F413146

General Info

Members Datasets Scaffolds Average Seq Length
337 216 674 102

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10174936|Ga0307413_101749362
Length 116
Sequence MAPLTPGRIRHTVVFVLSHPEGSPEEADFLAAAAALAAIPGVEAFEQLLEVSPKNDYRHGISMEFADRAAYEGYNGHPDHVRFVQERWLAEVTDFLEIDYEARADSSRSAARSPSA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
144 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
145 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
146 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 8.61
Rhizosphere 88.43
Stem 0
Stem Tuber 0
Unclassified 34.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10174936 3300031824 Bacteria 1524
2 JGI24742J22300_10043235 3300002244 Unclassified 806
3 JGI24751J29686_10127024 3300002459 Unclassified 537
4 Ga0070658_10228373 3300005327 Bacteria 1575
5 Ga0070676_10265577 3300005328 Unclassified 1151
6 Ga0070683_100350688 3300005329 Bacteria 1405
7 Ga0070683_100874630 3300005329 Bacteria 862
8 Ga0070683_100995757 3300005329 Bacteria 805
9 Ga0070670_100593542 3300005331 Unclassified 991
10 Ga0070670_100779040 3300005331 Unclassified 863
11 Ga0070670_102258774 3300005331 Unclassified 501
12 Ga0070680_101706205 3300005336 Unclassified 546
13 Ga0070682_101681862 3300005337 Bacteria 551
14 Ga0070660_100013342 3300005339 Bacteria 5891
15 Ga0070660_100581478 3300005339 Unclassified 935
16 Ga0070691_10883428 3300005341 Unclassified 550
17 Ga0070661_100272298 3300005344 Bacteria 1312
18 Ga0070661_100372110 3300005344 Bacteria 1125
19 Ga0070661_100519598 3300005344 Unclassified 955
20 Ga0070668_100733069 3300005347 Unclassified 874
21 Ga0070668_101114723 3300005347 Bacteria 713
22 Ga0070675_100044841 3300005354 Unclassified 3617
23 Ga0070671_100583807 3300005355 Bacteria 965
24 Ga0070671_100614768 3300005355 Unclassified 939
25 Ga0070674_100094517 3300005356 Bacteria 2165
26 Ga0070674_100228556 3300005356 Bacteria 1451
27 Ga0070673_100281374 3300005364 Bacteria 1459
28 Ga0070688_100375594 3300005365 Bacteria 1046
29 Ga0070688_101595382 3300005365 Unclassified 533
30 Ga0070688_101794076 3300005365 Bacteria 503
31 Ga0070659_100976650 3300005366 Unclassified 743
32 Ga0070709_10480237 3300005434 Unclassified 941
33 Ga0070701_10859286 3300005438 Bacteria 623
34 Ga0070701_11327720 3300005438 Unclassified 515
35 Ga0070711_100679520 3300005439 Unclassified 865
36 Ga0070700_100023492 3300005441 Bacteria 3606
37 Ga0070700_100155249 3300005441 Bacteria 1570
38 Ga0070708_100014260 3300005445 Bacteria 6532
39 Ga0070708_100569034 3300005445 Bacteria 1069
40 Ga0070663_100930750 3300005455 Bacteria 752
41 Ga0070663_101436312 3300005455 Unclassified 612
42 Ga0070681_10164283 3300005458 Bacteria 2143
43 Ga0068867_100184736 3300005459 Bacteria 1660
44 Ga0068867_100268791 3300005459 Bacteria 1393
45 Ga0068867_100584497 3300005459 Unclassified 972
46 Ga0070706_100007763 3300005467 Bacteria 10035
47 Ga0070707_100002425 3300005468 Bacteria 17768
48 Ga0070707_100854773 3300005468 Bacteria 874
49 Ga0070707_101354977 3300005468 Bacteria 678
50 Ga0070698_100108958 3300005471 Bacteria 2736
51 Ga0070698_100490909 3300005471 Bacteria 1165
52 Ga0070699_100001544 3300005518 Bacteria 21051
53 Ga0070699_100025473 3300005518 Bacteria 5099
54 Ga0070699_100069896 3300005518 Bacteria 3052
