263 3300046689 Bacteria 1064
184 Ga0495624_0093746 3300046690 Bacteria 1851
185 Ga0495624_0149581 3300046690 Bacteria 1428
186 Ga0495670_0037130 3300046691 Bacteria 2428
187 Ga0495671_0006605 3300046692 Bacteria 6688
188 Ga0495589_0004836 3300046794 Bacteria 7153
189 Ga0495589_0027244 3300046794 Bacteria 2889
190 Ga0495589_0062271 3300046794 Bacteria 1830
191 Ga0495600_0014496 3300046809 Bacteria 4967
192 Ga0495600_0095109 3300046809 Bacteria 1942
193 Ga0495600_0148400 3300046809 Bacteria 1519
194 Ga0495660_0051753 3300046810 Bacteria 2233
195 Ga0495581_0008367 3300047315 Bacteria 5996
196 Ga0495581_0113103 3300047315 Bacteria 1578
197 Ga0495581_0176248 3300047315 Bacteria 1250
198 Ga0495581_0619473 3300047315 Bacteria 626
199 Ga0495604_0016226 3300047317 Bacteria 5951
200 Ga0495604_0063583 3300047317 Bacteria 2814
201 Ga0495636_0005034 3300047318 Bacteria 5190
202 Ga0495636_0007656 3300047318 Bacteria 4247
203 Ga0495636_0030369 3300047318 Bacteria 2209
204 Ga0495636_0140751 3300047318 Bacteria 1077
205 Ga0495674_0036404 3300047319 Bacteria 4430
206 Ga0495674_0433115 3300047319 Bacteria 1058
207 Ga0495676_0033894 3300047321 Bacteria 4291
208 Ga0495676_0040525 3300047321 Bacteria 3842
209 Ga0495676_0097407 3300047321 Bacteria 2184
210 Ga0495676_0154643 3300047321 Bacteria 1628
211 Ga0495676_0440322 3300047321 Bacteria 860
212 Ga0495680_0018483 3300047322 Bacteria 5915
213 Ga0495683_0027576 3300047323 Bacteria 2904
214 Ga0495683_0290933 3300047323 Bacteria 704
215 Ga0495683_0344339 3300047323 Bacteria 630
216 Ga0495687_004197 3300047443 Bacteria 9894
217 Ga0495687_041947 3300047443 Bacteria 2003
218 Ga0495675_0043435 3300047444 Bacteria 2863
219 Ga0495675_0048331 3300047444 Bacteria 2707
220 Ga0495677_0166764 3300047445 Bacteria 851
221 Ga0495685_003515 3300047447 Bacteria 5003
222 Ga0495685_008931 3300047447 Bacteria 3341
223 Ga0495685_009053 3300047447 Bacteria 3318
224 Ga0495685_073255 3300047447 Bacteria 1145
225 Ga0495681_0000901 3300047470 Bacteria 22973
226 Ga0495681_0077584 3300047470 Bacteria 1490
227 Ga0495684_0242656 3300047471 Bacteria 1313
228 Ga0495686_0138703 3300047472 Bacteria 1436
229 Ga0495593_0000572 3300047673 Bacteria 20924
230 Ga0495593_0064142 3300047673 Bacteria 1917
231 Ga0495614_0002850 3300048089 Bacteria 7694
232 Ga0495614_0020031 3300048089 Bacteria 2893
233 Ga0495614_0050203 3300048089 Bacteria 1787
234 Ga0495614_0064647 3300048089 Bacteria 1573
235 Ga0495678_028445 3300049459 Bacteria 2359
236 Ga0495682_0092992 3300049460 Bacteria 1083
237 Ga0501031_0186150 3300049568 Bacteria 1356
238 Ga0501032_0244878 3300049569 Bacteria 1164
239 Ga0501034_0085998 3300049571 Bacteria 3145
240 Ga0501036_0081868 3300049572 Bacteria 2728
241 Ga0501038_0013667 3300049574 Bacteria 7399
242 Ga0501038_0138715 3300049574 Bacteria 1991
243 Ga0501039_0084796 3300049575 Bacteria 2468
244 Ga0501047_0023537 3300049581 Bacteria 5911
245 Ga0501047_0619117 3300049581 Bacteria 903
246 Ga0501069_0385014 3300049585 Bacteria 829
247 Ga0501070_0162609 3300049586 Bacteria 1840
248 Ga0501070_0358073 3300049586 Bacteria 1184
249 Ga0501070_0550233 3300049586 Bacteria 924
