F413231

General Info

Members Datasets Scaffolds Average Seq Length
337 219 674 330

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0118648|Ga0496109_0118648_971_1921
Length 316
Sequence VIVDEGTNPFEVGVATELFGLPRPELGRPEPLYELTLCTPTPGVRMNHGFFTLSGVPGLDAVDDADTLVVPGRPDNVVPRRPAVLDAIRRGHARGARVVSFCTGSFALAEAGLLDGRRATTHWRWTDVFRELHPRVLLDPDVLFVDEGDVLTAAGSAAALDLGLHLVRRDHGAEIANAVSRRLVFAAHRDGGQRQFVQRPLPEVRDESLAPLLAWTQERLGEPLTVGDLAAVSPATLHRRFRAQLGTTPLAWLTAERVALACRLIERGEVRLDVVADRSGLGTAANLRERVRRATGLSPSAYRRRFGAPTGEPVTA

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
74 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
159 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
162 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
163 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
164 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
165 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
166 2619618881 Frankia sp. ACN1ag Isolate Unclassified
167 2619619003 Frankia sp. CpI1-P Isolate Nodule
168 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
169 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
170 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
171 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
172 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
173 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
174 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
175 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
176 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
177 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
178 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
179 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
180 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
181 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
182 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
183 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
184 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
185 2862574272 Streptomyces sp. AcE210 Isolate Nodule
186 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
187 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
188 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
189 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
190 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
191 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
192 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
193 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
194 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
195 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
196 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
197 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
198 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
199 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
200 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
201 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
202 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
203 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
204 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
205 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
206 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
207 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
208 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
209 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
210 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