55 Ga0070699_100207867 3300005518 Bacteria 1742
56 Ga0070679_102124180 3300005530 Bacteria 511
57 Ga0070684_100190193 3300005535 Bacteria 1867
58 Ga0070684_100459753 3300005535 Bacteria 1177
59 Ga0070697_100202283 3300005536 Bacteria 1688
60 Ga0070686_100095464 3300005544 Unclassified 1997
61 Ga0070686_101171583 3300005544 Unclassified 637
62 Ga0070693_100925654 3300005547 Unclassified 655
63 Ga0070665_101491519 3300005548 Unclassified 685
64 Ga0070665_101655197 3300005548 Unclassified 647
65 Ga0070704_100726573 3300005549 Bacteria 883
66 Ga0070704_100972735 3300005549 Bacteria 766
67 Ga0068855_100233940 3300005563 Bacteria 2056
68 Ga0070664_100313967 3300005564 Unclassified 1419
69 Ga0068857_101333849 3300005577 Unclassified 697
70 Ga0068856_100018046 3300005614 Bacteria 6842
71 Ga0070702_100079596 3300005615 Bacteria 1959
72 Ga0068852_101511627 3300005616 Unclassified 694
73 Ga0068864_100366998 3300005618 Unclassified 1361
74 Ga0068866_10401745 3300005718 Unclassified 884
75 Ga0068866_11066767 3300005718 Unclassified 577
76 Ga0068861_100433868 3300005719 Bacteria 1173
77 Ga0068870_10119898 3300005840 Bacteria 1514
78 Ga0068858_100895864 3300005842 Bacteria 867
79 Ga0068860_101191438 3300005843 Bacteria 782
80 Ga0070712_100846243 3300006175 Bacteria 787
81 Ga0075433_10068140 3300006852 Bacteria 3124
82 Ga0075434_100033664 3300006871 Bacteria 5059
83 Ga0068865_100167010 3300006881 Bacteria 1683
84 Ga0075436_100159504 3300006914 Bacteria 1590
85 Ga0075436_100310699 3300006914 Bacteria 1131
86 Ga0075435_100114607 3300007076 Bacteria 2244
87 Ga0099794_10581334 3300007265 Unclassified 592
88 Ga0105244_10358232 3300009036 Unclassified 672
89 Ga0105245_10267305 3300009098 Bacteria 1666
90 Ga0105245_10670400 3300009098 Bacteria 1068
91 Ga0105245_10926564 3300009098 Unclassified 913
92 Ga0105245_11350228 3300009098 Unclassified 762
93 Ga0105243_10364323 3300009148 Bacteria 1331
94 Ga0105243_11038004 3300009148 Bacteria 825
95 Ga0105243_11063451 3300009148 Unclassified 815
96 Ga0105243_11067983 3300009148 Archaea 814
97 Ga0105241_12470033 3300009174 Unclassified 520
98 Ga0105242_10320356 3300009176 Bacteria 1422
99 Ga0105242_11590728 3300009176 Unclassified 687
100 Ga0105242_11838119 3300009176 Unclassified 645
101 Ga0105248_11177268 3300009177 Unclassified 866
102 Ga0105248_12713357 3300009177 Unclassified 565
103 Ga0105238_11924445 3300009551 Unclassified 624
104 Ga0105249_11648059 3300009553 Unclassified 714
105 Ga0105246_11055799 3300011119 Bacteria 739
106 Ga0105246_11564577 3300011119 Bacteria 622
107 Ga0105246_12367552 3300011119 Bacteria 520
108 Ga0157373_10095117 3300013100 Bacteria 2097
109 Ga0157374_10234732 3300013296 Bacteria 1803
110 Ga0157378_10350854 3300013297 Bacteria 1441
111 Ga0163162_12024022 3300013306 Bacteria 660
112 Ga0157372_10522996 3300013307 Unclassified 1383
113 Ga0157375_10418528 3300013308 Unclassified 1506
114 Ga0157375_11539627 3300013308 Bacteria 785
115 Ga0157375_12316192 3300013308 Bacteria 640
116 Ga0157375_13214272 3300013308 Unclassified 545
117 Ga0163163_10242744 3300014325 Bacteria 1851
118 Ga0163163_10296656 3300014325 Bacteria 1669
119 Ga0157380_11110749 3300014326 Unclassified 830
120 Ga0157380_12012105 3300014326 Unclassified 640