250 Ga0501035_0052539 3300049822 Bacteria 3646
251 Ga0501044_0086314 3300049823 Bacteria 3170
252 Ga0501044_0154418 3300049823 Bacteria 2275
253 nmdc:mga03n38_211258_c1 3300050490 Bacteria 1009
254 nmdc:mga06z11_46131_c1 3300050494 Bacteria 2207
255 nmdc:mga04h51_13118_c1 3300050495 Bacteria 2341
256 nmdc:mga07m45_146050_c1 3300050496 Bacteria 1371
257 nmdc:mga07m45_30572_c1 3300050496 Bacteria 2983
258 Ga0495601_0244037 3300053077 Bacteria 1173
259 Ga0500644_0126661 3300053088 Bacteria 1001
260 Ga0500647_0294654 3300053091 Bacteria 696
261 Ga0500640_000862 3300053095 Bacteria 8398
262 Ga0500553_019071 3300053101 Bacteria 3475
263 Ga0500560_106074 3300053107 Bacteria 942
264 Ga0500572_114624 3300053111 Bacteria 869
265 Ga0500614_031340 3300053123 Bacteria 1302
266 Ga0500573_0009645 3300053140 Bacteria 5367
267 Ga0500600_0106901 3300053149 Bacteria 1466
268 Ga0500600_0160102 3300053149 Bacteria 1108
269 Ga0500624_002941 3300053157 Bacteria 2251
270 2547411928 2547132111 Bacteria 8013147
271 2554260619 2554235005 Bacteria 6457341
272 2585298806 2582581312 Bacteria 7308206
273 2585309437 2582581313 Bacteria 10042643
274 2585314866 2582581314 Bacteria 11452267
275 2616702016 2616644814 Bacteria 11555299
276 2616902642 2616644941 Bacteria 8510691
277 2643761938 2643221548 Bacteria 8053412
278 2643903900 2643221578 Bacteria 9213798
279 2644270001 2643221647 Bacteria 10741251
280 2644388105 2643221670 Bacteria 6497041
281 2644402252 2643221673 Bacteria 9196637
282 2644430282 2643221677 Bacteria 7584031
283 2644442706 2643221678 Bacteria 9540101
284 2644460635 2643221682 Bacteria 6743283
285 2644626829 2643221714 Bacteria 9015452
286 2784591368 2784132148 Bacteria 8627943
287 2785340201 2784746763 Bacteria 9783172
288 2785372491 2784746768 Bacteria 10036182
289 2786675645 2786546132 Bacteria 10419719
290 2808844884 2808606359 Bacteria 9866990
291 2809234957 2808606448 Bacteria 8656184
292 2811843649 2808606982 Bacteria 7791042
293 2812355029 2811994879 Bacteria 9313447
294 2812477822 2811994917 Bacteria 7761064
295 2819698407 2818991463 Bacteria 7948711
296 2852638580 2852635781 Bacteria 8251373
297 2862183884 2862178590 Bacteria 8583590
298 2862283615 2862281513 Bacteria 9621493
299 2862389927 2862382967 Bacteria 10317375
300 2862511004 2862507626 Bacteria 9425308
301 2862576626 2862574272 Bacteria 10567477
302 2863409629 2863404153 Bacteria 9672205
303 2867374562 2867369537 Bacteria 6501581
304 2867430869 2867428634 Bacteria 9590268
305 2867477017 2867475112 Bacteria 6909112
306 2877678174 2877676314 Bacteria 9512378
307 2912716636 2912715099 Bacteria 9460473
308 2912729358 2912723979 Bacteria 8557534
309 2918507368 2918501144 Bacteria 8668083
310 2919472637 2919468124 Bacteria 9133025
311 2935396139 2935390628 Bacteria 7043367
312 2946046977 2946045630 Bacteria 8527308
313 2946070869 2946064051 Bacteria 8957905
314 2946078513 2946072368 Bacteria 8999607
315 2947225929 2947224130 Bacteria 9938529
316 2954010061 2954002825 Bacteria 9173742
317 2954383067 2954380949 Bacteria 10050426
318 2954679915 2954673503 Bacteria 9685905
319 2954684237 2954682443 Bacteria 9862841
