F413018

General Info

Members Datasets Scaffolds Average Seq Length
337 234 288 466

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10051323|Ga0081539_100513231
Length 514
Sequence VVIHPSEDMPHRVEHAVDGTPAAADLKEAIIVSTPTGRGAMLPTFAITSLALMMVTLDNLVVTTALPAIKAGLGASLESLEWTVNAYTLTFAVLLLPGAALGDRFGRRRVFVAGMIIFTAASAPTVTALNAARAIQGLGGAIVTPLTLTLLSAAFPAQRRGLALGAWGAVGGLAVALGPVVGGAVTQGISWQWIFWLNVPIGLLLIPLAGRLLQESRGPNSGLDVLGLALVSSGLFGIVWGLVRGNTSGWTSPEIISLLTAGAALIPAFVIWEIHTPRPMLPMRFFRSRAFTQTNIASLFMFFGMFGSIFLLAQFFQIVQHYSPLAAGLRILPWTAMPILVAPIAGVMSDKIPGHWIIGVGLALQAIGLGWIVAVSTPTVPYTSLVAPFVVSGVGMGLFFAPVANVILATVHPIEEGQASGANNAIRELGGVLGVAVLASIFAHAGGYTTTRTFSDGLNTAVAVGAAVVALGALSALTVPRTRTRTMAMPVVPIDQATSLGEPISATSSTAPLT

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
11 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
12 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
13 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
14 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
15 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
16 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
17 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
18 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
19 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
20 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
21 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
22 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
23 2862574272 Streptomyces sp. AcE210 Isolate Nodule
24 2867428634 Streptomyces sp. RP5T Isolate Unclassified
25 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
26 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
27 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
28 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
29 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
30 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
31 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
32 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
33 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
34 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
35 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
36 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
37 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
38 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
39 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
40 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
41 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
42 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
43 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
44 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
45 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
226 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
227 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
228 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
232 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
233 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
234 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.16
Metatranscriptomes 0.3
Isolates 14.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.26
Nodule 0.3
Rhizoplane 2.37
Rhizosphere 79.23
Stem 0
Stem Tuber 0
Unclassified 14.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10011801 3300001990 Bacteria 2857
2 Ga0006562J51391_1102892 3300003578 Bacteria 3192
3 Ga0070668_100039122 3300005347 Bacteria 3627
4 Ga0070714_100142438 3300005435 Bacteria 2153
5 Ga0070711_100015423 3300005439 Bacteria 4836
6 Ga0068853_100017710 3300005539 Bacteria 5879
7 Ga0068855_100032391 3300005563 Bacteria 6242
8 Ga0068863_100041587 3300005841 Bacteria 4371
9 Ga0081455_10015509 3300005937 Bacteria 7397
10 Ga0081539_10051323 3300005985 Bacteria 2325
11 Ga0070717_10181600 3300006028 Bacteria 1834
12 Ga0075365_10145842 3300006038 Bacteria 1645
13 Ga0075368_10049508 3300006042 Bacteria 1667
14 Ga0075367_10008260 3300006178 Bacteria 5386
15 Ga0075434_100017026 3300006871 Bacteria 6994
16 Ga0075435_100016390 3300007076 Bacteria 5587
17 Ga0105251_10010014 3300009011 Bacteria 5542
18 Ga0105250_10032179 3300009092 Bacteria 2107
19 Ga0111539_10003325 3300009094 Bacteria 21233
20 Ga0111539_10006499 3300009094 Bacteria 15060
21 Ga0105246_10022892 3300011119 Bacteria 4037
22 Ga0157370_10015556 3300013104 Bacteria 7734
23 Ga0182008_10004686 3300014497 Bacteria 7940
24 Ga0157379_10017991 3300014968 Bacteria 6229
25 Ga0182006_1036680 3300015261 Bacteria 1948
26 Ga0182007_10034015 3300015262 Bacteria 1724
27 Ga0182005_1016771 3300015265 Bacteria 2032
28 Ga0207647_10038821 3300025904 Bacteria 3008
29 Ga0207700_10014113 3300025928 Bacteria 5224
30 Ga0207664_10088453 3300025929 Bacteria 2534
31 Ga0207664_10109139 3300025929 Bacteria 2298
32 Ga0207641_10013629 3300026088 Bacteria 6668
33 Ga0207674_10052702 3300026116 Bacteria 4148