121 Ga0157380_12412870 3300014326 Bacteria 591
122 Ga0157380_12632237 3300014326 Unclassified 569
123 Ga0157380_12919350 3300014326 Unclassified 544
124 Ga0157377_10103744 3300014745 Unclassified 1699
125 Ga0157376_11293251 3300014969 Unclassified 759
126 Ga0157376_11314812 3300014969 Unclassified 753
127 Ga0213876_10472540 3300021384 Bacteria 667
128 Ga0207642_10131593 3300025899 Unclassified 1306
129 Ga0207642_11034767 3300025899 Unclassified 529
130 Ga0207688_10146948 3300025901 Bacteria 1390
131 Ga0207688_10763277 3300025901 Unclassified 612
132 Ga0207688_10813561 3300025901 Bacteria 592
133 Ga0207699_10394148 3300025906 Unclassified 985
134 Ga0207643_10494445 3300025908 Unclassified 781
135 Ga0207705_10462212 3300025909 Bacteria 984
136 Ga0207705_10515530 3300025909 Bacteria 929
137 Ga0207684_10037062 3300025910 Bacteria 4139
138 Ga0207684_10776713 3300025910 Unclassified 811
139 Ga0207662_10231786 3300025918 Unclassified 1206
140 Ga0207657_10027418 3300025919 Bacteria 5217
141 Ga0207657_11340506 3300025919 Unclassified 539
142 Ga0207652_10486666 3300025921 Bacteria 1111
143 Ga0207646_10002167 3300025922 Bacteria 23455
144 Ga0207646_11083188 3300025922 Bacteria 706
145 Ga0207681_11198935 3300025923 Bacteria 638
146 Ga0207659_10086819 3300025926 Bacteria 2327
147 Ga0207659_10196548 3300025926 Bacteria 1608
148 Ga0207687_10252634 3300025927 Bacteria 1402
149 Ga0207687_10330885 3300025927 Archaea 1236
150 Ga0207687_10758013 3300025927 Bacteria 826
151 Ga0207687_11137444 3300025927 Unclassified 671
152 Ga0207644_11178062 3300025931 Bacteria 644
153 Ga0207644_11484712 3300025931 Unclassified 569
154 Ga0207690_10430265 3300025932 Bacteria 1057
155 Ga0207706_10376297 3300025933 Unclassified 1233
156 Ga0207686_10403336 3300025934 Bacteria 1042
157 Ga0207686_10449846 3300025934 Unclassified 991
158 Ga0207709_10438799 3300025935 Unclassified 1007
159 Ga0207669_10119672 3300025937 Bacteria 1784
160 Ga0207669_10174690 3300025937 Unclassified 1533
161 Ga0207669_10181417 3300025937 Bacteria 1510
162 Ga0207669_10440594 3300025937 Unclassified 1030
163 Ga0207669_11075800 3300025937 Unclassified 678
164 Ga0207704_10163119 3300025938 Bacteria 1588
165 Ga0207665_10449530 3300025939 Unclassified 989
166 Ga0207661_10271652 3300025944 Unclassified 1513
167 Ga0207661_10373635 3300025944 Bacteria 1289
168 Ga0207661_11523162 3300025944 Bacteria 613
169 Ga0207679_10280535 3300025945 Bacteria 1429
170 Ga0207679_10992494 3300025945 Unclassified 769
171 Ga0207667_10841507 3300025949 Bacteria 912
172 Ga0207712_11563471 3300025961 Bacteria 591
173 Ga0207677_11014462 3300026023 Unclassified 753
174 Ga0207677_11261292 3300026023 Bacteria 678
175 Ga0207677_11865449 3300026023 Unclassified 558
176 Ga0207703_10626790 3300026035 Bacteria 1019
177 Ga0207702_10285731 3300026078 Bacteria 1561
178 Ga0207648_10437930 3300026089 Unclassified 1189
179 Ga0207648_10525372 3300026089 Unclassified 1085
180 Ga0207648_11792609 3300026089 Unclassified 575
181 Ga0207676_10138166 3300026095 Bacteria 2082
182 Ga0207674_10398570 3300026116 Bacteria 1330
183 Ga0207674_12202107 3300026116 Bacteria 514
184 Ga0207698_12327666 3300026142 Unclassified 547
185 Ga0268264_10137018 3300028381 Bacteria 2178
186 Ga0265319_1006869 3300028563 Bacteria 5197
187 Ga0265319_1080799 3300028563 Bacteria 1032