320 2954693794 2954691527 Bacteria 10720516
321 2954708888 2954701450 Bacteria 10834262
322 2954713430 2954711539 Bacteria 10867210
323 2954723394 2954721474 Bacteria 10456478
324 2954738435 2954731030 Bacteria 10243860
325 2954742297 2954740390 Bacteria 10229294
326 2954757296 2954749733 Bacteria 10366972
327 2954761269 2954759201 Bacteria 9358192
328 2966599999 2966598605 Bacteria 7676064
329 2997457630 2997451912 Bacteria 8492419
330 3006488070 3006486233 Bacteria 8157040
331 3006497885 3006493962 Bacteria 8825450
332 8008563870 8008558824 Bacteria 10610750
333 8008576367 8008574985 Bacteria 7815457
334 8023628067 8023623736 Bacteria 8593882
335 8025418003 8025413630 Bacteria 7014048
336 8048406943 8048406513 Bacteria 8936924
337 8054161801 8054160619 Bacteria 7783213
338 8056829704 8056829672 Bacteria 9045328
339 rootH1_10002350
340 rootH2_10081632
341 rootL2_10150836
342 rootH1_10018467
343 rootH1_10140438
344 JGI25160J50197_1014545
345 JGI25160J50197_1014572
346 Ga0006562J51391_1057977
347 Ga0006562J51391_1057978
348 Ga0068856_100418542
349 Ga0081455_10139148
350 Ga0075368_10003364
351 Ga0075363_100052061
352 Ga0075367_10100054
353 Ga0075370_10034192
354 Ga0075370_10171422
355 Ga0099826_10117856
356 Ga0105246_10044969
357 Ga0157369_10273637
358 Ga0157375_10693243
359 Ga0183367_1001
360 Ga0207426_1004704
361 Ga0207426_1006066
362 Ga0207647_10068584
363 Ga0207702_10114857
364 Ga0209282_1166864
365 Ga0209813_10012067
366 Ga0307517_10021123
367 Ga0307515_10000462
368 Ga0307515_10097920
369 Ga0307511_10001391
370 Ga0307511_10044685
371 Ga0307511_10135277
372 Ga0307512_10012581
373 Ga0307512_10019351
374 Ga0307512_10171786
375 Ga0307513_10024042
376 Ga0307513_10299371
377 Ga0307513_10446503
378 Ga0307509_10040427
379 Ga0307509_10065848
380 Ga0307408_100803688
381 Ga0307508_10035601
382 Ga0307508_10063645
383 Ga0307514_10011432
384 Ga0307514_10146443
385 Ga0307514_10151921
386 Ga0307514_10214279
387 Ga0307516_10011882
388 Ga0307516_10083625
389 Ga0307516_10332474
390 Ga0307518_10194672
391 Ga0307410_10506464
392 Ga0307415_101113737
393 Ga0307507_10006735
394 Ga0307507_10232158
395 Ga0307507_10249369
396 Ga0307507_10415590
397 Ga0307510_10006986
398 Ga0307510_10026676
399 Ga0307510_10041625
400 Ga0307510_10271039
401 Ga0395898_0020224
402 Ga0436364_1042148
403 Ga0395901_0084748
404 Ga0439436_0014335
405 Ga0439436_0057976
406 Ga0439439_0016269
407 Ga0439439_0019242
408 Ga0451833_0042948
409 Ga0451841_0612520
410 Ga0451849_0069635
411 Ga0451853_2219811
412 Ga0451853_4080923
413 Ga0439433_0010945
414 Ga0439448_0003002
415 Ga0439432_010435
416 Ga0439449_0002026
417 Ga0439449_0021647
418 Ga0439450_016534
419 Ga0439457_000015
420 Ga0439462_0006734
421 Ga0439462_0055810
422 Ga0450894_003043
423 Ga0450898_013769
424 Ga0450899_000720
425 Ga0450903_000505
426 Ga0450906_016280
427 Ga0439458_0030778
428 Ga0450908_028469
429 Ga0466969_0098020
430 Ga0466972_0005187
431 Ga0466972_0016387
432 Ga0466972_0216482
433 Ga0466972_0314569
434 Ga0466965_0093789
435 Ga0466965_0182918
436 Ga0466966_0045676
437 Ga0466961_0042898
438 Ga0466961_0107215
439 Ga0466963_0146560
440 Ga0466964_0155169
