F412993

General Info

Members Datasets Scaffolds Average Seq Length
337 220 674 172

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100141574|Ga0068855_1001415742
Length 189
Sequence MTRRPLPPRFLPHLSRSRVFHAGLLPVLVLPLALAACSGSEHSDLKQELVVLTKDQRGKIDPLPVVKPYEPVPYQAFDQPDPFGTQKIELVAKSLKPDLNRPKEPLEAYPLETLKMVGVLQQKKQTFALVRADTSLYRIKVGNYLGQNFGLVTGISDNQVQLRELIQDAGGDWSERQSTLQLQDAGSGK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.89
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 16.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100141574 3300005563 Bacteria 2741
2 Ga0058861_11357333 3300004800 Bacteria 1475
3 Ga0058862_11271760 3300004803 Bacteria 916
4 Ga0070670_100080624 3300005331 Bacteria 2797
5 Ga0068869_100000748 3300005334 Bacteria 18490
6 Ga0070666_10189437 3300005335 Unclassified 1445
7 Ga0070689_100134005 3300005340 Unclassified 1988
8 Ga0070689_101816551 3300005340 Bacteria 556
9 Ga0070687_100595969 3300005343 Unclassified 758
10 Ga0070669_101375144 3300005353 Unclassified 612
11 Ga0070675_100024903 3300005354 Bacteria 4796
12 Ga0070674_100131805 3300005356 Bacteria 1864
13 Ga0070659_100113247 3300005366 Bacteria 2191
14 Ga0070667_101091700 3300005367 Unclassified 746
15 Ga0070709_10404080 3300005434 Unclassified 1020
16 Ga0070710_10039476 3300005437 Bacteria 2598
17 Ga0070705_100111440 3300005440 Bacteria 1749
18 Ga0070705_100204312 3300005440 Unclassified 1357
19 Ga0070700_100256176 3300005441 Unclassified 1258
20 Ga0070694_100622675 3300005444 Bacteria 871
21 Ga0070678_100060614 3300005456 Bacteria 2786
22 Ga0070681_10035900 3300005458 Bacteria 4979
23 Ga0068867_100156291 3300005459 Bacteria 1795
24 Ga0070698_100427600 3300005471 Unclassified 1259
25 Ga0070698_100534607 3300005471 Unclassified 1111
26 Ga0070699_100981482 3300005518 Unclassified 774
27 Ga0068853_100001374 3300005539 Bacteria 17558
28 Ga0068853_101054318 3300005539 Unclassified 783
29 Ga0070686_100155734 3300005544 Bacteria 1604
30 Ga0070695_100035059 3300005545 Bacteria 3150
31 Ga0070696_100484693 3300005546 Bacteria 981
32 Ga0070693_100202460 3300005547 Bacteria 1290
33 Ga0070665_100010415 3300005548 Bacteria 9409
34 Ga0070704_100003706 3300005549 Bacteria 8802
35 Ga0070704_100447922 3300005549 Bacteria 1111
36 Ga0068855_100055617 3300005563 Bacteria 4647
37 Ga0068857_100034517 3300005577 Bacteria 4474
38 Ga0068854_100874294 3300005578 Unclassified 788
39 Ga0068856_100343836 3300005614 Bacteria 1510
40 Ga0068856_100605841 3300005614 Bacteria 1116
41 Ga0070702_100051058 3300005615 Unclassified 2366
42 Ga0068859_100004039 3300005617 Bacteria 14959
43 Ga0068864_100063600 3300005618 Bacteria 3198
44 Ga0068861_100289117 3300005719 Bacteria 1415
45 Ga0068863_100043046 3300005841 Bacteria 4287
46 Ga0068858_100026206 3300005842 Bacteria 5420
47 Ga0068858_100039504 3300005842 Bacteria 4375
48 Ga0068862_100075876 3300005844 Bacteria 2909
49 Ga0075365_10458896 3300006038 Bacteria 900
50 Ga0070715_10371884 3300006163 Unclassified 786
51 Ga0070716_100002115 3300006173 Bacteria 9124
52 Ga0097621_100041446 3300006237 Bacteria 3706
53 Ga0075370_10107779 3300006353 Unclassified 1616
54 Ga0068871_100432303 3300006358 Bacteria 1177
55 Ga0075430_100140515 3300006846 Bacteria 2011