188 Ga0265334_10012186 3300028573 Bacteria 3613
189 Ga0265318_10003613 3300028577 Bacteria 7729
190 Ga0265322_10090858 3300028654 Bacteria 868
191 Ga0265338_10006609 3300028800 Bacteria 14696
192 Ga0265338_10374858 3300028800 Bacteria 1019
193 Ga0265330_10073240 3300031235 Bacteria 1481
194 Ga0265320_10213317 3300031240 Unclassified 861
195 Ga0265329_10016654 3300031242 Bacteria 2544
196 Ga0265339_10080891 3300031249 Bacteria 1718
197 Ga0265327_10202226 3300031251 Unclassified 899
198 Ga0265327_10280143 3300031251 Bacteria 737
199 Ga0265316_10097569 3300031344 Bacteria 2236
200 Ga0265314_10260100 3300031711 Unclassified 991
201 Ga0307405_10743021 3300031731 Bacteria 817
202 Ga0307413_10524579 3300031824 Unclassified 956
203 Ga0307410_10736137 3300031852 Bacteria 834
204 Ga0307410_10952642 3300031852 Bacteria 738
205 Ga0307412_10535442 3300031911 Bacteria 981
206 Ga0307416_100426535 3300032002 Bacteria 1372
207 Ga0307416_100440988 3300032002 Bacteria 1352
208 Ga0307416_100480082 3300032002 Bacteria 1303
209 Ga0307415_100688012 3300032126 Bacteria 921
210 Ga0373943_0537658 3300035170 Bacteria 685
211 Ga0373947_0020494 3300035725 Bacteria 3817
212 Ga0373925_1128442 3300037068 Unclassified 645
213 Ga0395898_0340319 3300037466 Bacteria 1431
214 Ga0436364_0664838 3300037853 Bacteria 1846
215 Ga0395901_0094932 3300038443 Unclassified 3125
216 Ga0436365_0247609 3300039437 Unclassified 1382
217 Ga0436365_0992137 3300039437 Bacteria 1485
218 Ga0436365_1549168 3300039437 Bacteria 1300
219 Ga0436363_1498028 3300039450 Bacteria 735
220 Ga0451802_0409144 3300041460 Unclassified 515
221 Ga0451847_0925601 3300041503 Archaea 731
222 Ga0451853_3692732 3300041512 Bacteria 521
223 Ga0439437_001447 3300042000 Bacteria 2499
224 Ga0439441_000764 3300042001 Bacteria 3779
225 Ga0439454_053094 3300042011 Unclassified 689
226 Ga0439463_076890 3300042016 Bacteria 857
227 Ga0450920_003956 3300042122 Bacteria 2587
228 Ga0450890_052658 3300042127 Bacteria 624
229 Ga0450891_039028 3300042129 Unclassified 507
230 Ga0439459_0047991 3300042438 Bacteria 929
231 Ga0495627_133030 3300046453 Unclassified 699
232 Ga0495603_0035721 3300046455 Bacteria 2985
233 Ga0495629_0011476 3300046459 Bacteria 6436
234 Ga0495629_0439723 3300046459 Bacteria 884
235 Ga0495629_0833526 3300046459 Bacteria 607
236 Ga0495641_0033688 3300046461 Bacteria 2429
237 Ga0495641_0161532 3300046461 Bacteria 1002
238 Ga0495641_0390885 3300046461 Bacteria 631
239 Ga0495653_0591890 3300046463 Bacteria 683
240 Ga0495582_0113204 3300046473 Unclassified 1525
241 Ga0495605_0025465 3300046474 Bacteria 3083
242 Ga0495639_0038872 3300046475 Bacteria 2138
243 Ga0495664_0123398 3300046477 Unclassified 1567
244 Ga0495664_0291701 3300046477 Bacteria 985
245 Ga0495664_0682341 3300046477 Bacteria 608
246 Ga0495584_0071174 3300046491 Bacteria 1748
247 Ga0495594_0647505 3300046499 Unclassified 598
248 Ga0495608_0289526 3300046511 Unclassified 1015
249 Ga0495618_0824205 3300046514 Bacteria 539
250 Ga0495628_0220173 3300046516 Bacteria 1426
251 Ga0495628_0490396 3300046516 Unclassified 888
252 Ga0495630_0293281 3300046517 Bacteria 1243
253 Ga0495630_0542495 3300046517 Unclassified 892
254 Ga0495630_0685522 3300046517 Bacteria 784
255 Ga0495637_0207416 3300046520 Unclassified 718