211 8002775197 Frankia nepalensis CN7 Isolate Nodule
212 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
213 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
214 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
215 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
216 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
217 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
218 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
219 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.2
Metatranscriptomes 0.3
Isolates 17.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 1.19
Rhizoplane 0.3
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0118648 3300048912 Bacteria 2463
2 rootH1_10012744 3300003316 Bacteria 13538
3 rootH1_10015402 3300003316 Bacteria 4504
4 rootH2_10003162 3300003320 Bacteria 3602
5 rootH1_10076089 3300003323 Bacteria 8670
6 rootH1_10238833 3300003323 Bacteria 1891
7 Ga0006562J51391_1048211 3300003578 Bacteria 5250
8 Ga0070668_100001075 3300005347 Bacteria 19228
9 Ga0070667_100017079 3300005367 Bacteria 6011
10 Ga0070713_100379203 3300005436 Bacteria 1317
11 Ga0070663_100002388 3300005455 Bacteria 10556
12 Ga0070665_100088352 3300005548 Bacteria 3105
13 Ga0068855_100137575 3300005563 Bacteria 2786
14 Ga0068862_100449346 3300005844 Bacteria 1215
15 Ga0081539_10000195 3300005985 Bacteria 141188
16 Ga0075365_10120903 3300006038 Bacteria 1806
17 Ga0075368_10065121 3300006042 Bacteria 1464
18 Ga0075363_100005119 3300006048 Bacteria 5798
19 Ga0075363_100006277 3300006048 Bacteria 5383
20 Ga0075367_10001095 3300006178 Bacteria 11193
21 Ga0105251_10022677 3300009011 Bacteria 3253
22 Ga0105245_10025364 3300009098 Bacteria 5214
23 Ga0105237_10000861 3300009545 Bacteria 41263
24 Ga0105239_10001018 3300010375 Bacteria 39155
25 Ga0105246_10000853 3300011119 Bacteria 17428
26 Ga0182008_10056531 3300014497 Bacteria 1938
27 Ga0182007_10002477 3300015262 Bacteria 9149
28 Ga0183367_1008 3300015688 Bacteria 490626
29 Ga0209758_1002667 3300025297 Bacteria 17635
30 Ga0209051_1014892 3300025303 Bacteria 3607
31 Ga0207713_1039889 3300025735 Bacteria 1976
32 Ga0207687_10324397 3300025927 Bacteria 1247
33 Ga0207661_10179820 3300025944 Bacteria 1847
34 Ga0207667_10135604 3300025949 Bacteria 2535
35 Ga0207678_10000848 3300026067 Bacteria 28054
36 Ga0209371_1003873 3300027312 Bacteria 6913
37 Ga0268266_10017556 3300028379 Bacteria 6105
38 Ga0268265_10226836 3300028380 Bacteria 1639
39 Ga0307517_10006148 3300028786 Bacteria 17886
40 Ga0307515_10000205 3300028794 Bacteria 144874
41 Ga0307515_10001228 3300028794 Bacteria 58620
42 Ga0307515_10043208 3300028794 Bacteria 7016
43 Ga0307515_10069536 3300028794 Bacteria 4810
44 Ga0307515_10075819 3300028794 Bacteria 4472
45 Ga0268256_1002035 3300030500 Bacteria 10913
46 Ga0307511_10001586 3300030521 Bacteria 24132
47 Ga0307511_10144833 3300030521 Bacteria 1383
48 Ga0307512_10007580 3300030522 Bacteria 10722
49 Ga0307513_10094708 3300031456 Bacteria 3030
50 Ga0307509_10007036 3300031507 Bacteria 14878
51 Ga0307509_10040528 3300031507 Bacteria 5065
52 Ga0307509_10052127 3300031507 Bacteria 4369
53 Ga0307509_10238635 3300031507 Bacteria 1613
54 Ga0307509_10372881 3300031507 Bacteria 1143
55 Ga0307508_10004027 3300031616 Bacteria 14537
56 Ga0307514_10063891 3300031649 Bacteria 2793
57 Ga0307516_10006594 3300031730 Bacteria 13567
58 Ga0307518_10000881 3300031838 Bacteria 22336
59 Ga0307518_10071770 3300031838 Bacteria 2507
60 Ga0307507_10047215 3300033179 Bacteria 4210
61 Ga0307507_10110072 3300033179 Bacteria 2255