34 Ga0209813_10026864 3300027866 Bacteria 1667
35 Ga0207428_10024588 3300027907 Bacteria 5057
36 Ga0268266_10091973 3300028379 Bacteria 2661
37 Ga0307517_10002248 3300028786 Bacteria 31157
38 Ga0307517_10084316 3300028786 Bacteria 2675
39 Ga0307515_10001897 3300028794 Bacteria 46523
40 Ga0307515_10101954 3300028794 Bacteria 3458
41 Ga0307511_10006642 3300030521 Bacteria 11663
42 Ga0307512_10011226 3300030522 Bacteria 8499
43 Ga0307513_10014815 3300031456 Bacteria 9485
44 Ga0307513_10091820 3300031456 Bacteria 3092
45 Ga0307513_10105129 3300031456 Bacteria 2834
46 Ga0307509_10018160 3300031507 Bacteria 8070
47 Ga0307509_10088336 3300031507 Bacteria 3182
48 Ga0307508_10043112 3300031616 Bacteria 4043
49 Ga0307508_10067386 3300031616 Bacteria 3148
50 Ga0307514_10003307 3300031649 Bacteria 15641
51 Ga0307516_10012550 3300031730 Bacteria 9120
52 Ga0307516_10019067 3300031730 Bacteria 7115
53 Ga0307507_10009069 3300033179 Bacteria 13406
54 Ga0307507_10025134 3300033179 Bacteria 6467
55 Ga0307510_10018408 3300033180 Bacteria 8220
56 Ga0307510_10095605 3300033180 Bacteria 2790
57 Ga0307510_10105865 3300033180 Bacteria 2579
58 Ga0373926_0024493 3300035083 Bacteria 2102
59 Ga0373934_0000007 3300035086 Bacteria 74186
60 Ga0373953_0000069 3300035117 Bacteria 25378
61 Ga0373956_0000481 3300035119 Bacteria 16393
62 Ga0373957_0000139 3300035120 Bacteria 18107
63 Ga0373955_0000062 3300035172 Bacteria 42579
64 Ga0373924_0002870 3300035410 Bacteria 5840
65 Ga0373933_0000021 3300035724 Bacteria 96820
66 Ga0373947_0041535 3300035725 Bacteria 2742
67 Ga0373937_0000032 3300036401 Bacteria 120148
68 Ga0395898_0093581 3300037466 Bacteria 2888
69 Ga0395901_0262017 3300038443 Bacteria 1799
70 Ga0439436_0000987 3300041404 Bacteria 7903
71 Ga0439436_0004595 3300041404 Bacteria 4232
72 Ga0439448_0014013 3300042005 Bacteria 2415
73 Ga0439449_0016529 3300042007 Bacteria 2772
74 Ga0439457_000226 3300042014 Bacteria 15042
75 Ga0439457_009583 3300042014 Bacteria 2250
76 Ga0450903_001178 3300042138 Bacteria 4934
77 Ga0439458_0002293 3300042157 Bacteria 4696
78 Ga0466972_0071754 3300044658 Bacteria 1651
79 Ga0466963_0006510 3300044694 Bacteria 6915
80 Ga0466968_0018452 3300044735 Bacteria 2798
81 Ga0466970_0092891 3300044765 Bacteria 1639
82 Ga0466957_0047187 3300044842 Bacteria 2617
83 Ga0466967_0046949 3300045976 Bacteria 3763
84 Ga0466967_0169534 3300045976 Bacteria 2053
85 Ga0495627_017351 3300046453 Bacteria 2448
86 Ga0495592_0000143 3300046454 Bacteria 63228
87 Ga0495592_0034240 3300046454 Bacteria 3829
88 Ga0495603_0026568 3300046455 Bacteria 3496
89 Ga0495603_0027598 3300046455 Bacteria 3425
90 Ga0495629_0005008 3300046459 Bacteria 9933
91 Ga0495629_0008159 3300046459 Bacteria 7702
92 Ga0495629_0038088 3300046459 Bacteria 3388
93 Ga0495629_0070348 3300046459 Bacteria 2441
94 Ga0495651_0000010 3300046462 Bacteria 148763
95 Ga0495651_0001402 3300046462 Bacteria 18685
96 Ga0495651_0011850 3300046462 Bacteria 6704
97 Ga0495653_0013162 3300046463 Bacteria 6745
98 Ga0495653_0056217 3300046463 Bacteria 3000
99 Ga0495580_0022814 3300046472 Bacteria 4601
100 Ga0495580_0058626 3300046472 Bacteria 2707
101 Ga0495662_0000039 3300046476 Bacteria 43770
102 Ga0495662_0016973 3300046476 Bacteria 3523
103 Ga0495664_0001560 3300046477 Bacteria 12137
104 Ga0495664_0005989 3300046477 Bacteria 6702
105 Ga0495584_0080795 3300046491 Bacteria 1636
106 Ga0495585_0006093 3300046492 Bacteria 7534
107 Ga0495594_0002244 3300046499 Bacteria 10060
108 Ga0495596_0017056 3300046500 Bacteria 3012
109 Ga0495606_0025713 3300046507 Bacteria 4209
110 Ga0495608_0000037 3300046511 Bacteria 125064
111 Ga0495608_0004844 3300046511 Bacteria 9620
112 Ga0495608_0130270 3300046511 Bacteria 1610
113 Ga0495616_0054038 3300046513 Bacteria 1994
114 Ga0495628_0001124 3300046516 Bacteria 24422
115 Ga0495628_0001358 3300046516 Bacteria 22407
116 Ga0495628_0004286 3300046516 Bacteria 12689
117 Ga0495628_0021408 3300046516 Bacteria 5319
118 Ga0495630_0019283 3300046517 Bacteria 5013
119 Ga0495630_0035887 3300046517 Bacteria 3705
120 Ga0495630_0073330 3300046517 Bacteria 2578
121 Ga0495637_0047465 3300046520 Bacteria 1812
122 Ga0495643_0027521 3300046522 Bacteria 3193
123 Ga0495643_0043330 3300046522 Bacteria 2449
124 Ga0495666_0007506 3300046526 Bacteria 5456
125 Ga0495652_0000135 3300046529 Bacteria 82725
126 Ga0495652_0009670 3300046529 Bacteria 8753
127 Ga0495652_0043793 3300046529 Bacteria 3855
128 Ga0495665_0014064 3300046531 Bacteria 4321
129 Ga0495640_0020598 3300046533 Bacteria 4851
130 Ga0495640_0071290 3300046533 Bacteria 2332
131 Ga0495586_0007014 3300046535 Bacteria 6006
132 Ga0495587_0000024 3300046536 Bacteria 148753
133 Ga0495645_0004582 3300046543 Bacteria 9435
134 Ga0495645_0015603 3300046543 Bacteria 5404
135 Ga0495622_0017272 3300046557 Bacteria 3359
136 Ga0495633_0021828 3300046558 Bacteria 3196