256 Ga0495663_0351283 3300046525 Archaea 537
257 Ga0495666_0214877 3300046526 Bacteria 882
258 Ga0495642_0016043 3300046528 Bacteria 2916
259 Ga0495642_0130011 3300046528 Bacteria 1084
260 Ga0495652_0409030 3300046529 Bacteria 959
261 Ga0495640_0089424 3300046533 Unclassified 2034
262 Ga0495640_0320233 3300046533 Bacteria 961
263 Ga0495609_0088877 3300046538 Bacteria 1345
264 Ga0495609_0161871 3300046538 Bacteria 948
265 Ga0495645_0229371 3300046543 Unclassified 1245
266 Ga0495622_0392988 3300046557 Unclassified 598
267 Ga0495656_0299422 3300046615 Bacteria 824
268 Ga0495634_0037391 3300046642 Bacteria 3316
269 Ga0495634_0330667 3300046642 Bacteria 916
270 Ga0495635_0818828 3300046663 Bacteria 599
271 Ga0495659_0282051 3300046664 Bacteria 698
272 Ga0495647_0056207 3300046681 Bacteria 1542
273 Ga0495613_0023360 3300046689 Bacteria 4606
274 Ga0495671_0216059 3300046692 Bacteria 929
275 Ga0495589_0072314 3300046794 Bacteria 1684
276 Ga0495604_0162841 3300047317 Unclassified 1575
277 Ga0495636_0186635 3300047318 Bacteria 943
278 Ga0495636_0419699 3300047318 Bacteria 639
279 Ga0495674_0619998 3300047319 Bacteria 855
280 Ga0495676_0028762 3300047321 Bacteria 4742
281 Ga0495680_0985060 3300047322 Bacteria 539
282 Ga0495677_0155970 3300047445 Bacteria 880
283 Ga0495685_058404 3300047447 Bacteria 1302
284 Ga0495684_0382166 3300047471 Unclassified 993
285 Ga0495684_0514616 3300047471 Unclassified 821
286 Ga0495684_0729529 3300047471 Bacteria 654
287 Ga0495602_0126372 3300048088 Bacteria 2048
288 Ga0495615_0122174 3300048090 Unclassified 754
289 Ga0496100_0362183 3300048903 Bacteria 1097
290 Ga0496101_0246065 3300048904 Bacteria 1392
291 Ga0496101_0476822 3300048904 Bacteria 985
292 Ga0496102_0840072 3300048905 Bacteria 841
293 Ga0496102_0898822 3300048905 Unclassified 807
294 Ga0496104_0046768 3300048907 Bacteria 4076
295 Ga0496104_1485242 3300048907 Unclassified 581
296 Ga0496105_0008995 3300048908 Bacteria 7790
297 Ga0496108_0025187 3300048911 Bacteria 4902
298 Ga0496108_0308492 3300048911 Unclassified 1379
299 Ga0496109_0042240 3300048912 Bacteria 4129
300 Ga0496109_0118004 3300048912 Bacteria 2470
301 Ga0496109_0591893 3300048912 Unclassified 1045
302 Ga0496110_0119303 3300048913 Bacteria 2376
303 Ga0496110_0254788 3300048913 Bacteria 1597
304 Ga0496110_0630254 3300048913 Bacteria 971
305 Ga0496110_0785567 3300048913 Unclassified 856
306 Ga0496111_0009875 3300048914 Bacteria 6378
307 Ga0496111_0333102 3300048914 Bacteria 1124
308 Ga0496111_1265075 3300048914 Bacteria 521
309 Ga0496111_1278838 3300048914 Unclassified 517
310 Ga0496112_0342287 3300048915 Bacteria 1439
311 Ga0496112_1447368 3300048915 Unclassified 601
312 Ga0496113_0075598 3300048916 Bacteria 2571
313 Ga0496114_0071672 3300048917 Bacteria 2912
314 Ga0496114_0432418 3300048917 Bacteria 1166
315 Ga0496114_1557503 3300048917 Unclassified 549
316 Ga0496115_0947357 3300048918 Bacteria 661
317 Ga0496126_0333517 3300048929 Bacteria 1244
318 Ga0501034_1517793 3300049571 Unclassified 544
319 Ga0501067_0004883 3300049583 Bacteria 7447
320 Ga0501067_0225474 3300049583 Bacteria 1043
321 Ga0501069_0179817 3300049585 Bacteria 1222
322 Ga0501079_1107412 3300049741 Bacteria 624
323 nmdc:mga08y16_1546859_c1 3300050511 Bacteria 622