62 Ga0307507_10157187 3300033179 Bacteria 1691
63 Ga0307507_10224640 3300033179 Bacteria 1256
64 Ga0307510_10005928 3300033180 Bacteria 14580
65 Ga0307510_10038822 3300033180 Bacteria 5257
66 Ga0307510_10057471 3300033180 Bacteria 4037
67 Ga0307510_10058317 3300033180 Bacteria 3998
68 Ga0395899_0189022 3300037312 Bacteria 1442
69 Ga0395900_0418020 3300037418 Bacteria 1302
70 Ga0395898_0007905 3300037466 Bacteria 11284
71 Ga0395898_0173301 3300037466 Bacteria 2062
72 Ga0395905_0171865 3300037471 Bacteria 2036
73 Ga0395901_0263110 3300038443 Bacteria 1795
74 Ga0439436_0000048 3300041404 Bacteria 36210
75 Ga0439436_0007267 3300041404 Bacteria 3406
76 Ga0439439_0000020 3300041406 Bacteria 23008
77 Ga0439439_0000291 3300041406 Bacteria 7988
78 Ga0451837_1462428 3300041494 Bacteria 4527
79 Ga0439433_0000072 3300041999 Bacteria 13049
80 Ga0439433_0002770 3300041999 Bacteria 3733
81 Ga0439449_0000855 3300042007 Bacteria 11842
82 Ga0439457_000006 3300042014 Bacteria 47136
83 Ga0439457_004987 3300042014 Bacteria 3395
84 Ga0439462_0000834 3300042015 Bacteria 6442
85 Ga0450899_002517 3300042135 Bacteria 1976
86 Ga0450903_000147 3300042138 Bacteria 15381
87 Ga0466972_0003699 3300044658 Bacteria 7614
88 Ga0466972_0016676 3300044658 Bacteria 3672
89 Ga0466972_0045606 3300044658 Bacteria 2124
90 Ga0466965_0002338 3300044683 Bacteria 8018
91 Ga0466965_0010226 3300044683 Bacteria 4370
92 Ga0466965_0015212 3300044683 Bacteria 3655
93 Ga0466966_0082418 3300044684 Bacteria 2002
94 Ga0466961_0011305 3300044693 Bacteria 5708
95 Ga0466961_0011722 3300044693 Bacteria 5603
96 Ga0466961_0018996 3300044693 Bacteria 4422
97 Ga0466963_0000994 3300044694 Bacteria 14620
98 Ga0466968_0009811 3300044735 Bacteria 3695
99 Ga0466970_0016994 3300044765 Bacteria 3756
100 Ga0466960_0001938 3300044901 Bacteria 7648
101 Ga0466958_0071455 3300045836 Bacteria 2125
102 Ga0466967_0024317 3300045976 Bacteria 4979
103 Ga0495617_022626 3300046452 Bacteria 2125
104 Ga0495617_034946 3300046452 Bacteria 1688
105 Ga0495627_044362 3300046453 Bacteria 1357
106 Ga0495592_0007095 3300046454 Bacteria 8385
107 Ga0495603_0008121 3300046455 Bacteria 6342
108 Ga0495603_0021950 3300046455 Bacteria 3864
109 Ga0495603_0027190 3300046455 Bacteria 3453
110 Ga0495603_0045985 3300046455 Bacteria 2601
111 Ga0495629_0003229 3300046459 Bacteria 12347
112 Ga0495629_0014092 3300046459 Bacteria 5759
113 Ga0495629_0037992 3300046459 Bacteria 3393
114 Ga0495629_0041552 3300046459 Bacteria 3235
115 Ga0495629_0169906 3300046459 Bacteria 1513
116 Ga0495638_0017529 3300046460 Bacteria 4771
117 Ga0495638_0066787 3300046460 Bacteria 2210
118 Ga0495651_0002277 3300046462 Bacteria 14820
119 Ga0495582_0083536 3300046473 Bacteria 1775
120 Ga0495605_0015129 3300046474 Bacteria 4205
121 Ga0495639_0001135 3300046475 Bacteria 12028
122 Ga0495639_0103975 3300046475 Bacteria 1343
123 Ga0495662_0000521 3300046476 Bacteria 17569
124 Ga0495662_0009644 3300046476 Bacteria 4734
125 Ga0495662_0053839 3300046476 Bacteria 1943
126 Ga0495662_0113528 3300046476 Bacteria 1328
127 Ga0495664_0006775 3300046477 Bacteria 6335
128 Ga0495585_0006412 3300046492 Bacteria 7307
129 Ga0495585_0036106 3300046492 Bacteria 2790
130 Ga0495585_0042027 3300046492 Bacteria 2562
131 Ga0495594_0003897 3300046499 Bacteria 7676
132 Ga0495594_0012673 3300046499 Bacteria 4396
133 Ga0495594_0020338 3300046499 Bacteria 3535
134 Ga0495583_0041377 3300046506 Bacteria 2158
135 Ga0495583_0042824 3300046506 Bacteria 2111
136 Ga0495608_0203608 3300046511 Bacteria 1246