137 Ga0495667_0000024 3300046559 Bacteria 168313
138 Ga0495667_0004962 3300046559 Bacteria 8999
139 Ga0495667_0175021 3300046559 Bacteria 1378
140 Ga0495634_0001063 3300046642 Bacteria 25743
141 Ga0495634_0036252 3300046642 Bacteria 3373
142 Ga0495625_0010562 3300046660 Bacteria 7626
143 Ga0495635_0004318 3300046663 Bacteria 9841
144 Ga0495635_0008663 3300046663 Bacteria 7103
145 Ga0495661_0070572 3300046665 Bacteria 2044
146 Ga0495657_0000057 3300046675 Bacteria 98920
147 Ga0495657_0001831 3300046675 Bacteria 18169
148 Ga0495657_0065026 3300046675 Bacteria 2399
149 Ga0495599_0006972 3300046678 Bacteria 6834
150 Ga0495623_0000812 3300046679 Bacteria 21041
151 Ga0495646_0000605 3300046680 Bacteria 19528
152 Ga0495646_0008785 3300046680 Bacteria 6416
153 Ga0495646_0014711 3300046680 Bacteria 4973
154 Ga0495658_0010152 3300046683 Bacteria 4705
155 Ga0495613_0004137 3300046689 Bacteria 10861
156 Ga0495613_0006485 3300046689 Bacteria 8743
157 Ga0495613_0007081 3300046689 Bacteria 8349
158 Ga0495613_0037030 3300046689 Bacteria 3617
159 Ga0495671_0003890 3300046692 Bacteria 9068
160 Ga0495649_0092762 3300046694 Bacteria 1608
161 Ga0495589_0007062 3300046794 Bacteria 5887
162 Ga0495600_0035192 3300046809 Bacteria 3251
163 Ga0495600_0080599 3300046809 Bacteria 2125
164 Ga0495660_0042299 3300046810 Bacteria 2518
165 Ga0495581_0051020 3300047315 Bacteria 2389
166 Ga0495581_0057153 3300047315 Bacteria 2252
167 Ga0495581_0106904 3300047315 Bacteria 1626
168 Ga0495604_0000024 3300047317 Bacteria 148542
169 Ga0495604_0000692 3300047317 Bacteria 28601
170 Ga0495604_0001340 3300047317 Bacteria 20143
171 Ga0495604_0095807 3300047317 Bacteria 2191
172 Ga0495636_0054437 3300047318 Bacteria 1681
173 Ga0495674_0002503 3300047319 Bacteria 17909
174 Ga0495674_0005859 3300047319 Bacteria 11787
175 Ga0495674_0097051 3300047319 Bacteria 2511
176 Ga0495676_0002369 3300047321 Bacteria 16718
177 Ga0495676_0010050 3300047321 Bacteria 8593
178 Ga0495676_0011550 3300047321 Bacteria 7966
179 Ga0495676_0016511 3300047321 Bacteria 6548
180 Ga0495676_0214039 3300047321 Bacteria 1332
181 Ga0495680_0000005 3300047322 Bacteria 168308
182 Ga0495680_0017516 3300047322 Bacteria 6113
183 Ga0495687_002749 3300047443 Bacteria 13636
184 Ga0495687_053723 3300047443 Bacteria 1695
185 Ga0495675_0000908 3300047444 Bacteria 18056
186 Ga0495675_0005789 3300047444 Bacteria 7554
187 Ga0495675_0068262 3300047444 Bacteria 2246
188 Ga0495685_000833 3300047447 Bacteria 9405
189 Ga0495681_0001709 3300047470 Bacteria 16261
190 Ga0495681_0032680 3300047470 Bacteria 2616
191 Ga0495684_0017701 3300047471 Bacteria 5487
192 Ga0495684_0031840 3300047471 Bacteria 4051
193 Ga0495686_0082236 3300047472 Bacteria 1966
194 Ga0495593_0009694 3300047673 Bacteria 5587
195 Ga0495593_0049606 3300047673 Bacteria 2226
196 Ga0495602_0000203 3300048088 Bacteria 55275
197 Ga0495614_0000846 3300048089 Bacteria 12951
198 Ga0495614_0000938 3300048089 Bacteria 12410
199 Ga0496100_0000961 3300048903 Bacteria 13801
200 Ga0496101_0010205 3300048904 Bacteria 6198
201 Ga0496102_0000275 3300048905 Bacteria 65564
202 Ga0496103_0000138 3300048906 Bacteria 76227
203 Ga0496104_0014055 3300048907 Bacteria 7226
204 Ga0496105_0138004 3300048908 Bacteria 2008
205 Ga0496110_0145574 3300048913 Bacteria 2143
206 Ga0496114_0118288 3300048917 Bacteria 2277
207 Ga0496116_0000855 3300048919 Bacteria 38098
208 Ga0496117_0000488 3300048920 Bacteria 65578
209 Ga0496118_0000235 3300048921 Bacteria 97453
210 Ga0496119_0000148 3300048922 Bacteria 98160
211 Ga0496120_0010779 3300048923 Bacteria 6334
212 Ga0496121_0048694 3300048924 Bacteria 3603
213 Ga0496124_0010676 3300048927 Bacteria 9268
214 Ga0496126_0000635 3300048929 Bacteria 65555
215 Ga0501031_0002042 3300049568 Bacteria 12701
216 Ga0501031_0028310 3300049568 Bacteria 3652
217 Ga0501032_0006325 3300049569 Bacteria 8727
218 Ga0501032_0051453 3300049569 Bacteria 2777
219 Ga0501032_0158869 3300049569 Bacteria 1484
220 Ga0501033_0007289 3300049570 Bacteria 8627
221 Ga0501033_0052459 3300049570 Bacteria 3022
222 Ga0501033_0107172 3300049570 Bacteria 2035
223 Ga0501034_0036990 3300049571 Bacteria 4942
224 Ga0501034_0043503 3300049571 Bacteria 4545
225 Ga0501034_0106412 3300049571 Bacteria 2798
226 Ga0501036_0032644 3300049572 Bacteria 4400
227 Ga0501036_0036883 3300049572 Bacteria 4136
228 Ga0501036_0040119 3300049572 Bacteria 3960
229 Ga0501036_0046384 3300049572 Bacteria 3680
230 Ga0501037_0067344 3300049573 Bacteria 2607
231 Ga0501037_0082137 3300049573 Bacteria 2335
232 Ga0501038_0011284 3300049574 Bacteria 8158
233 Ga0501038_0030638 3300049574 Bacteria 4757
234 Ga0501038_0083866 3300049574 Bacteria 2682
235 Ga0501039_0007779 3300049575 Bacteria 8175
236 Ga0501039_0032955 3300049575 Bacteria 3997
237 Ga0501039_0034429 3300049575 Bacteria 3908
238 Ga0501040_0122464 3300049576 Bacteria 1825
239 Ga0501041_0022923 3300049577 Bacteria 3741