324 nmdc:mga0n895_1968413_c1 3300050512 Bacteria 543
325 nmdc:mga0n895_63461_c1 3300050512 Bacteria 3653
326 nmdc:mga08x19_168046_c1 3300050514 Bacteria 1492
327 nmdc:mga08x19_289024_c1 3300050514 Bacteria 1137
328 nmdc:mga0a205_28893_c1 3300050515 Bacteria 3990
329 Ga0495601_0464298 3300053077 Unclassified 818
330 Ga0495601_0503180 3300053077 Bacteria 782
331 Ga0495601_0634842 3300053077 Unclassified 684
332 Ga0495612_0193458 3300053078 Unclassified 896
333 Ga0495595_0256305 3300053084 Unclassified 876
334 Ga0495619_0270366 3300053085 Bacteria 1178
335 Ga0495619_0405586 3300053085 Unclassified 941
336 Ga0500566_0153909 3300053094 Bacteria 1206
337 Ga0530510_0012157 3300061734 Bacteria 6042
338 Ga0307413_10174936
339 JGI24742J22300_10043235
340 JGI24751J29686_10127024
341 Ga0070658_10228373
342 Ga0070676_10265577
343 Ga0070683_100350688
344 Ga0070683_100874630
345 Ga0070683_100995757
346 Ga0070670_100593542
347 Ga0070670_100779040
348 Ga0070670_102258774
349 Ga0070680_101706205
350 Ga0070682_101681862
351 Ga0070660_100013342
352 Ga0070660_100581478
353 Ga0070691_10883428
354 Ga0070661_100272298
355 Ga0070661_100372110
356 Ga0070661_100519598
357 Ga0070668_100733069
358 Ga0070668_101114723
359 Ga0070675_100044841
360 Ga0070671_100583807
361 Ga0070671_100614768
362 Ga0070674_100094517
363 Ga0070674_100228556
364 Ga0070673_100281374
365 Ga0070688_100375594
366 Ga0070688_101595382
367 Ga0070688_101794076
368 Ga0070659_100976650
369 Ga0070709_10480237
370 Ga0070701_10859286
371 Ga0070701_11327720
372 Ga0070711_100679520
373 Ga0070700_100023492
374 Ga0070700_100155249
375 Ga0070708_100014260
376 Ga0070708_100569034
377 Ga0070663_100930750
378 Ga0070663_101436312
379 Ga0070681_10164283
380 Ga0068867_100184736
381 Ga0068867_100268791
382 Ga0068867_100584497
383 Ga0070706_100007763
384 Ga0070707_100002425
385 Ga0070707_100854773
386 Ga0070707_101354977
387 Ga0070698_100108958
388 Ga0070698_100490909
389 Ga0070699_100001544
390 Ga0070699_100025473
391 Ga0070699_100069896
392 Ga0070699_100207867
393 Ga0070679_102124180
394 Ga0070684_100190193
395 Ga0070684_100459753
396 Ga0070697_100202283
397 Ga0070686_100095464
398 Ga0070686_101171583
399 Ga0070693_100925654
400 Ga0070665_101491519
401 Ga0070665_101655197
402 Ga0070704_100726573
403 Ga0070704_100972735
404 Ga0068855_100233940
405 Ga0070664_100313967
406 Ga0068857_101333849
407 Ga0068856_100018046
408 Ga0070702_100079596
409 Ga0068852_101511627
410 Ga0068864_100366998
411 Ga0068866_10401745
412 Ga0068866_11066767
413 Ga0068861_100433868
414 Ga0068870_10119898
415 Ga0068858_100895864
416 Ga0068860_101191438
417 Ga0070712_100846243
418 Ga0075433_10068140
419 Ga0075434_100033664
420 Ga0068865_100167010
421 Ga0075436_100159504
422 Ga0075436_100310699
423 Ga0075435_100114607
424 Ga0099794_10581334
425 Ga0105244_10358232
426 Ga0105245_10267305
427 Ga0105245_10670400
428 Ga0105245_10926564
429 Ga0105245_11350228
430 Ga0105243_10364323
431 Ga0105243_11038004
432 Ga0105243_11063451
433 Ga0105243_11067983
434 Ga0105241_12470033
435 Ga0105242_10320356
436 Ga0105242_11590728
437 Ga0105242_11838119
438 Ga0105248_11177268
439 Ga0105248_12713357
440 Ga0105238_11924445
441 Ga0105249_11648059
442 Ga0105246_11055799
443 Ga0105246_11564577
444 Ga0105246_12367552
445 Ga0157373_10095117