56 Ga0075431_100000324 3300006847 Bacteria 37752
57 Ga0075431_100043332 3300006847 Bacteria 4644
58 Ga0075431_100125345 3300006847 Bacteria 2650
59 Ga0075434_101509881 3300006871 Bacteria 681
60 Ga0068865_100406725 3300006881 Bacteria 1116
61 Ga0075436_100026936 3300006914 Bacteria 3958
62 Ga0075436_100156201 3300006914 Bacteria 1607
63 Ga0097620_100004039 3300006931 Bacteria 14959
64 Ga0075435_100189917 3300007076 Bacteria 1739
65 Ga0099794_10037357 3300007265 Unclassified 2299
66 Ga0099794_10057924 3300007265 Bacteria 1878
67 Ga0099794_10285043 3300007265 Bacteria 854
68 Ga0099795_10015261 3300007788 Bacteria 2402
69 Ga0099795_10022052 3300007788 Bacteria 2098
70 Ga0105240_10092411 3300009093 Bacteria 3695
71 Ga0111539_10257931 3300009094 Unclassified 2030
72 Ga0105245_10104933 3300009098 Bacteria 2621
73 Ga0105243_10439672 3300009148 Unclassified 1221
74 Ga0105241_10021802 3300009174 Bacteria 4740
75 Ga0105241_10126964 3300009174 Bacteria 2061
76 Ga0105242_10042298 3300009176 Bacteria 3678
77 Ga0105242_11033785 3300009176 Unclassified 831
78 Ga0105242_11330280 3300009176 Unclassified 743
79 Ga0105248_10001876 3300009177 Bacteria 23307
80 Ga0105237_10008914 3300009545 Bacteria 10810
81 Ga0105238_10060911 3300009551 Bacteria 3777
82 Ga0105238_10195945 3300009551 Unclassified 1996
83 Ga0099796_10087022 3300010159 Bacteria 1156
84 Ga0105239_10061863 3300010375 Bacteria 4109
85 Ga0105239_10168074 3300010375 Bacteria 2452
86 Ga0105246_10007889 3300011119 Bacteria 6532
87 Ga0105246_10990813 3300011119 Unclassified 760
88 Ga0157369_10885463 3300013105 Bacteria 916
89 Ga0157374_10000127 3300013296 Bacteria 69890
90 Ga0157378_10051407 3300013297 Bacteria 3667
91 Ga0157378_10716274 3300013297 Bacteria 1021
92 Ga0157372_10089203 3300013307 Bacteria 3503
93 Ga0157375_10901408 3300013308 Bacteria 1028
94 Ga0163163_10053565 3300014325 Bacteria 3983
95 Ga0163163_10066238 3300014325 Bacteria 3587
96 Ga0163163_11585292 3300014325 Unclassified 716
97 Ga0157380_10096182 3300014326 Bacteria 2455
98 Ga0157379_10040563 3300014968 Bacteria 4155
99 Ga0157376_10584026 3300014969 Bacteria 1110
100 Ga0157376_11918660 3300014969 Unclassified 629
101 Ga0207680_10243332 3300025903 Unclassified 1240
102 Ga0207685_10221524 3300025905 Unclassified 900
103 Ga0207654_10004491 3300025911 Bacteria 7043
104 Ga0207707_10257858 3300025912 Bacteria 1514
105 Ga0207694_10036929 3300025924 Bacteria 3750
106 Ga0207659_10038347 3300025926 Bacteria 3332
107 Ga0207687_10219182 3300025927 Unclassified 1497
108 Ga0207690_10024182 3300025932 Bacteria 3802
109 Ga0207686_10149576 3300025934 Unclassified 1624
110 Ga0207686_10867358 3300025934 Unclassified 727
111 Ga0207670_10029654 3300025936 Bacteria 3487
112 Ga0207669_10049861 3300025937 Bacteria 2499
113 Ga0207665_10001087 3300025939 Bacteria 18295
114 Ga0207691_10230037 3300025940 Unclassified 1606
115 Ga0207711_10014208 3300025941 Bacteria 6612
116 Ga0207689_10002992 3300025942 Bacteria 15584
117 Ga0207679_10482577 3300025945 Bacteria 1104
118 Ga0207667_10070010 3300025949 Bacteria 3652
119 Ga0207667_10281531 3300025949 Bacteria 1699
120 Ga0207703_10015001 3300026035 Bacteria 6047
121 Ga0207703_10040646 3300026035 Bacteria 3722