137 Ga0495610_0005905 3300046512 Bacteria 8577
138 Ga0495616_0017459 3300046513 Bacteria 3958
139 Ga0495618_0028613 3300046514 Bacteria 3474
140 Ga0495620_0005013 3300046515 Bacteria 7422
141 Ga0495620_0030529 3300046515 Bacteria 2480
142 Ga0495628_0014305 3300046516 Bacteria 6657
143 Ga0495628_0083345 3300046516 Bacteria 2482
144 Ga0495628_0304256 3300046516 Bacteria 1179
145 Ga0495631_0014521 3300046518 Bacteria 3799
146 Ga0495631_0056068 3300046518 Bacteria 1716
147 Ga0495666_0031178 3300046526 Bacteria 2613
148 Ga0495666_0038314 3300046526 Bacteria 2331
149 Ga0495652_0051801 3300046529 Bacteria 3503
150 Ga0495640_0013049 3300046533 Bacteria 6327
151 Ga0495640_0056583 3300046533 Bacteria 2679
152 Ga0495586_0020728 3300046535 Bacteria 3502
153 Ga0495587_0000883 3300046536 Bacteria 19828
154 Ga0495597_0036619 3300046542 Bacteria 2208
155 Ga0495645_0050811 3300046543 Bacteria 3017
156 Ga0495645_0083998 3300046543 Bacteria 2281
157 Ga0495622_0050553 3300046557 Bacteria 1928
158 Ga0495667_0039202 3300046559 Bacteria 3152
159 Ga0495668_0020272 3300046616 Bacteria 3825
160 Ga0495634_0025208 3300046642 Bacteria 4166
161 Ga0495634_0044412 3300046642 Bacteria 3007
162 Ga0495611_0005056 3300046648 Bacteria 5655
163 Ga0495625_0024179 3300046660 Bacteria 4628
164 Ga0495625_0025704 3300046660 Bacteria 4461
165 Ga0495625_0052782 3300046660 Bacteria 2910
166 Ga0495625_0199553 3300046660 Bacteria 1321
167 Ga0495625_0305099 3300046660 Bacteria 1017
168 Ga0495635_0000321 3300046663 Bacteria 30958
169 Ga0495635_0336097 3300046663 Bacteria 1009
170 Ga0495661_0060357 3300046665 Bacteria 2253
171 Ga0495588_0001891 3300046674 Bacteria 8936
172 Ga0495588_0004932 3300046674 Bacteria 5920
173 Ga0495657_0004177 3300046675 Bacteria 11568
174 Ga0495657_0006295 3300046675 Bacteria 9300
175 Ga0495657_0074948 3300046675 Bacteria 2200
176 Ga0495657_0172642 3300046675 Bacteria 1330
177 Ga0495623_0014463 3300046679 Bacteria 5107
178 Ga0495646_0000440 3300046680 Bacteria 21966
179 Ga0495613_0001963 3300046689 Bacteria 15617
180 Ga0495613_0002118 3300046689 Bacteria 15063
181 Ga0495613_0026253 3300046689 Bacteria 4340
182 Ga0495613_0059022 3300046689 Bacteria 2813
183 Ga0495613_0087392 3300046689 Bacteria 2259
184 Ga0495671_0025687 3300046692 Bacteria 3058
185 Ga0495649_0023743 3300046694 Bacteria 3425
186 Ga0495589_0008999 3300046794 Bacteria 5193
187 Ga0495589_0025699 3300046794 Bacteria 2987
188 Ga0495589_0047872 3300046794 Bacteria 2117
189 Ga0495600_0087677 3300046809 Bacteria 2030
190 Ga0495660_0082944 3300046810 Bacteria 1677
191 Ga0495660_0136036 3300046810 Bacteria 1228
192 Ga0495581_0000548 3300047315 Bacteria 19401
193 Ga0495581_0094164 3300047315 Bacteria 1739
194 Ga0495604_0000902 3300047317 Bacteria 24693
195 Ga0495604_0021762 3300047317 Bacteria 5119
196 Ga0495636_0007410 3300047318 Bacteria 4318
197 Ga0495636_0040264 3300047318 Bacteria 1937
198 Ga0495636_0086273 3300047318 Bacteria 1358
199 Ga0495674_0062127 3300047319 Bacteria 3253
200 Ga0495672_0086827 3300047320 Bacteria 1729
201 Ga0495676_0007570 3300047321 Bacteria 9959
202 Ga0495676_0049796 3300047321 Bacteria 3364
203 Ga0495676_0078725 3300047321 Bacteria 2508
204 Ga0495676_0203324 3300047321 Bacteria 1375
205 Ga0495680_0063151 3300047322 Bacteria 2844
206 Ga0495680_0178126 3300047322 Bacteria 1536
207 Ga0495683_0005548 3300047323 Bacteria 6996
208 Ga0495683_0018928 3300047323 Bacteria 3555
209 Ga0495687_006300 3300047443 Bacteria 7311
210 Ga0495687_020386 3300047443 Bacteria 3230
211 Ga0495687_023641 3300047443 Bacteria 2932