240 Ga0501043_0007469 3300049579 Bacteria 8679
241 Ga0501043_0011949 3300049579 Bacteria 6793
242 Ga0501043_0014218 3300049579 Bacteria 6228
243 Ga0501043_0105635 3300049579 Bacteria 2212
244 Ga0501046_0015524 3300049580 Bacteria 6397
245 Ga0501046_0021332 3300049580 Bacteria 5345
246 Ga0501047_0000582 3300049581 Bacteria 38847
247 Ga0501047_0013451 3300049581 Bacteria 7758
248 Ga0501047_0036302 3300049581 Bacteria 4763
249 Ga0501047_0055647 3300049581 Bacteria 3825
250 Ga0501047_0057951 3300049581 Bacteria 3743
251 Ga0501047_0115940 3300049581 Bacteria 2560
252 Ga0501047_0271945 3300049581 Bacteria 1540
253 Ga0501048_0012919 3300049582 Bacteria 6202
254 Ga0501067_0005472 3300049583 Bacteria 7045
255 Ga0501068_0022849 3300049584 Bacteria 3661
256 Ga0501070_0083879 3300049586 Bacteria 2638
257 Ga0501071_0007769 3300049587 Bacteria 7072
258 Ga0501072_0002701 3300049588 Bacteria 13305
259 Ga0501073_0122071 3300049589 Bacteria 1805
260 Ga0501076_0187243 3300049592 Bacteria 1688
261 Ga0501079_0048399 3300049741 Bacteria 3280
262 Ga0501080_0022322 3300049742 Bacteria 5862
263 Ga0501080_0069371 3300049742 Bacteria 3278
264 Ga0501035_0006838 3300049822 Bacteria 10658
265 Ga0501035_0023390 3300049822 Bacteria 5668
266 Ga0501035_0051284 3300049822 Bacteria 3695
267 Ga0501035_0157141 3300049822 Bacteria 1970
268 Ga0501044_0000806 3300049823 Bacteria 37759
269 Ga0501044_0029838 3300049823 Bacteria 5749
270 Ga0501044_0036126 3300049823 Bacteria 5169
271 Ga0501044_0052436 3300049823 Bacteria 4203
272 Ga0501044_0096688 3300049823 Bacteria 2974
273 Ga0501044_0209494 3300049823 Bacteria 1904
274 nmdc:mga06z11_4831_c1 3300050494 Bacteria 5336
275 nmdc:mga04h51_31706_c1 3300050495 Bacteria 1672
276 nmdc:mga08y16_189632_c1 3300050511 Bacteria 2133
277 nmdc:mga0rr50_73088_c1 3300050513 Bacteria 2621
278 nmdc:mga0a205_126062_c1 3300050515 Bacteria 2460
279 Ga0495601_0004280 3300053077 Bacteria 8243
280 Ga0495612_0018709 3300053078 Bacteria 2775
281 Ga0495619_0101036 3300053085 Bacteria 1963
282 Ga0500644_0006676 3300053088 Bacteria 2967
283 Ga0500560_000044 3300053107 Bacteria 12726
284 Ga0500600_0078389 3300053149 Bacteria 1793
285 Ga0500633_0011425 3300053160 Bacteria 2414
286 Ga0500587_004788 3300053739 Bacteria 1848
287 Ga0501084_0004705 3300054114 Bacteria 11147
288 Ga0501082_0011656 3300060353 Bacteria 7558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0214039 Ga0495676_0214039_17_1267 406
2 3300035083 Ga0373926_0024493 Ga0373926_0024493_11_1366 418
3 3300047321 Ga0495676_0002369 Ga0495676_0002369_15353_16708 418
4 3300047673 Ga0495593_0009694 Ga0495593_0009694_11_1366 418
5 3300049575 Ga0501039_0007779 Ga0501039_0007779_6841_8163 418
6 3300047315 Ga0495581_0057153 Ga0495581_0057153_76_1620 419
7 3300044694 Ga0466963_0006510 Ga0466963_0006510_3016_4398 423
8 3300049581 Ga0501047_0036302 Ga0501047_0036302_3265_4725 423
9 3300046491 Ga0495584_0080795 Ga0495584_0080795_182_1576 427
10 3300049570 Ga0501033_0052459 Ga0501033_0052459_258_1634 428
11 3300049572 Ga0501036_0046384 Ga0501036_0046384_1342_2718 428
12 3300049579 Ga0501043_0007469 Ga0501043_0007469_5249_6625 428
13 3300049581 Ga0501047_0115940 Ga0501047_0115940_926_2302 428
14 3300049582 Ga0501048_0012919 Ga0501048_0012919_2123_3499 428
15 3300049823 Ga0501044_0096688 Ga0501044_0096688_659_2035 428
16 3300009094 Ga0111539_10003325 Ga0111539_1000332516 430
17 3300026116 Ga0207674_10052702 Ga0207674_100527023 430
18 3300050511 nmdc:mga08y16_189632_c1 nmdc:mga08y16_189632_c1_149_1567 430
19 3300005937 Ga0081455_10015509 Ga0081455_100155094 431
20 3300046559 Ga0495667_0175021 Ga0495667_0175021_12_1367 431
21 3300049573 Ga0501037_0082137 Ga0501037_0082137_939_2273 431
22 3300049581 Ga0501047_0000582 Ga0501047_0000582_25408_26742 431
23 3300049589 Ga0501073_0122071 Ga0501073_0122071_393_1793 432
24 iso_pu_bacteria 2862290372 2862292144 433
25 3300047319 Ga0495674_0002503 Ga0495674_0002503_4709_6196 434
26 3300053078 Ga0495612_0018709 Ga0495612_0018709_637_2124 434
27 3300044735 Ga0466968_0018452 Ga0466968_0018452_630_2051 436
28 3300048908 Ga0496105_0138004 Ga0496105_0138004_536_1948 436
29 3300035086 Ga0373934_0000007 Ga0373934_0000007_15722_17188 437
30 3300035117 Ga0373953_0000069 Ga0373953_0000069_18881_20347 437
31 3300035119 Ga0373956_0000481 Ga0373956_0000481_6750_8216 437
32 3300035120 Ga0373957_0000139 Ga0373957_0000139_15582_17048 437
33 3300035172 Ga0373955_0000062 Ga0373955_0000062_15744_17210 437
34 3300035410 Ga0373924_0002870 Ga0373924_0002870_4182_5648 437
35 3300035724 Ga0373933_0000021 Ga0373933_0000021_79790_81256 437
36 3300036401 Ga0373937_0000032 Ga0373937_0000032_15792_17258 437
37 3300046454 Ga0495592_0000143 Ga0495592_0000143_45963_47429 437
38 3300046462 Ga0495651_0000010 Ga0495651_0000010_131496_132962 437
39 3300046463 Ga0495653_0056217 Ga0495653_0056217_525_1991 437