441 Ga0466971_0026498
442 Ga0466970_0012959
443 Ga0466960_0008229
444 Ga0466959_0079385
445 Ga0466959_0183200
446 Ga0466967_0052613
447 Ga0466967_0061748
448 Ga0466967_0258705
449 Ga0495592_0016427
450 Ga0495592_0054226
451 Ga0495603_0000382
452 Ga0495603_0016380
453 Ga0495603_0044093
454 Ga0495590_0075359
455 Ga0495629_0004104
456 Ga0495629_0025536
457 Ga0495629_0029725
458 Ga0495629_0312884
459 Ga0495638_0058719
460 Ga0495638_0104800
461 Ga0495651_0057257
462 Ga0495651_0078395
463 Ga0495582_0013967
464 Ga0495605_0023316
465 Ga0495662_0001294
466 Ga0495662_0159974
467 Ga0495662_0225328
468 Ga0495664_0001315
469 Ga0495664_0051474
470 Ga0495584_0162223
471 Ga0495585_0185637
472 Ga0495594_0047150
473 Ga0495594_0083779
474 Ga0495594_0108340
475 Ga0495607_0118604
476 Ga0495583_0064053
477 Ga0495606_0006724
478 Ga0495608_0065273
479 Ga0495616_0004005
480 Ga0495618_0097252
481 Ga0495620_0002850
482 Ga0495620_0029053
483 Ga0495628_0020761
484 Ga0495630_0017652
485 Ga0495643_0036650
486 Ga0495648_0106656
487 Ga0495648_0110592
488 Ga0495642_0063333
489 Ga0495652_0038240
490 Ga0495652_0367889
491 Ga0495654_0131917
492 Ga0495665_0147776
493 Ga0495586_0300456
494 Ga0495586_0343133
495 Ga0495587_0004985
496 Ga0495597_0121322
497 Ga0495645_0123961
498 Ga0495645_0231529
499 Ga0495622_0070755
500 Ga0495622_0182848
501 Ga0495634_0002434
502 Ga0495634_0411002
503 Ga0495611_0005551
504 Ga0495611_0011993
505 Ga0495625_0176872
506 Ga0495625_0193443
507 Ga0495625_0294383
508 Ga0495635_0015987
509 Ga0495661_0081675
510 Ga0495588_0077216
511 Ga0495588_0090854
512 Ga0495657_0001152
513 Ga0495599_0097096
514 Ga0495623_0133715
515 Ga0495646_0000167
516 Ga0495646_0105793
517 Ga0495658_0024012
518 Ga0495613_0005364
519 Ga0495613_0010174
520 Ga0495613_0163428
521 Ga0495613_0323263
522 Ga0495624_0093746
523 Ga0495624_0149581
524 Ga0495670_0037130
525 Ga0495671_0006605
526 Ga0495589_0004836
527 Ga0495589_0027244
528 Ga0495589_0062271
529 Ga0495600_0014496
530 Ga0495600_0095109
531 Ga0495600_0148400
532 Ga0495660_0051753
533 Ga0495581_0008367
534 Ga0495581_0113103
535 Ga0495581_0176248
536 Ga0495581_0619473
537 Ga0495604_0016226
538 Ga0495604_0063583
539 Ga0495636_0005034
540 Ga0495636_0007656
541 Ga0495636_0030369
542 Ga0495636_0140751
543 Ga0495674_0036404
544 Ga0495674_0433115
545 Ga0495676_0033894
546 Ga0495676_0040525
547 Ga0495676_0097407
548 Ga0495676_0154643
549 Ga0495676_0440322
550 Ga0495680_0018483
551 Ga0495683_0027576
552 Ga0495683_0290933
553 Ga0495683_0344339
554 Ga0495687_004197
555 Ga0495687_041947
556 Ga0495675_0043435
557 Ga0495675_0048331
558 Ga0495677_0166764
559 Ga0495685_003515
560 Ga0495685_008931
561 Ga0495685_009053
562 Ga0495685_073255
563 Ga0495681_0000901
564 Ga0495681_0077584
565 Ga0495684_0242656
566 Ga0495686_0138703
567 Ga0495593_0000572
568 Ga0495593_0064142
569 Ga0495614_0002850
570 Ga0495614_0020031
571 Ga0495614_0050203
572 Ga0495614_0064647
573 Ga0495678_028445
574 Ga0495682_0092992
575 Ga0501031_0186150
576 Ga0501032_0244878
577 Ga0501034_0085998
578 Ga0501036_0081868
579 Ga0501038_0013667
580 Ga0501038_0138715
581 Ga0501039_0084796
582 Ga0501047_0023537