212 Ga0495687_055929 3300047443 Bacteria 1647
213 Ga0495675_0087565 3300047444 Bacteria 1957
214 Ga0495675_0088077 3300047444 Bacteria 1950
215 Ga0495675_0098107 3300047444 Bacteria 1836
216 Ga0495685_003213 3300047447 Bacteria 5192
217 Ga0495685_009853 3300047447 Bacteria 3197
218 Ga0495681_0001734 3300047470 Bacteria 16131
219 Ga0495686_0112955 3300047472 Bacteria 1627
220 Ga0495593_0019816 3300047673 Bacteria 3769
221 Ga0495614_0006697 3300048089 Bacteria 5159
222 Ga0495614_0015953 3300048089 Bacteria 3271
223 Ga0495614_0060123 3300048089 Bacteria 1633
224 Ga0495626_0018069 3300048091 Bacteria 3549
225 Ga0501031_0026228 3300049568 Bacteria 3800
226 Ga0501032_0112011 3300049569 Bacteria 1805
227 Ga0501033_0013505 3300049570 Bacteria 6218
228 Ga0501033_0023700 3300049570 Bacteria 4629
229 Ga0501033_0179062 3300049570 Bacteria 1520
230 Ga0501034_0017918 3300049571 Bacteria 7264
231 Ga0501034_0026474 3300049571 Bacteria 5906
232 Ga0501034_0136534 3300049571 Bacteria 2433
233 Ga0501034_0297546 3300049571 Bacteria 1551
234 Ga0501036_0000664 3300049572 Bacteria 25261
235 Ga0501036_0076558 3300049572 Bacteria 2830
236 Ga0501036_0176288 3300049572 Bacteria 1800
237 Ga0501037_0034868 3300049573 Bacteria 3712
238 Ga0501037_0039313 3300049573 Bacteria 3483
239 Ga0501037_0161933 3300049573 Bacteria 1595
240 Ga0501038_0014335 3300049574 Bacteria 7223
241 Ga0501038_0026375 3300049574 Bacteria 5175
242 Ga0501039_0068106 3300049575 Bacteria 2764
243 Ga0501042_0034280 3300049578 Bacteria 3600
244 Ga0501043_0007868 3300049579 Bacteria 8431
245 Ga0501043_0033638 3300049579 Bacteria 4033
246 Ga0501043_0089224 3300049579 Bacteria 2423
247 Ga0501043_0096167 3300049579 Bacteria 2328
248 Ga0501046_0007987 3300049580 Bacteria 9252
249 Ga0501046_0021740 3300049580 Bacteria 5290
250 Ga0501047_0033426 3300049581 Bacteria 4964
251 Ga0501047_0044189 3300049581 Bacteria 4304
252 Ga0501047_0069033 3300049581 Bacteria 3404
253 Ga0501047_0084479 3300049581 Bacteria 3051
254 Ga0501047_0135745 3300049581 Bacteria 2340
255 Ga0501048_0029559 3300049582 Bacteria 3972
256 Ga0501048_0109388 3300049582 Bacteria 1951
257 Ga0501048_0140088 3300049582 Bacteria 1711
258 Ga0501071_0183378 3300049587 Bacteria 1569
259 Ga0501074_0077836 3300049590 Bacteria 2380
260 Ga0501080_0176309 3300049742 Bacteria 1969
261 Ga0501035_0066219 3300049822 Bacteria 3206
262 Ga0501035_0112883 3300049822 Bacteria 2380
263 Ga0501035_0181016 3300049822 Bacteria 1816
264 Ga0501035_0227035 3300049822 Bacteria 1592
265 Ga0501035_0276408 3300049822 Bacteria 1420
266 Ga0501044_0042638 3300049823 Bacteria 4718
267 Ga0501044_0061192 3300049823 Bacteria 3852
268 Ga0501044_0148560 3300049823 Bacteria 2327
269 Ga0501044_0169747 3300049823 Bacteria 2154
270 Ga0501044_0261084 3300049823 Bacteria 1670
271 nmdc:mga03n38_2647_c1 3300050490 Bacteria 5590
272 nmdc:mga0yw44_135027_c1 3300050492 Bacteria 1600
273 nmdc:mga06z11_4331_c1 3300050494 Bacteria 5580
274 Ga0500583_0034644 3300053092 Bacteria 2246
275 Ga0500640_003210 3300053095 Bacteria 5642
276 Ga0500560_001442 3300053107 Bacteria 4138
277 Ga0466962_0031133 3300061719 Bacteria 2554
278 Ga0466962_0053922 3300061719 Bacteria 1921
279 2585301844 2582581312 Bacteria 7308206
280 2585305655 2582581313 Bacteria 10042643
281 2585312653 2582581314 Bacteria 11452267
282 2586059500 2585427649 Bacteria 9053857
283 2616700551 2616644814 Bacteria 11555299
284 2619855568 2619618881 Bacteria 7521104
285 2620350842 2619619003 Bacteria 7619552
286 2644015787 2643221601 Bacteria 7493239
287 2644175098 2643221631 Bacteria 8168043