446 Ga0157374_10234732
447 Ga0157378_10350854
448 Ga0163162_12024022
449 Ga0157372_10522996
450 Ga0157375_10418528
451 Ga0157375_11539627
452 Ga0157375_12316192
453 Ga0157375_13214272
454 Ga0163163_10242744
455 Ga0163163_10296656
456 Ga0157380_11110749
457 Ga0157380_12012105
458 Ga0157380_12412870
459 Ga0157380_12632237
460 Ga0157380_12919350
461 Ga0157377_10103744
462 Ga0157376_11293251
463 Ga0157376_11314812
464 Ga0213876_10472540
465 Ga0207642_10131593
466 Ga0207642_11034767
467 Ga0207688_10146948
468 Ga0207688_10763277
469 Ga0207688_10813561
470 Ga0207699_10394148
471 Ga0207643_10494445
472 Ga0207705_10462212
473 Ga0207705_10515530
474 Ga0207684_10037062
475 Ga0207684_10776713
476 Ga0207662_10231786
477 Ga0207657_10027418
478 Ga0207657_11340506
479 Ga0207652_10486666
480 Ga0207646_10002167
481 Ga0207646_11083188
482 Ga0207681_11198935
483 Ga0207659_10086819
484 Ga0207659_10196548
485 Ga0207687_10252634
486 Ga0207687_10330885
487 Ga0207687_10758013
488 Ga0207687_11137444
489 Ga0207644_11178062
490 Ga0207644_11484712
491 Ga0207690_10430265
492 Ga0207706_10376297
493 Ga0207686_10403336
494 Ga0207686_10449846
495 Ga0207709_10438799
496 Ga0207669_10119672
497 Ga0207669_10174690
498 Ga0207669_10181417
499 Ga0207669_10440594
500 Ga0207669_11075800
501 Ga0207704_10163119
502 Ga0207665_10449530
503 Ga0207661_10271652
504 Ga0207661_10373635
505 Ga0207661_11523162
506 Ga0207679_10280535
507 Ga0207679_10992494
508 Ga0207667_10841507
509 Ga0207712_11563471
510 Ga0207677_11014462
511 Ga0207677_11261292
512 Ga0207677_11865449
513 Ga0207703_10626790
514 Ga0207702_10285731
515 Ga0207648_10437930
516 Ga0207648_10525372
517 Ga0207648_11792609
518 Ga0207676_10138166
519 Ga0207674_10398570
520 Ga0207674_12202107
521 Ga0207698_12327666
522 Ga0268264_10137018
523 Ga0265319_1006869
524 Ga0265319_1080799
525 Ga0265334_10012186
526 Ga0265318_10003613
527 Ga0265322_10090858
528 Ga0265338_10006609
529 Ga0265338_10374858
530 Ga0265330_10073240
531 Ga0265320_10213317
532 Ga0265329_10016654
533 Ga0265339_10080891
534 Ga0265327_10202226
535 Ga0265327_10280143
536 Ga0265316_10097569
537 Ga0265314_10260100
538 Ga0307405_10743021
539 Ga0307413_10524579
540 Ga0307410_10736137
541 Ga0307410_10952642
542 Ga0307412_10535442
543 Ga0307416_100426535
544 Ga0307416_100440988
545 Ga0307416_100480082
546 Ga0307415_100688012
547 Ga0373943_0537658
548 Ga0373947_0020494
549 Ga0373925_1128442
550 Ga0395898_0340319
551 Ga0436364_0664838
552 Ga0395901_0094932
553 Ga0436365_0247609
554 Ga0436365_0992137
555 Ga0436365_1549168
556 Ga0436363_1498028
557 Ga0451802_0409144
558 Ga0451847_0925601
559 Ga0451853_3692732
560 Ga0439437_001447
561 Ga0439441_000764
562 Ga0439454_053094
563 Ga0439463_076890
564 Ga0450920_003956
565 Ga0450890_052658
566 Ga0450891_039028
567 Ga0439459_0047991
568 Ga0495627_133030
569 Ga0495603_0035721
570 Ga0495629_0011476
571 Ga0495629_0439723
572 Ga0495629_0833526
573 Ga0495641_0033688
574 Ga0495641_0161532
575 Ga0495641_0390885
576 Ga0495653_0591890
577 Ga0495582_0113204
578 Ga0495605_0025465
579 Ga0495639_0038872
580 Ga0495664_0123398
581 Ga0495664_0291701
582 Ga0495664_0682341
583 Ga0495584_0071174
584 Ga0495594_0647505
585 Ga0495608_0289526
586 Ga0495618_0824205
587 Ga0495628_0220173
588 Ga0495628_0490396
589 Ga0495630_0293281