122 Ga0207639_10010995 3300026041 Bacteria 6274
123 Ga0207639_11213559 3300026041 Unclassified 708
124 Ga0207708_10224007 3300026075 Bacteria 1508
125 Ga0207702_10374212 3300026078 Bacteria 1368
126 Ga0207702_10545353 3300026078 Bacteria 1134
127 Ga0207641_10041880 3300026088 Bacteria 3840
128 Ga0207648_10050473 3300026089 Bacteria 3638
129 Ga0207676_10110209 3300026095 Unclassified 2302
130 Ga0207674_10030131 3300026116 Bacteria 5708
131 Ga0207675_100091197 3300026118 Bacteria 2865
132 Ga0207683_10027436 3300026121 Bacteria 4921
133 Ga0209179_1004397 3300027512 Bacteria 2123
134 Ga0209588_1001855 3300027671 Bacteria 5637
135 Ga0209588_1132685 3300027671 Unclassified 794
136 Ga0268266_10055827 3300028379 Bacteria 3396
137 Ga0268265_10053174 3300028380 Bacteria 3067
138 Ga0268264_10043062 3300028381 Bacteria 3740
139 Ga0268264_11558019 3300028381 Unclassified 671
140 Ga0265323_10005124 3300028653 Bacteria 5584
141 Ga0265332_10039960 3300031238 Bacteria 2031
142 Ga0265325_10017237 3300031241 Bacteria 4016
143 Ga0265325_10079000 3300031241 Bacteria 1638
144 Ga0265316_10094425 3300031344 Bacteria 2279
145 Ga0265316_10120568 3300031344 Bacteria 1981
146 Ga0265316_10130059 3300031344 Bacteria 1897
147 Ga0307509_10000018 3300031507 Bacteria 258998
148 Ga0307416_100524070 3300032002 Bacteria 1254
149 Ga0316587_1001331 3300033529 Unclassified 3011
150 Ga0373948_0175152 3300034817 Bacteria 548
151 Ga0373934_0000011 3300035086 Bacteria 62703
152 Ga0373934_0002280 3300035086 Bacteria 7060
153 Ga0373934_0047340 3300035086 Bacteria 1701
154 Ga0373923_0005622 3300035111 Bacteria 4268
155 Ga0373936_0000889 3300035113 Bacteria 10689
156 Ga0373953_0092774 3300035117 Bacteria 1264
157 Ga0373953_0147524 3300035117 Bacteria 1007
158 Ga0373954_0002079 3300035118 Bacteria 8308
159 Ga0373954_0010175 3300035118 Bacteria 4146
160 Ga0373956_0000124 3300035119 Bacteria 27145
161 Ga0373956_0008670 3300035119 Bacteria 4117
162 Ga0373956_0014877 3300035119 Bacteria 3253
163 Ga0373956_0205085 3300035119 Bacteria 935
164 Ga0373957_0000670 3300035120 Bacteria 8831
165 Ga0373957_0011545 3300035120 Bacteria 2952
166 Ga0373943_0016637 3300035170 Bacteria 3356
167 Ga0373946_0011804 3300035171 Bacteria 3266
168 Ga0373955_0008840 3300035172 Bacteria 4695
169 Ga0373955_0076541 3300035172 Bacteria 1882
170 Ga0373955_0133319 3300035172 Bacteria 1452
171 Ga0373935_0011893 3300035692 Bacteria 5229
172 Ga0373927_0031320 3300035695 Bacteria 3467
173 Ga0373927_0349364 3300035695 Bacteria 975
174 Ga0373933_0000331 3300035724 Bacteria 30365
175 Ga0373933_0014198 3300035724 Bacteria 4424
176 Ga0373933_0126226 3300035724 Bacteria 1605
177 Ga0373933_0411808 3300035724 Bacteria 882
178 Ga0373933_0975769 3300035724 Unclassified 558
179 Ga0373937_0001929 3300036401 Bacteria 17353
180 Ga0373937_0005477 3300036401 Bacteria 10872
181 Ga0373937_0805140 3300036401 Bacteria 887
182 Ga0373937_0805146 3300036401 Unclassified 887
183 Ga0373925_0011254 3300037068 Bacteria 6489
184 Ga0373925_0121641 3300037068 Bacteria 2027
185 Ga0395905_0190029 3300037471 Bacteria 1926
186 Ga0242420_054334 3300038996 Unclassified 788
187 Ga0451843_0749695 3300041509 Bacteria 951