288 2644442976 2643221678 Bacteria 9540101
289 2676490007 2675903060 Bacteria 10051191
290 2768643062 2767802112 Bacteria 6465194
291 2785370145 2784746768 Bacteria 10036182
292 2786671164 2786546132 Bacteria 10419719
293 2795782365 2795385470 Bacteria 8317180
294 2795793124 2795385472 Bacteria 6627535
295 2808842602 2808606359 Bacteria 9866990
296 2808917024 2808606375 Bacteria 9466072
297 2809591739 2808606522 Bacteria 9488490
298 2812357515 2811994879 Bacteria 9313447
299 2819698670 2818991463 Bacteria 7948711
300 2861527135 2861520306 Bacteria 8348283
301 2862181705 2862178590 Bacteria 8583590
302 2862286195 2862281513 Bacteria 9621493
303 2862578725 2862574272 Bacteria 10567477
304 2870790221 2870782633 Bacteria 9624083
305 2873157494 2873151551 Bacteria 8625867
306 2877680541 2877676314 Bacteria 9512378
307 2912719191 2912715099 Bacteria 9460473
308 2912764521 2912757875 Bacteria 7940295
309 2915771805 2915768154 Bacteria 8424322
310 2917742232 2917736166 Bacteria 9690793
311 2919475558 2919468124 Bacteria 9133025
312 2947228549 2947224130 Bacteria 9938529
313 2954006976 2954002825 Bacteria 9173742
314 2954677497 2954673503 Bacteria 9685905
315 2954686657 2954682443 Bacteria 9862841
316 2954715674 2954711539 Bacteria 10867210
317 2954725611 2954721474 Bacteria 10456478
318 2954736201 2954731030 Bacteria 10243860
319 2954744550 2954740390 Bacteria 10229294
320 2954755048 2954749733 Bacteria 10366972
321 2954763533 2954759201 Bacteria 9358192
322 2995469939 2995463766 Bacteria 8577691
323 2997452002 2997451912 Bacteria 8492419
324 3002999435 3002998708 Bacteria 11715108
325 3006326180 3006321560 Bacteria 8247479
326 3006398302 3006393351 Bacteria 6615579
327 3006491207 3006486233 Bacteria 8157040
328 3006499524 3006493962 Bacteria 8825450
329 8002775616 8002775197 Bacteria 10728764
330 8003316995 8003314358 Bacteria 10575343
331 8023630759 8023623736 Bacteria 8593882
332 8025417342 8025413630 Bacteria 7014048
333 8025536835 8025530807 Bacteria 8495698
334 8053953538 8053945823 Bacteria 8962862
335 8054916069 8054913762 Bacteria 7713009
336 8056669718 8056667051 Bacteria 6953971
337 8056837923 8056829672 Bacteria 9045328
338 Ga0496109_0118648
339 rootH1_10012744
340 rootH1_10015402
341 rootH2_10003162
342 rootH1_10076089
343 rootH1_10238833
344 Ga0006562J51391_1048211
345 Ga0070668_100001075
346 Ga0070667_100017079
347 Ga0070713_100379203
348 Ga0070663_100002388
349 Ga0070665_100088352
350 Ga0068855_100137575
351 Ga0068862_100449346
352 Ga0081539_10000195
353 Ga0075365_10120903
354 Ga0075368_10065121
355 Ga0075363_100005119
356 Ga0075363_100006277
357 Ga0075367_10001095
358 Ga0105251_10022677
359 Ga0105245_10025364
360 Ga0105237_10000861
361 Ga0105239_10001018
362 Ga0105246_10000853
363 Ga0182008_10056531
364 Ga0182007_10002477
365 Ga0183367_1008
366 Ga0209758_1002667
367 Ga0209051_1014892
368 Ga0207713_1039889
369 Ga0207687_10324397
370 Ga0207661_10179820
371 Ga0207667_10135604
372 Ga0207678_10000848
373 Ga0209371_1003873
374 Ga0268266_10017556
375 Ga0268265_10226836
376 Ga0307517_10006148
377 Ga0307515_10000205
378 Ga0307515_10001228
379 Ga0307515_10043208
380 Ga0307515_10069536
381 Ga0307515_10075819
382 Ga0268256_1002035
383 Ga0307511_10001586
384 Ga0307511_10144833
385 Ga0307512_10007580
386 Ga0307513_10094708
387 Ga0307509_10007036
388 Ga0307509_10040528
389 Ga0307509_10052127
390 Ga0307509_10238635
391 Ga0307509_10372881
392 Ga0307508_10004027
393 Ga0307514_10063891
394 Ga0307516_10006594
395 Ga0307518_10000881
396 Ga0307518_10071770