583 Ga0501047_0619117
584 Ga0501069_0385014
585 Ga0501070_0162609
586 Ga0501070_0358073
587 Ga0501070_0550233
588 Ga0501035_0052539
589 Ga0501044_0086314
590 Ga0501044_0154418
591 nmdc:mga03n38_211258_c1
592 nmdc:mga06z11_46131_c1
593 nmdc:mga04h51_13118_c1
594 nmdc:mga07m45_146050_c1
595 nmdc:mga07m45_30572_c1
596 Ga0495601_0244037
597 Ga0500644_0126661
598 Ga0500647_0294654
599 Ga0500640_000862
600 Ga0500553_019071
601 Ga0500560_106074
602 Ga0500572_114624
603 Ga0500614_031340
604 Ga0500573_0009645
605 Ga0500600_0106901
606 Ga0500600_0160102
607 Ga0500624_002941
608 2547411928
609 2554260619
610 2585298806
611 2585309437
612 2585314866
613 2616702016
614 2616902642
615 2643761938
616 2643903900
617 2644270001
618 2644388105
619 2644402252
620 2644430282
621 2644442706
622 2644460635
623 2644626829
624 2784591368
625 2785340201
626 2785372491
627 2786675645
628 2808844884
629 2809234957
630 2811843649
631 2812355029
632 2812477822
633 2819698407
634 2852638580
635 2862183884
636 2862283615
637 2862389927
638 2862511004
639 2862576626
640 2863409629
641 2867374562
642 2867430869
643 2867477017
644 2877678174
645 2912716636
646 2912729358
647 2918507368
648 2919472637
649 2935396139
650 2946046977
651 2946070869
652 2946078513
653 2947225929
654 2954010061
655 2954383067
656 2954679915
657 2954684237
658 2954693794
659 2954708888
660 2954713430
661 2954723394
662 2954738435
663 2954742297
664 2954757296
665 2954761269
666 2966599999
667 2997457630
668 3006488070
669 3006497885
670 8008563870
671 8008576367
672 8023628067
673 8025418003
674 8048406943
675 8054161801
676 8056829704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

14

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q37-assembly1.cif.gz_A-2 crystal structure of ohcu decarboxylase in the presence of (s)-allantoin 0.8932 26 156
3o7k-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8707 10 149
3o7j-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8355 10 149
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.8329 10 153
3o7i-assembly2.cif.gz_B crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8292 10 149
ID Description Score Start End Superfamily
af_I1MM35_6_163_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9166 22 156 1.10.3330.10
2o8iA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8469 16 150 1.10.3330.10
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8418 10 153 1.10.3330.10
af_Q54SV3_483_649_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8391 10 152 1.10.3330.10
2q37A00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8359 26 156 1.10.3330.10
ID Description Score Start End GO Terms
AF-A0A0M8VI53-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9727 11 156 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A0M8TMD8-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9699 1 156 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A370B8Z3-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9675 5 158 GO:0005777
GO:0006144
GO:0019628
GO:0033971
GO:0051997
AF-A0A6G4B2C8-F1-model_v4 deleted 0.9642 1 158
AF-W9FY90-F1-model_v4 deleted 0.9629 8 158

Map