188 Ga0451577_0000489 3300042876 Bacteria 67100
189 Ga0451577_0036235 3300042876 Bacteria 4442
190 Ga0451577_0056873 3300042876 Bacteria 3489
191 Ga0451577_0060561 3300042876 Bacteria 3375
192 Ga0453683_0159516 3300044673 Bacteria 1427
193 Ga0453684_0000014 3300044712 Bacteria 993311
194 Ga0453684_0000189 3300044712 Bacteria 269690
195 Ga0453684_0000731 3300044712 Bacteria 115326
196 Ga0453684_0001597 3300044712 Bacteria 62266
197 Ga0453684_0002735 3300044712 Bacteria 41744
198 Ga0453684_0006614 3300044712 Bacteria 21910
199 Ga0453684_0228279 3300044712 Bacteria 2151
200 Ga0453684_0796631 3300044712 Bacteria 1019
201 Ga0451576_0000272 3300045051 Bacteria 126530
202 Ga0451576_0049679 3300045051 Bacteria 4402
203 Ga0451576_0126320 3300045051 Bacteria 2665
204 Ga0495592_0009535 3300046454 Bacteria 7304
205 Ga0495592_0012190 3300046454 Bacteria 6524
206 Ga0495592_0084287 3300046454 Bacteria 2294
207 Ga0495641_0000646 3300046461 Bacteria 29404
208 Ga0495651_0000570 3300046462 Bacteria 28594
209 Ga0495651_0001148 3300046462 Bacteria 20475
210 Ga0495653_0016472 3300046463 Bacteria 6017
211 Ga0495653_0725629 3300046463 Unclassified 602
212 Ga0495580_0026721 3300046472 Bacteria 4204
213 Ga0495582_0029451 3300046473 Bacteria 3014
214 Ga0495662_0001966 3300046476 Bacteria 10318
215 Ga0495664_0015795 3300046477 Bacteria 4296
216 Ga0495594_0014199 3300046499 Bacteria 4169
217 Ga0495608_0009175 3300046511 Bacteria 6914
218 Ga0495618_0006570 3300046514 Bacteria 7052
219 Ga0495628_0000486 3300046516 Bacteria 36439
220 Ga0495628_0001568 3300046516 Bacteria 20933
221 Ga0495630_0003803 3300046517 Bacteria 10529
222 Ga0495666_0000205 3300046526 Bacteria 25319
223 Ga0495652_0002564 3300046529 Bacteria 18609
224 Ga0495652_0150602 3300046529 Unclassified 1818
225 Ga0495640_0006505 3300046533 Bacteria 9234
226 Ga0495586_0001179 3300046535 Bacteria 14671
227 Ga0495586_0060930 3300046535 Bacteria 2053
228 Ga0495587_0003401 3300046536 Bacteria 10619
229 Ga0495645_0001457 3300046543 Bacteria 15986
230 Ga0495622_0037317 3300046557 Bacteria 2264
231 Ga0495667_0008223 3300046559 Bacteria 7080
232 Ga0495667_0008352 3300046559 Bacteria 7024
233 Ga0495667_0335530 3300046559 Bacteria 956
234 Ga0495667_0492128 3300046559 Unclassified 768
235 Ga0495634_0002521 3300046642 Bacteria 15179
236 Ga0495635_0101422 3300046663 Bacteria 1967
237 Ga0495657_0002214 3300046675 Bacteria 16460
238 Ga0495657_0162256 3300046675 Bacteria 1382
239 Ga0495599_0000461 3300046678 Bacteria 23203
240 Ga0495599_0030342 3300046678 Bacteria 3392
241 Ga0495647_0006528 3300046681 Bacteria 3869
242 Ga0495658_0012677 3300046683 Bacteria 4275
243 Ga0495613_0001788 3300046689 Bacteria 16337
244 Ga0495624_0006034 3300046690 Bacteria 8639
245 Ga0495600_0000301 3300046809 Bacteria 26459
246 Ga0495604_0465058 3300047317 Unclassified 824
247 Ga0495636_0019790 3300047318 Bacteria 2708
248 Ga0495674_0016084 3300047319 Bacteria 6982
249 Ga0495680_0009365 3300047322 Bacteria 8816
250 Ga0495680_0033384 3300047322 Bacteria 4168
251 Ga0495680_0192428 3300047322 Bacteria 1467
252 Ga0495675_0001943 3300047444 Bacteria 12328
253 Ga0495684_0027256 3300047471 Bacteria 4387
254 Ga0495614_0080801 3300048089 Bacteria 1408