397 Ga0307507_10047215
398 Ga0307507_10110072
399 Ga0307507_10157187
400 Ga0307507_10224640
401 Ga0307510_10005928
402 Ga0307510_10038822
403 Ga0307510_10057471
404 Ga0307510_10058317
405 Ga0395899_0189022
406 Ga0395900_0418020
407 Ga0395898_0007905
408 Ga0395898_0173301
409 Ga0395905_0171865
410 Ga0395901_0263110
411 Ga0439436_0000048
412 Ga0439436_0007267
413 Ga0439439_0000020
414 Ga0439439_0000291
415 Ga0451837_1462428
416 Ga0439433_0000072
417 Ga0439433_0002770
418 Ga0439449_0000855
419 Ga0439457_000006
420 Ga0439457_004987
421 Ga0439462_0000834
422 Ga0450899_002517
423 Ga0450903_000147
424 Ga0466972_0003699
425 Ga0466972_0016676
426 Ga0466972_0045606
427 Ga0466965_0002338
428 Ga0466965_0010226
429 Ga0466965_0015212
430 Ga0466966_0082418
431 Ga0466961_0011305
432 Ga0466961_0011722
433 Ga0466961_0018996
434 Ga0466963_0000994
435 Ga0466968_0009811
436 Ga0466970_0016994
437 Ga0466960_0001938
438 Ga0466958_0071455
439 Ga0466967_0024317
440 Ga0495617_022626
441 Ga0495617_034946
442 Ga0495627_044362
443 Ga0495592_0007095
444 Ga0495603_0008121
445 Ga0495603_0021950
446 Ga0495603_0027190
447 Ga0495603_0045985
448 Ga0495629_0003229
449 Ga0495629_0014092
450 Ga0495629_0037992
451 Ga0495629_0041552
452 Ga0495629_0169906
453 Ga0495638_0017529
454 Ga0495638_0066787
455 Ga0495651_0002277
456 Ga0495582_0083536
457 Ga0495605_0015129
458 Ga0495639_0001135
459 Ga0495639_0103975
460 Ga0495662_0000521
461 Ga0495662_0009644
462 Ga0495662_0053839
463 Ga0495662_0113528
464 Ga0495664_0006775
465 Ga0495585_0006412
466 Ga0495585_0036106
467 Ga0495585_0042027
468 Ga0495594_0003897
469 Ga0495594_0012673
470 Ga0495594_0020338
471 Ga0495583_0041377
472 Ga0495583_0042824
473 Ga0495608_0203608
474 Ga0495610_0005905
475 Ga0495616_0017459
476 Ga0495618_0028613
477 Ga0495620_0005013
478 Ga0495620_0030529
479 Ga0495628_0014305
480 Ga0495628_0083345
481 Ga0495628_0304256
482 Ga0495631_0014521
483 Ga0495631_0056068
484 Ga0495666_0031178
485 Ga0495666_0038314
486 Ga0495652_0051801
487 Ga0495640_0013049
488 Ga0495640_0056583
489 Ga0495586_0020728
490 Ga0495587_0000883
491 Ga0495597_0036619
492 Ga0495645_0050811
493 Ga0495645_0083998
494 Ga0495622_0050553
495 Ga0495667_0039202
496 Ga0495668_0020272
497 Ga0495634_0025208
498 Ga0495634_0044412
499 Ga0495611_0005056
500 Ga0495625_0024179
501 Ga0495625_0025704
502 Ga0495625_0052782
503 Ga0495625_0199553
504 Ga0495625_0305099
505 Ga0495635_0000321
506 Ga0495635_0336097
507 Ga0495661_0060357
508 Ga0495588_0001891
509 Ga0495588_0004932
510 Ga0495657_0004177
511 Ga0495657_0006295
512 Ga0495657_0074948
513 Ga0495657_0172642
514 Ga0495623_0014463
515 Ga0495646_0000440
516 Ga0495613_0001963
517 Ga0495613_0002118
518 Ga0495613_0026253
519 Ga0495613_0059022
520 Ga0495613_0087392
521 Ga0495671_0025687
522 Ga0495649_0023743
523 Ga0495589_0008999
524 Ga0495589_0025699
525 Ga0495589_0047872
526 Ga0495600_0087677
527 Ga0495660_0082944
528 Ga0495660_0136036
529 Ga0495581_0000548
530 Ga0495581_0094164
531 Ga0495604_0000902
532 Ga0495604_0021762
533 Ga0495636_0007410
534 Ga0495636_0040264
535 Ga0495636_0086273
536 Ga0495674_0062127
537 Ga0495672_0086827
538 Ga0495676_0007570
539 Ga0495676_0049796
540 Ga0495676_0078725
541 Ga0495676_0203324
542 Ga0495680_0063151
543 Ga0495680_0178126
544 Ga0495683_0005548
545 Ga0495683_0018928
546 Ga0495687_006300
547 Ga0495687_020386
548 Ga0495687_023641
549 Ga0495687_055929
550 Ga0495675_0087565
551 Ga0495675_0088077
552 Ga0495675_0098107
553 Ga0495685_003213
554 Ga0495685_009853
555 Ga0495681_0001734
556 Ga0495686_0112955