590 Ga0495630_0542495
591 Ga0495630_0685522
592 Ga0495637_0207416
593 Ga0495663_0351283
594 Ga0495666_0214877
595 Ga0495642_0016043
596 Ga0495642_0130011
597 Ga0495652_0409030
598 Ga0495640_0089424
599 Ga0495640_0320233
600 Ga0495609_0088877
601 Ga0495609_0161871
602 Ga0495645_0229371
603 Ga0495622_0392988
604 Ga0495656_0299422
605 Ga0495634_0037391
606 Ga0495634_0330667
607 Ga0495635_0818828
608 Ga0495659_0282051
609 Ga0495647_0056207
610 Ga0495613_0023360
611 Ga0495671_0216059
612 Ga0495589_0072314
613 Ga0495604_0162841
614 Ga0495636_0186635
615 Ga0495636_0419699
616 Ga0495674_0619998
617 Ga0495676_0028762
618 Ga0495680_0985060
619 Ga0495677_0155970
620 Ga0495685_058404
621 Ga0495684_0382166
622 Ga0495684_0514616
623 Ga0495684_0729529
624 Ga0495602_0126372
625 Ga0495615_0122174
626 Ga0496100_0362183
627 Ga0496101_0246065
628 Ga0496101_0476822
629 Ga0496102_0840072
630 Ga0496102_0898822
631 Ga0496104_0046768
632 Ga0496104_1485242
633 Ga0496105_0008995
634 Ga0496108_0025187
635 Ga0496108_0308492
636 Ga0496109_0042240
637 Ga0496109_0118004
638 Ga0496109_0591893
639 Ga0496110_0119303
640 Ga0496110_0254788
641 Ga0496110_0630254
642 Ga0496110_0785567
643 Ga0496111_0009875
644 Ga0496111_0333102
645 Ga0496111_1265075
646 Ga0496111_1278838
647 Ga0496112_0342287
648 Ga0496112_1447368
649 Ga0496113_0075598
650 Ga0496114_0071672
651 Ga0496114_0432418
652 Ga0496114_1557503
653 Ga0496115_0947357
654 Ga0496126_0333517
655 Ga0501034_1517793
656 Ga0501067_0004883
657 Ga0501067_0225474
658 Ga0501069_0179817
659 Ga0501079_1107412
660 nmdc:mga08y16_1546859_c1
661 nmdc:mga0n895_1968413_c1
662 nmdc:mga0n895_63461_c1
663 nmdc:mga08x19_168046_c1
664 nmdc:mga08x19_289024_c1
665 nmdc:mga0a205_28893_c1
666 Ga0495601_0464298
667 Ga0495601_0503180
668 Ga0495601_0634842
669 Ga0495612_0193458
670 Ga0495595_0256305
671 Ga0495619_0270366
672 Ga0495619_0405586
673 Ga0500566_0153909
674 Ga0530510_0012157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

9

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bde-assembly1.cif.gz_A crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution 0.9727 5 100
5b0f-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y72f mutant 0.8778 6 100
5xzq-assembly2.cif.gz_D hydroxynitrile lyase from passiflora edulis (pehnl) 0.8731 3 100
5b0g-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa, h78s mutant 0.8707 6 100
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.8647 6 100
ID Description Score Start End Superfamily
3bdeB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9633 6 100 3.30.70.100
3bdeB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9343 6 100 3.30.70.100
af_C0HHH9_33_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8863 2 99 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8695 4 100 3.30.70.100
af_C0HHH9_33_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.862 2 99 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y1Y5K8-F1-model_v4 Dabb family protein 0.9945 7 100
AF-A0A442ULQ5-F1-model_v4 Dabb family protein 0.9939 6 98
AF-V4Q611-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9937 6 98
AF-A0A660LGV5-F1-model_v4 Stress responsive alpha/beta barrel protein 0.9936 4 100
AF-A0A1H7K424-F1-model_v4 Stress responsive A/B Barrel Domain 0.9932 6 100

Map