40 3300046511 Ga0495608_0000037 Ga0495608_0000037_114094_115560 437
41 3300046516 Ga0495628_0001358 Ga0495628_0001358_15745_17211 437
42 3300046529 Ga0495652_0000135 Ga0495652_0000135_35299_36765 437
43 3300046536 Ga0495587_0000024 Ga0495587_0000024_15791_17257 437
44 3300046559 Ga0495667_0000024 Ga0495667_0000024_35350_36816 437
45 3300046675 Ga0495657_0000057 Ga0495657_0000057_35327_36793 437
46 3300046679 Ga0495623_0000812 Ga0495623_0000812_3830_5296 437
47 3300046680 Ga0495646_0014711 Ga0495646_0014711_557_2023 437
48 3300047317 Ga0495604_0000024 Ga0495604_0000024_15608_17074 437
49 3300047322 Ga0495680_0000005 Ga0495680_0000005_131472_132938 437
50 3300047444 Ga0495675_0000908 Ga0495675_0000908_11984_13450 437
51 3300048088 Ga0495602_0000203 Ga0495602_0000203_18453_19919 437
52 3300005435 Ga0070714_100142438 Ga0070714_1001424382 438
53 3300005439 Ga0070711_100015423 Ga0070711_1000154233 438
54 3300006871 Ga0075434_100017026 Ga0075434_1000170264 438
55 3300007076 Ga0075435_100016390 Ga0075435_1000163905 438
56 3300009011 Ga0105251_10010014 Ga0105251_100100143 438
57 3300009092 Ga0105250_10032179 Ga0105250_100321792 438
58 3300014968 Ga0157379_10017991 Ga0157379_100179915 438
59 3300025928 Ga0207700_10014113 Ga0207700_100141134 438
60 3300025929 Ga0207664_10109139 Ga0207664_101091392 438
61 3300046459 Ga0495629_0070348 Ga0495629_0070348_838_2295 438
62 3300046476 Ga0495662_0016973 Ga0495662_0016973_507_1964 438
63 3300046543 Ga0495645_0015603 Ga0495645_0015603_156_1670 438
64 3300046642 Ga0495634_0036252 Ga0495634_0036252_15_1382 438
65 3300046689 Ga0495613_0007081 Ga0495613_0007081_2092_3519 438
66 3300048903 Ga0496100_0000961 Ga0496100_0000961_10193_11566 438
67 3300048904 Ga0496101_0010205 Ga0496101_0010205_240_1613 438
68 3300048905 Ga0496102_0000275 Ga0496102_0000275_61921_63294 438
69 3300048906 Ga0496103_0000138 Ga0496103_0000138_72069_73442 438
70 3300048907 Ga0496104_0014055 Ga0496104_0014055_5410_6783 438
71 3300048913 Ga0496110_0145574 Ga0496110_0145574_32_1405 438
72 3300048919 Ga0496116_0000855 Ga0496116_0000855_2270_3643 438
73 3300048920 Ga0496117_0000488 Ga0496117_0000488_61935_63308 438
74 3300048921 Ga0496118_0000235 Ga0496118_0000235_2271_3644 438
75 3300048922 Ga0496119_0000148 Ga0496119_0000148_95023_96396 438
76 3300048923 Ga0496120_0010779 Ga0496120_0010779_2766_4139 438
77 3300048924 Ga0496121_0048694 Ga0496121_0048694_87_1460 438
78 3300048927 Ga0496124_0010676 Ga0496124_0010676_3487_4860 438
79 3300048929 Ga0496126_0000635 Ga0496126_0000635_2271_3644 438
80 3300049568 Ga0501031_0028310 Ga0501031_0028310_2061_3470 438
81 3300049571 Ga0501034_0106412 Ga0501034_0106412_71_1447 438
82 3300049572 Ga0501036_0036883 Ga0501036_0036883_1135_2544 438
83 3300049573 Ga0501037_0067344 Ga0501037_0067344_231_1640 438
84 3300049574 Ga0501038_0030638 Ga0501038_0030638_233_1642 438
85 3300049579 Ga0501043_0014218 Ga0501043_0014218_749_2158 438
86 3300049580 Ga0501046_0015524 Ga0501046_0015524_2218_3627 438
87 3300049581 Ga0501047_0013451 Ga0501047_0013451_4084_5460 438
88 3300006028 Ga0070717_10181600 Ga0070717_101816002 439
89 3300050513 nmdc:mga0rr50_73088_c1 nmdc:mga0rr50_73088_c1_1035_2504 439
90 3300050515 nmdc:mga0a205_126062_c1 nmdc:mga0a205_126062_c1_574_2043 439
91 3300046517 Ga0495630_0019283 Ga0495630_0019283_3274_4674 440
92 3300049822 Ga0501035_0023390 Ga0501035_0023390_1122_2582 440
93 3300049823 Ga0501044_0209494 Ga0501044_0209494_398_1858 440
94 3300042014 Ga0439457_009583 Ga0439457_009583_731_2203 441
95 3300044842 Ga0466957_0047187 Ga0466957_0047187_1105_2562 441
96 3300045976 Ga0466967_0169534 Ga0466967_0169534_71_1480 441
97 3300046683 Ga0495658_0010152 Ga0495658_0010152_1351_2784 441
98 3300041404 Ga0439436_0004595 Ga0439436_0004595_2052_3524 442
99 3300038443 Ga0395901_0262017 Ga0395901_0262017_18_1421 443
100 3300049569 Ga0501032_0158869 Ga0501032_0158869_33_1469 444
101 3300049581 Ga0501047_0271945 Ga0501047_0271945_16_1452 444
102 3300028786 Ga0307517_10084316 Ga0307517_100843162 445
103 3300030522 Ga0307512_10011226 Ga0307512_100112264 445
104 3300031616 Ga0307508_10043112 Ga0307508_100431122 445
105 3300031616 Ga0307508_10067386 Ga0307508_100673863 445
106 3300046522 Ga0495643_0043330 Ga0495643_0043330_707_2149 445
107 3300047447 Ga0495685_000833 Ga0495685_000833_3375_4817 445
108 3300047470 Ga0495681_0032680 Ga0495681_0032680_270_1712 445
109 3300047472 Ga0495686_0082236 Ga0495686_0082236_92_1534 445
110 3300049570 Ga0501033_0007289 Ga0501033_0007289_6223_7827 445
111 3300053160 Ga0500633_0011425 Ga0500633_0011425_45_1487 445
112 3300053739 Ga0500587_004788 Ga0500587_004788_373_1815 445
113 3300006042 Ga0075368_10049508 Ga0075368_100495081 446
114 3300006178 Ga0075367_10008260 Ga0075367_100082601 446
115 3300027866 Ga0209813_10026864 Ga0209813_100268641 446
116 3300046459 Ga0495629_0005008 Ga0495629_0005008_2076_3536 446