255 Ga0496102_0149503 3300048905 Bacteria 2194
256 Ga0496102_0439665 3300048905 Unclassified 1224
257 Ga0496109_0358945 3300048912 Unclassified 1377
258 Ga0496110_1083476 3300048913 Unclassified 709
259 Ga0496114_0026630 3300048917 Bacteria 4736
260 Ga0501290_017545 3300049513 Bacteria 959
261 Ga0501031_0040226 3300049568 Bacteria 3052
262 Ga0501031_0211391 3300049568 Bacteria 1264
263 Ga0501032_0550461 3300049569 Bacteria 736
264 Ga0501033_0437224 3300049570 Bacteria 910
265 Ga0501033_0535947 3300049570 Bacteria 807
266 Ga0501036_0027947 3300049572 Bacteria 4769
267 Ga0501036_0936775 3300049572 Unclassified 710
268 Ga0501038_0002732 3300049574 Bacteria 16442
269 Ga0501038_0324346 3300049574 Bacteria 1204
270 Ga0501039_0004582 3300049575 Bacteria 10448
271 Ga0501039_0183142 3300049575 Bacteria 1647
272 Ga0501039_0953037 3300049575 Unclassified 667
273 Ga0501040_0167493 3300049576 Bacteria 1555
274 Ga0501040_1062951 3300049576 Bacteria 587
275 Ga0501041_0016204 3300049577 Bacteria 4429
276 Ga0501042_0016770 3300049578 Bacteria 5037
277 Ga0501046_0112741 3300049580 Bacteria 2076
278 Ga0501048_0038783 3300049582 Bacteria 3418
279 Ga0501048_0138803 3300049582 Bacteria 1719
280 Ga0501048_0306833 3300049582 Bacteria 1129
281 Ga0501048_0508073 3300049582 Bacteria 864
282 Ga0501068_0034963 3300049584 Bacteria 2999
283 Ga0501068_0540396 3300049584 Bacteria 757
284 Ga0501071_0004083 3300049587 Bacteria 9228
285 Ga0501071_0072415 3300049587 Bacteria 2513
286 Ga0501071_0424916 3300049587 Bacteria 1016
287 Ga0501072_0013326 3300049588 Bacteria 6293
288 Ga0501072_0045043 3300049588 Bacteria 3468
289 Ga0501072_0231928 3300049588 Bacteria 1470
290 Ga0501073_0034116 3300049589 Bacteria 3623
291 Ga0501075_0007246 3300049591 Bacteria 7689
292 Ga0501075_0025759 3300049591 Bacteria 4322
293 Ga0501075_0091747 3300049591 Bacteria 2305
294 Ga0501076_0001824 3300049592 Bacteria 14464
295 Ga0501076_0007792 3300049592 Bacteria 7806
296 Ga0501076_0125237 3300049592 Bacteria 2082
297 Ga0501077_0025159 3300049593 Bacteria 3781
298 Ga0501216_109617 3300049660 Bacteria 618
299 Ga0501229_068307 3300049706 Bacteria 553
300 Ga0501079_0002099 3300049741 Bacteria 14306
301 Ga0501079_0547381 3300049741 Unclassified 910
302 Ga0501080_0004298 3300049742 Bacteria 12649
303 Ga0501080_0198030 3300049742 Bacteria 1845
304 Ga0501080_1794999 3300049742 Bacteria 515
305 Ga0501081_0021197 3300049743 Bacteria 4337
306 Ga0501081_0094932 3300049743 Bacteria 2102
307 Ga0501081_0322133 3300049743 Bacteria 1136
308 Ga0501083_0152680 3300049744 Unclassified 1512
309 Ga0501044_0775861 3300049823 Bacteria 839
310 Ga0501044_1090539 3300049823 Bacteria 668
311 Ga0501045_0001682 3300049824 Bacteria 14887
312 Ga0501045_0168690 3300049824 Bacteria 1630
313 Ga0501045_0827279 3300049824 Bacteria 681
314 nmdc:mga07m45_117709_c1 3300050496 Unclassified 1533
315 nmdc:mga0qj67_1428300_c1 3300050509 Unclassified 533
316 nmdc:mga06r32_288048_c1 3300050510 Bacteria 1629
317 nmdc:mga06r32_37691_c1 3300050510 Bacteria 4573
318 nmdc:mga06r32_812_c1 3300050510 Bacteria 27757
319 nmdc:mga08y16_201246_c1 3300050511 Unclassified 2064
320 nmdc:mga0rr50_504468_c1 3300050513 Bacteria 1029
321 nmdc:mga08x19_109454_c1 3300050514 Bacteria 1842