557 Ga0495593_0019816
558 Ga0495614_0006697
559 Ga0495614_0015953
560 Ga0495614_0060123
561 Ga0495626_0018069
562 Ga0501031_0026228
563 Ga0501032_0112011
564 Ga0501033_0013505
565 Ga0501033_0023700
566 Ga0501033_0179062
567 Ga0501034_0017918
568 Ga0501034_0026474
569 Ga0501034_0136534
570 Ga0501034_0297546
571 Ga0501036_0000664
572 Ga0501036_0076558
573 Ga0501036_0176288
574 Ga0501037_0034868
575 Ga0501037_0039313
576 Ga0501037_0161933
577 Ga0501038_0014335
578 Ga0501038_0026375
579 Ga0501039_0068106
580 Ga0501042_0034280
581 Ga0501043_0007868
582 Ga0501043_0033638
583 Ga0501043_0089224
584 Ga0501043_0096167
585 Ga0501046_0007987
586 Ga0501046_0021740
587 Ga0501047_0033426
588 Ga0501047_0044189
589 Ga0501047_0069033
590 Ga0501047_0084479
591 Ga0501047_0135745
592 Ga0501048_0029559
593 Ga0501048_0109388
594 Ga0501048_0140088
595 Ga0501071_0183378
596 Ga0501074_0077836
597 Ga0501080_0176309
598 Ga0501035_0066219
599 Ga0501035_0112883
600 Ga0501035_0181016
601 Ga0501035_0227035
602 Ga0501035_0276408
603 Ga0501044_0042638
604 Ga0501044_0061192
605 Ga0501044_0148560
606 Ga0501044_0169747
607 Ga0501044_0261084
608 nmdc:mga03n38_2647_c1
609 nmdc:mga0yw44_135027_c1
610 nmdc:mga06z11_4331_c1
611 Ga0500583_0034644
612 Ga0500640_003210
613 Ga0500560_001442
614 Ga0466962_0031133
615 Ga0466962_0053922
616 2585301844
617 2585305655
618 2585312653
619 2586059500
620 2616700551
621 2619855568
622 2620350842
623 2644015787
624 2644175098
625 2644442976
626 2676490007
627 2768643062
628 2785370145
629 2786671164
630 2795782365
631 2795793124
632 2808842602
633 2808917024
634 2809591739
635 2812357515
636 2819698670
637 2861527135
638 2862181705
639 2862286195
640 2862578725
641 2870790221
642 2873157494
643 2877680541
644 2912719191
645 2912764521
646 2915771805
647 2917742232
648 2919475558
649 2947228549
650 2954006976
651 2954677497
652 2954686657
653 2954715674
654 2954725611
655 2954736201
656 2954744550
657 2954755048
658 2954763533
659 2995469939
660 2997452002
661 3002999435
662 3006326180
663 3006398302
664 3006491207
665 3006499524
666 8002775616
667 8003316995
668 8023630759
669 8025417342
670 8025536835
671 8053953538
672 8054916069
673 8056669718
674 8056837923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

227

305

0.96

PF01965

DJ-1_PfpI

DJ-1/PfpI family

50

169

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9608 224 324
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.95 224 326
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9477 225 321
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9226 225 312
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9219 225 316
ID Description Score Start End Superfamily
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9608 224 324 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9321 272 324 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9301 223 324 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.926 273 324 1.10.10.60
af_P05052_134_237_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9244 225 323 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7R7EJ50-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9587 224 324 GO:0003700
GO:0043565
AF-A0A644U0M6-F1-model_v4 DNA gyrase inhibitor 0.9532 227 322 GO:0003700
GO:0043565
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.95 224 322 GO:0003700
GO:0043565
AF-A0A069SXS9-F1-model_v4 deleted 0.9482 230 324
AF-A0A1G8AJA1-F1-model_v4 Helix-turn-helix domain-containing protein 0.9473 232 323 GO:0003700
GO:0043565

Map