117 3300046660 Ga0495625_0010562 Ga0495625_0010562_303_1763 446
118 3300047470 Ga0495681_0001709 Ga0495681_0001709_6966_8426 446
119 3300048089 Ga0495614_0000938 Ga0495614_0000938_6191_7651 446
120 3300049572 Ga0501036_0040119 Ga0501036_0040119_218_1720 446
121 3300049574 Ga0501038_0083866 Ga0501038_0083866_75_1577 446
122 3300049581 Ga0501047_0055647 Ga0501047_0055647_109_1611 446
123 3300049822 Ga0501035_0006838 Ga0501035_0006838_6053_7555 446
124 3300049822 Ga0501035_0157141 Ga0501035_0157141_193_1812 446
125 3300049823 Ga0501044_0036126 Ga0501044_0036126_555_2057 446
126 3300050494 nmdc:mga06z11_4831_c1 nmdc:mga06z11_4831_c1_30_1472 446
127 3300050495 nmdc:mga04h51_31706_c1 nmdc:mga04h51_31706_c1_35_1477 446
128 3300053107 Ga0500560_000044 Ga0500560_000044_4909_6369 446
129 3300005347 Ga0070668_100039122 Ga0070668_1000391224 447
130 3300005841 Ga0068863_100041587 Ga0068863_1000415876 447
131 3300026088 Ga0207641_10013629 Ga0207641_100136291 447
132 3300046692 Ga0495671_0003890 Ga0495671_0003890_2275_3717 447
133 3300047318 Ga0495636_0054437 Ga0495636_0054437_88_1563 447
134 3300047443 Ga0495687_053723 Ga0495687_053723_215_1630 447
135 3300048917 Ga0496114_0118288 Ga0496114_0118288_744_2165 447
136 3300044658 Ga0466972_0071754 Ga0466972_0071754_169_1596 448
137 3300046558 Ga0495633_0021828 Ga0495633_0021828_1301_2788 448
138 3300014497 Ga0182008_10004686 Ga0182008_100046861 449
139 3300015262 Ga0182007_10034015 Ga0182007_100340152 449
140 3300015265 Ga0182005_1016771 Ga0182005_10167711 449
141 3300047443 Ga0495687_002749 Ga0495687_002749_6842_8284 449
142 iso_pu_bacteria 2891554331 2891554785 449
143 3300005539 Ga0068853_100017710 Ga0068853_1000177104 450
144 3300046453 Ga0495627_017351 Ga0495627_017351_58_1575 450
145 3300046454 Ga0495592_0034240 Ga0495592_0034240_504_1967 450
146 3300046472 Ga0495580_0058626 Ga0495580_0058626_881_2344 450
147 3300046500 Ga0495596_0017056 Ga0495596_0017056_1320_2843 450
148 3300046507 Ga0495606_0025713 Ga0495606_0025713_750_2249 450
149 3300046511 Ga0495608_0130270 Ga0495608_0130270_102_1565 450
150 3300046513 Ga0495616_0054038 Ga0495616_0054038_45_1544 450
151 3300046516 Ga0495628_0021408 Ga0495628_0021408_3194_4657 450
152 3300046520 Ga0495637_0047465 Ga0495637_0047465_15_1508 450
153 3300046522 Ga0495643_0027521 Ga0495643_0027521_868_2331 450
154 3300046529 Ga0495652_0043793 Ga0495652_0043793_971_2434 450
155 3300046665 Ga0495661_0070572 Ga0495661_0070572_94_1593 450
156 3300046810 Ga0495660_0042299 Ga0495660_0042299_188_1687 450
157 3300047315 Ga0495581_0106904 Ga0495581_0106904_48_1517 450
158 3300047322 Ga0495680_0017516 Ga0495680_0017516_3088_4551 450
159 3300046455 Ga0495603_0027598 Ga0495603_0027598_229_1728 451
160 3300046459 Ga0495629_0038088 Ga0495629_0038088_1157_2656 451
161 3300047471 Ga0495684_0031840 Ga0495684_0031840_1436_2854 451
162 3300025929 Ga0207664_10088453 Ga0207664_100884532 452
163 3300046794 Ga0495589_0007062 Ga0495589_0007062_329_1780 452
164 3300047321 Ga0495676_0011550 Ga0495676_0011550_320_1765 452
165 3300053088 Ga0500644_0006676 Ga0500644_0006676_539_1984 452
166 3300005563 Ga0068855_100032391 Ga0068855_1000323914 453
167 3300006038 Ga0075365_10145842 Ga0075365_101458421 453
168 3300013104 Ga0157370_10015556 Ga0157370_100155562 453
169 3300035725 Ga0373947_0041535 Ga0373947_0041535_41_1432 453
170 3300046455 Ga0495603_0026568 Ga0495603_0026568_1894_3324 453
171 3300047321 Ga0495676_0010050 Ga0495676_0010050_2128_3558 453
172 3300048089 Ga0495614_0000846 Ga0495614_0000846_329_1759 453
173 iso_pu_bacteria 2912723979 2912730817 453
174 3300015261 Ga0182006_1036680 Ga0182006_10366802 454
175 3300049586 Ga0501070_0083879 Ga0501070_0083879_717_2381 454
176 3300009094 Ga0111539_10006499 Ga0111539_1000649914 455
177 3300027907 Ga0207428_10024588 Ga0207428_100245883 455
178 3300046462 Ga0495651_0011850 Ga0495651_0011850_2931_4355 455
179 3300046463 Ga0495653_0013162 Ga0495653_0013162_4510_5934 455
180 3300046472 Ga0495580_0022814 Ga0495580_0022814_847_2271 455
181 3300046477 Ga0495664_0005989 Ga0495664_0005989_2936_4360 455
182 3300046499 Ga0495594_0002244 Ga0495594_0002244_6682_8130 455
183 3300046511 Ga0495608_0004844 Ga0495608_0004844_811_2235 455
184 3300046516 Ga0495628_0001124 Ga0495628_0001124_20291_21715 455
185 3300046517 Ga0495630_0035887 Ga0495630_0035887_1598_3022 455
186 3300046526 Ga0495666_0007506 Ga0495666_0007506_325_1749 455
187 3300046529 Ga0495652_0009670 Ga0495652_0009670_3488_4912 455
188 3300046531 Ga0495665_0014064 Ga0495665_0014064_2317_3741 455
189 3300046533 Ga0495640_0020598 Ga0495640_0020598_2238_3662 455
190 3300046535 Ga0495586_0007014 Ga0495586_0007014_735_2159 455
191 3300046543 Ga0495645_0004582 Ga0495645_0004582_7902_9326 455
192 3300046557 Ga0495622_0017272 Ga0495622_0017272_55_1503 455
193 3300046559 Ga0495667_0004962 Ga0495667_0004962_6898_8322 455