322 nmdc:mga08x19_232853_c1 3300050514 Unclassified 1268
323 Ga0495601_0000559 3300053077 Bacteria 19741
324 Ga0495601_0193978 3300053077 Bacteria 1327
325 Ga0495601_0262439 3300053077 Unclassified 1127
326 Ga0495601_0471988 3300053077 Unclassified 811
327 Ga0495595_0030494 3300053084 Bacteria 2419
328 Ga0495619_0252283 3300053085 Bacteria 1222
329 Ga0500566_0065726 3300053094 Bacteria 2045
330 Ga0501084_0008717 3300054114 Bacteria 8386
331 Ga0501084_0070915 3300054114 Bacteria 2917
332 Ga0501082_0010973 3300060353 Bacteria 7796
333 Ga0501082_0260523 3300060353 Bacteria 1508
334 Ga0501082_0278144 3300060353 Bacteria 1457
335 Ga0501082_0864470 3300060353 Unclassified 791
336 Ga0530510_0001032 3300061734 Bacteria 18419
337 639788813 639633007 Bacteria 4376040
338 Ga0068855_100141574
339 Ga0058861_11357333
340 Ga0058862_11271760
341 Ga0070670_100080624
342 Ga0068869_100000748
343 Ga0070666_10189437
344 Ga0070689_100134005
345 Ga0070689_101816551
346 Ga0070687_100595969
347 Ga0070669_101375144
348 Ga0070675_100024903
349 Ga0070674_100131805
350 Ga0070659_100113247
351 Ga0070667_101091700
352 Ga0070709_10404080
353 Ga0070710_10039476
354 Ga0070705_100111440
355 Ga0070705_100204312
356 Ga0070700_100256176
357 Ga0070694_100622675
358 Ga0070678_100060614
359 Ga0070681_10035900
360 Ga0068867_100156291
361 Ga0070698_100427600
362 Ga0070698_100534607
363 Ga0070699_100981482
364 Ga0068853_100001374
365 Ga0068853_101054318
366 Ga0070686_100155734
367 Ga0070695_100035059
368 Ga0070696_100484693
369 Ga0070693_100202460
370 Ga0070665_100010415
371 Ga0070704_100003706
372 Ga0070704_100447922
373 Ga0068855_100055617
374 Ga0068857_100034517
375 Ga0068854_100874294
376 Ga0068856_100343836
377 Ga0068856_100605841
378 Ga0070702_100051058
379 Ga0068859_100004039
380 Ga0068864_100063600
381 Ga0068861_100289117
382 Ga0068863_100043046
383 Ga0068858_100026206
384 Ga0068858_100039504
385 Ga0068862_100075876
386 Ga0075365_10458896
387 Ga0070715_10371884
388 Ga0070716_100002115
389 Ga0097621_100041446
390 Ga0075370_10107779
391 Ga0068871_100432303
392 Ga0075430_100140515
393 Ga0075431_100000324
394 Ga0075431_100043332
395 Ga0075431_100125345
396 Ga0075434_101509881
397 Ga0068865_100406725
398 Ga0075436_100026936
399 Ga0075436_100156201
400 Ga0097620_100004039
401 Ga0075435_100189917
402 Ga0099794_10037357
403 Ga0099794_10057924
404 Ga0099794_10285043
405 Ga0099795_10015261
406 Ga0099795_10022052
407 Ga0105240_10092411
408 Ga0111539_10257931
409 Ga0105245_10104933
410 Ga0105243_10439672
411 Ga0105241_10021802
412 Ga0105241_10126964
413 Ga0105242_10042298
414 Ga0105242_11033785
415 Ga0105242_11330280
416 Ga0105248_10001876
417 Ga0105237_10008914
418 Ga0105238_10060911
419 Ga0105238_10195945
420 Ga0099796_10087022
421 Ga0105239_10061863
422 Ga0105239_10168074
423 Ga0105246_10007889
424 Ga0105246_10990813
425 Ga0157369_10885463
426 Ga0157374_10000127
427 Ga0157378_10051407
428 Ga0157378_10716274
429 Ga0157372_10089203
430 Ga0157375_10901408
431 Ga0163163_10053565
432 Ga0163163_10066238
433 Ga0163163_11585292
434 Ga0157380_10096182
435 Ga0157379_10040563
436 Ga0157376_10584026
437 Ga0157376_11918660
438 Ga0207680_10243332
439 Ga0207685_10221524
440 Ga0207654_10004491
441 Ga0207707_10257858
442 Ga0207694_10036929
443 Ga0207659_10038347
444 Ga0207687_10219182
445 Ga0207690_10024182
446 Ga0207686_10149576
447 Ga0207686_10867358
448 Ga0207670_10029654
449 Ga0207669_10049861
450 Ga0207665_10001087
451 Ga0207691_10230037
452 Ga0207711_10014208
453 Ga0207689_10002992
454 Ga0207679_10482577
455 Ga0207667_10070010
456 Ga0207667_10281531
457 Ga0207703_10015001
458 Ga0207703_10040646
459 Ga0207639_10010995
460 Ga0207639_11213559
461 Ga0207708_10224007
462 Ga0207702_10374212
463 Ga0207702_10545353
464 Ga0207641_10041880
465 Ga0207648_10050473
466 Ga0207676_10110209
467 Ga0207674_10030131
468 Ga0207675_100091197
469 Ga0207683_10027436
470 Ga0209179_1004397
471 Ga0209588_1001855
472 Ga0209588_1132685
473 Ga0268266_10055827
474 Ga0268265_10053174
475 Ga0268264_10043062
476 Ga0268264_11558019
477 Ga0265323_10005124
478 Ga0265332_10039960
479 Ga0265325_10017237
480 Ga0265325_10079000
481 Ga0265316_10094425
482 Ga0265316_10120568
483 Ga0265316_10130059
484 Ga0307509_10000018
485 Ga0307416_100524070
486 Ga0316587_1001331
487 Ga0373948_0175152
488 Ga0373934_0000011
489 Ga0373934_0002280
490 Ga0373934_0047340
491 Ga0373923_0005622
492 Ga0373936_0000889
493 Ga0373953_0092774
494 Ga0373953_0147524
495 Ga0373954_0002079
496 Ga0373954_0010175
497 Ga0373956_0000124
498 Ga0373956_0008670
499 Ga0373956_0014877
500 Ga0373956_0205085
501 Ga0373957_0000670
502 Ga0373957_0011545
503 Ga0373943_0016637
504 Ga0373946_0011804
505 Ga0373955_0008840
506 Ga0373955_0076541
507 Ga0373955_0133319
508 Ga0373935_0011893
509 Ga0373927_0031320
510 Ga0373927_0349364
511 Ga0373933_0000331
512 Ga0373933_0014198
513 Ga0373933_0126226
514 Ga0373933_0411808
515 Ga0373933_0975769
516 Ga0373937_0001929
517 Ga0373937_0005477
518 Ga0373937_0805140
519 Ga0373937_0805146
520 Ga0373925_0011254
521 Ga0373925_0121641
522 Ga0395905_0190029
523 Ga0242420_054334
524 Ga0451843_0749695
525 Ga0451577_0000489
526 Ga0451577_0036235
527 Ga0451577_0056873
528 Ga0451577_0060561
529 Ga0453683_0159516
530 Ga0453684_0000014
531 Ga0453684_0000189
532 Ga0453684_0000731
533 Ga0453684_0001597
534 Ga0453684_0002735
535 Ga0453684_0006614
536 Ga0453684_0228279
537 Ga0453684_0796631
538 Ga0451576_0000272
539 Ga0451576_0049679
540 Ga0451576_0126320
541 Ga0495592_0009535
542 Ga0495592_0012190
543 Ga0495592_0084287
544 Ga0495641_0000646
545 Ga0495651_0000570
546 Ga0495651_0001148
547 Ga0495653_0016472
548 Ga0495653_0725629
549 Ga0495580_0026721
550 Ga0495582_0029451
551 Ga0495662_0001966
552 Ga0495664_0015795
553 Ga0495594_0014199
554 Ga0495608_0009175
555 Ga0495618_0006570
556 Ga0495628_0000486
557 Ga0495628_0001568
558 Ga0495630_0003803
559 Ga0495666_0000205
560 Ga0495652_0002564
561 Ga0495652_0150602
562 Ga0495640_0006505
563 Ga0495586_0001179
564 Ga0495586_0060930
565 Ga0495587_0003401
566 Ga0495645_0001457
567 Ga0495622_0037317
568 Ga0495667_0008223
569 Ga0495667_0008352
570 Ga0495667_0335530
571 Ga0495667_0492128
572 Ga0495634_0002521
573 Ga0495635_0101422
574 Ga0495657_0002214
575 Ga0495657_0162256
576 Ga0495599_0000461
577 Ga0495599_0030342
578 Ga0495647_0006528
579 Ga0495658_0012677
580 Ga0495613_0001788
581 Ga0495624_0006034
582 Ga0495600_0000301