194 3300046663 Ga0495635_0008663 Ga0495635_0008663_3489_4913 455
195 3300046675 Ga0495657_0065026 Ga0495657_0065026_292_1716 455
196 3300046678 Ga0495599_0006972 Ga0495599_0006972_468_1892 455
197 3300046680 Ga0495646_0008785 Ga0495646_0008785_663_2087 455
198 3300046689 Ga0495613_0006485 Ga0495613_0006485_550_1974 455
199 3300047317 Ga0495604_0001340 Ga0495604_0001340_3799_5223 455
200 3300047319 Ga0495674_0005859 Ga0495674_0005859_2990_4414 455
201 3300047321 Ga0495676_0016511 Ga0495676_0016511_516_1964 455
202 3300047471 Ga0495684_0017701 Ga0495684_0017701_811_2235 455
203 3300047673 Ga0495593_0049606 Ga0495593_0049606_87_1550 455
204 3300049568 Ga0501031_0002042 Ga0501031_0002042_9874_11388 455
205 3300049569 Ga0501032_0006325 Ga0501032_0006325_6864_8378 455
206 3300049571 Ga0501034_0036990 Ga0501034_0036990_3359_4873 455
207 3300049572 Ga0501036_0032644 Ga0501036_0032644_42_1556 455
208 3300049575 Ga0501039_0034429 Ga0501039_0034429_507_2021 455
209 3300049576 Ga0501040_0122464 Ga0501040_0122464_211_1725 455
210 3300049577 Ga0501041_0022923 Ga0501041_0022923_705_2219 455
211 3300049580 Ga0501046_0021332 Ga0501046_0021332_3779_5293 455
212 3300049583 Ga0501067_0005472 Ga0501067_0005472_2851_4365 455
213 3300049584 Ga0501068_0022849 Ga0501068_0022849_664_2178 455
214 3300049587 Ga0501071_0007769 Ga0501071_0007769_1708_3222 455
215 3300049588 Ga0501072_0002701 Ga0501072_0002701_7914_9428 455
216 3300049592 Ga0501076_0187243 Ga0501076_0187243_121_1635 455
217 3300049741 Ga0501079_0048399 Ga0501079_0048399_950_2464 455
218 3300049742 Ga0501080_0022322 Ga0501080_0022322_556_2070 455
219 3300049823 Ga0501044_0000806 Ga0501044_0000806_2884_4398 455
220 3300053077 Ga0495601_0004280 Ga0495601_0004280_4466_5890 455
221 3300053085 Ga0495619_0101036 Ga0495619_0101036_68_1492 455
222 3300053149 Ga0500600_0078389 Ga0500600_0078389_221_1702 455
223 3300054114 Ga0501084_0004705 Ga0501084_0004705_6315_7829 455
224 3300060353 Ga0501082_0011656 Ga0501082_0011656_3787_5301 455
225 iso_pu_bacteria 2918501144 2918505782 455
226 iso_pu_bacteria 8023623736 8023629388 455
227 iso_pu_bacteria 8048406513 8048413867 455
228 3300005985 Ga0081539_10051323 Ga0081539_100513231 456
229 3300028379 Ga0268266_10091973 Ga0268266_100919732 456
230 3300028786 Ga0307517_10002248 Ga0307517_1000224829 456
231 3300028794 Ga0307515_10001897 Ga0307515_1000189729 456
232 3300033179 Ga0307507_10009069 Ga0307507_1000906911 456
233 3300033180 Ga0307510_10095605 Ga0307510_100956051 456
234 iso_pu_bacteria 2582581312 2585295884 456
235 iso_pu_bacteria 2784132148 2784589688 456
236 iso_pu_bacteria 2808606982 2811845124 456
237 iso_pu_bacteria 2616644814 2616696828 457
238 iso_pu_bacteria 2811994879 2812356739 457
239 iso_pu_bacteria 2852635781 2852640368 457
240 iso_pu_bacteria 2862507626 2862516818 457
241 iso_pu_bacteria 2862574272 2862578212 457
242 iso_pu_bacteria 2947224130 2947227811 457
243 iso_pu_bacteria 8008574985 8008577835 457
244 3300031649 Ga0307514_10003307 Ga0307514_1000330714 458
245 3300031730 Ga0307516_10012550 Ga0307516_1001255013 458
246 3300033180 Ga0307510_10018408 Ga0307510_100184087 458
247 3300033180 Ga0307510_10105865 Ga0307510_101058651 458
248 3300044765 Ga0466970_0092891 Ga0466970_0092891_183_1610 458
249 3300046694 Ga0495649_0092762 Ga0495649_0092762_84_1526 458
250 iso_pu_bacteria 2547132111 2547409985 458
251 iso_pu_bacteria 2582581313 2585308122 458
252 iso_pu_bacteria 2582581314 2585319566 458
253 iso_pu_bacteria 2643221578 2643902902 458
254 iso_pu_bacteria 2643221647 2644261625 458
255 iso_pu_bacteria 2643221673 2644404588 458
256 iso_pu_bacteria 2643221678 2644439292 458
257 iso_pu_bacteria 2786546132 2786671928 458
258 iso_pu_bacteria 2808606359 2808843292 458
259 iso_pu_bacteria 2808606375 2808912901 458
260 iso_pu_bacteria 2919468124 2919470192 458
261 iso_pu_bacteria 2946045630 2946048617 458
262 iso_pu_bacteria 2954673503 2954678200 458
263 iso_pu_bacteria 2954682443 2954685957 458
264 iso_pu_bacteria 2954691527 2954695606 458
265 iso_pu_bacteria 2954701450 2954710799 458
266 iso_pu_bacteria 3006493962 3006494695 458
267 iso_pu_bacteria 8056829672 8056837650 458
268 3300003578 Ga0006562J51391_1102892 Ga0006562J51391_11028924 459
269 3300030521 Ga0307511_10006642 Ga0307511_100066425 459
270 3300031507 Ga0307509_10018160 Ga0307509_100181604 459
271 3300031730 Ga0307516_10019067 Ga0307516_100190672 459
272 3300047444 Ga0495675_0005789 Ga0495675_0005789_1667_3352 459
273 iso_pu_bacteria 2784746768 2785370747 459
274 iso_pu_bacteria 2862178590 2862185368 459
275 iso_pu_bacteria 2954711539 2954715034 459
276 iso_pu_bacteria 2954721474 2954724976 459
277 iso_pu_bacteria 2954731030 2954736842 459
278 iso_pu_bacteria 2954740390 2954743909 459
279 iso_pu_bacteria 2954749733 2954755690 459
280 iso_pu_bacteria 2954759201 2954762850 459
281 3300033179 Ga0307507_10025134 Ga0307507_100251349 460
282 3300037466 Ga0395898_0093581 Ga0395898_0093581_1406_2854 460
283 3300042005 Ga0439448_0014013 Ga0439448_0014013_880_2328 460
284 3300042138 Ga0450903_001178 Ga0450903_001178_3111_4559 460
285 3300042157 Ga0439458_0002293 Ga0439458_0002293_400_1848 460
286 3300046459 Ga0495629_0008159 Ga0495629_0008159_5281_6771 460
287 3300046462 Ga0495651_0001402 Ga0495651_0001402_17155_18645 460
288 3300046476 Ga0495662_0000039 Ga0495662_0000039_29437_30927 460
289 3300046477 Ga0495664_0001560 Ga0495664_0001560_10070_11560 460
290 3300046516 Ga0495628_0004286 Ga0495628_0004286_209_1660 460
291 3300046517 Ga0495630_0073330 Ga0495630_0073330_479_1969 460
292 3300046533 Ga0495640_0071290 Ga0495640_0071290_243_1733 460
293 3300046642 Ga0495634_0001063 Ga0495634_0001063_10338_11828 460
294 3300046663 Ga0495635_0004318 Ga0495635_0004318_7646_9136 460
295 3300046675 Ga0495657_0001831 Ga0495657_0001831_12048_13538 460
296 3300046680 Ga0495646_0000605 Ga0495646_0000605_1027_2517 460
297 3300046689 Ga0495613_0004137 Ga0495613_0004137_2064_3515 460
298 3300046689 Ga0495613_0037030 Ga0495613_0037030_39_1529 460
299 3300046809 Ga0495600_0035192 Ga0495600_0035192_511_2001 460
300 3300046809 Ga0495600_0080599 Ga0495600_0080599_176_1627 460
301 3300047315 Ga0495581_0051020 Ga0495581_0051020_601_2091 460
302 3300047317 Ga0495604_0000692 Ga0495604_0000692_13097_14587 460
303 3300047319 Ga0495674_0097051 Ga0495674_0097051_974_2464 460
304 3300047444 Ga0495675_0068262 Ga0495675_0068262_723_2222 460
305 3300049575 Ga0501039_0032955 Ga0501039_0032955_2217_3719 460
306 iso_pu_bacteria 2784746763 2785341908 460
307 iso_pu_bacteria 2862281513 2862286822 460
308 iso_pu_bacteria 2867428634 2867429348 460
309 3300028794 Ga0307515_10101954 Ga0307515_101019541 461
310 3300031456 Ga0307513_10014815 Ga0307513_100148154 461
311 3300031456 Ga0307513_10091820 Ga0307513_100918202 461
312 3300041404 Ga0439436_0000987 Ga0439436_0000987_2672_4108 461
313 3300042007 Ga0439449_0016529 Ga0439449_0016529_897_2333 461
314 3300042014 Ga0439457_000226 Ga0439457_000226_12124_13560 461
315 3300046492 Ga0495585_0006093 Ga0495585_0006093_256_1707 461
316 3300047317 Ga0495604_0095807 Ga0495604_0095807_201_1670 461
317 3300049569 Ga0501032_0051453 Ga0501032_0051453_1155_2603 461
318 3300049570 Ga0501033_0107172 Ga0501033_0107172_425_1873 461
319 3300049571 Ga0501034_0043503 Ga0501034_0043503_807_2255 461
320 3300049574 Ga0501038_0011284 Ga0501038_0011284_1542_2990 461
321 3300049579 Ga0501043_0011949 Ga0501043_0011949_782_2230 461
322 3300049581 Ga0501047_0057951 Ga0501047_0057951_616_2064 461
323 3300049822 Ga0501035_0051284 Ga0501035_0051284_1004_2479 461
324 3300049823 Ga0501044_0052436 Ga0501044_0052436_101_1576 461
325 iso_pu_bacteria 2877676314 2877679842 461
326 iso_pu_bacteria 2954002825 2954003086 461
327 iso_pu_bacteria 2995463766 2995464115 461
328 iso_pu_bacteria 3006321560 3006326595 461
329 3300001990 JGI24737J22298_10011801 JGI24737J22298_100118011 462
330 3300011119 Ga0105246_10022892 Ga0105246_100228925 462
331 3300025904 Ga0207647_10038821 Ga0207647_100388211 462
332 3300031456 Ga0307513_10105129 Ga0307513_101051291 462
333 3300031507 Ga0307509_10088336 Ga0307509_100883361 462
334 3300045976 Ga0466967_0046949 Ga0466967_0046949_172_1623 462
335 3300049579 Ga0501043_0105635 Ga0501043_0105635_424_1866 462
336 3300049742 Ga0501080_0069371 Ga0501080_0069371_1663_3105 462
337 3300049823 Ga0501044_0029838 Ga0501044_0029838_2134_3576 462

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

48

435

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9127 1 451
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8937 13 448
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8901 1 451
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8818 13 448
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8782 13 448
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9666 16 200 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9622 16 211 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9466 16 200 1.20.1250.20
af_Q9HE13_92_349_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.945 15 261 1.20.1250.20
af_P9WJX3_18_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9432 12 188 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0D2HD52-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9447 8 448 GO:0005886
GO:0022857
AF-A0A353DBH9-F1-model_v4 MFS transporter 0.9411 6 205 GO:0016020
GO:0022857
AF-A0A5B0RLU2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9398 8 448 GO:0005886
GO:0022857
AF-A0A561PL88-F1-model_v4 EmrB/QacA subfamily drug resistance transporter 0.938 11 448 GO:0016020
GO:0022857
AF-A0A4D4LVG6-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9358 2 276 GO:0016020
GO:0022857
GO:0046677

Feature Viewer

pLDDT pTM Quality
88.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map