583 Ga0495604_0465058
584 Ga0495636_0019790
585 Ga0495674_0016084
586 Ga0495680_0009365
587 Ga0495680_0033384
588 Ga0495680_0192428
589 Ga0495675_0001943
590 Ga0495684_0027256
591 Ga0495614_0080801
592 Ga0496102_0149503
593 Ga0496102_0439665
594 Ga0496109_0358945
595 Ga0496110_1083476
596 Ga0496114_0026630
597 Ga0501290_017545
598 Ga0501031_0040226
599 Ga0501031_0211391
600 Ga0501032_0550461
601 Ga0501033_0437224
602 Ga0501033_0535947
603 Ga0501036_0027947
604 Ga0501036_0936775
605 Ga0501038_0002732
606 Ga0501038_0324346
607 Ga0501039_0004582
608 Ga0501039_0183142
609 Ga0501039_0953037
610 Ga0501040_0167493
611 Ga0501040_1062951
612 Ga0501041_0016204
613 Ga0501042_0016770
614 Ga0501046_0112741
615 Ga0501048_0038783
616 Ga0501048_0138803
617 Ga0501048_0306833
618 Ga0501048_0508073
619 Ga0501068_0034963
620 Ga0501068_0540396
621 Ga0501071_0004083
622 Ga0501071_0072415
623 Ga0501071_0424916
624 Ga0501072_0013326
625 Ga0501072_0045043
626 Ga0501072_0231928
627 Ga0501073_0034116
628 Ga0501075_0007246
629 Ga0501075_0025759
630 Ga0501075_0091747
631 Ga0501076_0001824
632 Ga0501076_0007792
633 Ga0501076_0125237
634 Ga0501077_0025159
635 Ga0501216_109617
636 Ga0501229_068307
637 Ga0501079_0002099
638 Ga0501079_0547381
639 Ga0501080_0004298
640 Ga0501080_0198030
641 Ga0501080_1794999
642 Ga0501081_0021197
643 Ga0501081_0094932
644 Ga0501081_0322133
645 Ga0501083_0152680
646 Ga0501044_0775861
647 Ga0501044_1090539
648 Ga0501045_0001682
649 Ga0501045_0168690
650 Ga0501045_0827279
651 nmdc:mga07m45_117709_c1
652 nmdc:mga0qj67_1428300_c1
653 nmdc:mga06r32_288048_c1
654 nmdc:mga06r32_37691_c1
655 nmdc:mga06r32_812_c1
656 nmdc:mga08y16_201246_c1
657 nmdc:mga0rr50_504468_c1
658 nmdc:mga08x19_109454_c1
659 nmdc:mga08x19_232853_c1
660 Ga0495601_0000559
661 Ga0495601_0193978
662 Ga0495601_0262439
663 Ga0495601_0471988
664 Ga0495595_0030494
665 Ga0495619_0252283
666 Ga0500566_0065726
667 Ga0501084_0008717
668 Ga0501084_0070915
669 Ga0501082_0010973
670 Ga0501082_0260523
671 Ga0501082_0278144
672 Ga0501082_0864470
673 Ga0530510_0001032
674 639788813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

44

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9617 132 163
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9545 78 164
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9501 77 165
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9453 83 165
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9432 78 164
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9453 83 165 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9112 83 165 2.30.30.830
5qj4D00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9038 132 161 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8649 132 163 3.90.79.10
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8573 77 168 2.30.30.830
ID Description Score Start End GO Terms
AF-A0A645H133-F1-model_v4 Uncharacterized protein 0.9743 98 171
AF-A0A2R7TAJ7-F1-model_v4 Pilus assembly protein PilP 0.972 82 168
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.9575 76 168
AF-A0A1B3PKD3-F1-model_v4 Pilus assembly, PilP family protein 0.9575 97 166
AF-A0A2H0NN81-F1-model_v4 Pilus assembly protein PilP 0.9556 91 166

Map