F412987

General Info

Members Datasets Scaffolds Average Seq Length
337 215 332 136

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000068|Ga0070665_100000068138
Length 151
Sequence MDKRPWLLLPSLAGMNLTLSQCFVLVHDPDQALAFYRDTLGLELRNDVAKGEFRWITVGADSQPGVAIVLTNYLNGSPADQDALSALIAKGALNGVHFHSDDLDSTFEKVDASGAEIVQEPTDQPWGTRDFALRDPSGNMIRIDQPPATQS

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
3 2687453737 Frankia sp. BMG5.36 Isolate Nodule
4 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 1.48
Rhizoplane 13.65
Rhizosphere 74.18
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10000011 3300005333 Bacteria 60102
2 Ga0070682_100000028 3300005337 Bacteria 185177
3 Ga0070682_100247186 3300005337 Bacteria 1284
4 Ga0070660_100119418 3300005339 Bacteria 2103
5 Ga0070714_100012544 3300005435 Bacteria 6771
6 Ga0070714_101799179 3300005435 Bacteria 598
7 Ga0070713_100000112 3300005436 Bacteria 53224
8 Ga0070713_100983538 3300005436 Bacteria 814
9 Ga0070710_11126597 3300005437 Bacteria 577
10 Ga0070701_10564472 3300005438 Bacteria 749
11 Ga0070681_10004765 3300005458 Bacteria 12998
12 Ga0068867_100420983 3300005459 Bacteria 1131
13 Ga0070679_100000401 3300005530 Bacteria 36912
14 Ga0068853_100100284 3300005539 Bacteria 2560
15 Ga0070665_100000068 3300005548 Bacteria 204531
16 Ga0068855_101874821 3300005563 Bacteria 608
17 Ga0068854_100037476 3300005578 Bacteria 3404
18 Ga0068856_100008862 3300005614 Bacteria 9790
19 Ga0068856_100145108 3300005614 Bacteria 2381
20 Ga0068866_10041860 3300005718 Bacteria 2276
21 Ga0068861_100270172 3300005719 Bacteria 1460
22 Ga0068858_100000012 3300005842 Bacteria 216931
23 Ga0068858_100000033 3300005842 Bacteria 142748
24 Ga0068858_100000081 3300005842 Bacteria 100314
25 Ga0081455_10026544 3300005937 Bacteria 5323
26 Ga0081540_1009793 3300005983 Bacteria 6559
27 Ga0075365_10301513 3300006038 Bacteria 1128
28 Ga0075368_10014845 3300006042 Bacteria 2882
29 Ga0075363_100006935 3300006048 Bacteria 5179
30 Ga0075363_100100753 3300006048 Bacteria 1598
31 Ga0075364_10006562 3300006051 Bacteria 6845
32 Ga0075364_10030834 3300006051 Bacteria 3443
33 Ga0075364_10707260 3300006051 Bacteria 687
34 Ga0070712_100000006 3300006175 Bacteria 161357
35 Ga0075362_10013392 3300006177 Bacteria 3284
36 Ga0075367_10002919 3300006178 Bacteria 7971
37 Ga0075367_10021589 3300006178 Bacteria 3600
38 Ga0075370_10003859 3300006353 Bacteria 7179
39 Ga0075370_10006366 3300006353 Bacteria 5929
40 Ga0075370_10582177 3300006353 Bacteria 678
41 Ga0068871_100364209 3300006358 Bacteria 1281
42 Ga0075428_102096782 3300006844 Bacteria 585
43 Ga0068865_100000017 3300006881 Bacteria 109636
44 Ga0075435_100618344 3300007076 Bacteria 940
45 Ga0099794_10371308 3300007265 Bacteria 745
46 Ga0105240_10328139 3300009093 Bacteria 1742
47 Ga0105245_10000161 3300009098 Bacteria 63378
48 Ga0105245_10000295 3300009098 Bacteria 47700
49 Ga0105247_10000105 3300009101 Bacteria 87578
50 Ga0105247_11167969 3300009101 Bacteria 611
51 Ga0105241_10810945 3300009174 Bacteria 863
52 Ga0105242_10001190 3300009176 Bacteria 20519
53 Ga0105242_10003454 3300009176 Bacteria 12286
54 Ga0105242_12410761 3300009176 Bacteria 574
55 Ga0105248_10000028 3300009177 Bacteria 225683
56 Ga0105248_10000941 3300009177 Bacteria 32417
57 Ga0105248_12267115 3300009177 Bacteria 618
58 Ga0105249_10000165 3300009553 Bacteria 77694
59 Ga0157370_10004853 3300013104 Bacteria 15271
60 Ga0157370_10195774 3300013104 Bacteria 1876
61 Ga0157374_10030619 3300013296 Bacteria 4888
62 Ga0157374_10142188 3300013296 Bacteria 2330
63 Ga0157378_10045623 3300013297 Bacteria 3895
64 Ga0157378_11705251 3300013297 Bacteria 677
65 Ga0157375_10002684 3300013308 Bacteria 15420
66 Ga0157375_10498308 3300013308 Bacteria 1382
67 Ga0157375_12206974 3300013308 Bacteria 656
68 Ga0163163_10003439 3300014325 Bacteria 13453
69 Ga0157380_10000028 3300014326 Bacteria 99836
70 Ga0157377_10329536 3300014745 Bacteria 1017
71 Ga0157379_10000042 3300014968 Bacteria 77721
72 Ga0157379_10026743 3300014968 Bacteria 5136
73 Ga0157379_10341125 3300014968 Bacteria 1370
74 Ga0157376_12073847 3300014969 Bacteria 607
75 Ga0207682_10000159 3300025893 Bacteria 30618
76 Ga0207710_10009817 3300025900 Bacteria 4023
77 Ga0207707_10017049 3300025912 Bacteria 6328
78 Ga0207695_10401910 3300025913 Bacteria 1254
79 Ga0207693_10001638 3300025915 Bacteria 19774
80 Ga0207663_10280078 3300025916 Bacteria 1238
81 Ga0207652_10000577 3300025921 Bacteria 36887
82 Ga0207687_10000026 3300025927 Bacteria 173968
83 Ga0207687_10000578 3300025927 Bacteria 24764
84 Ga0207700_10000008 3300025928 Bacteria 341717
85 Ga0207664_10000210 3300025929 Bacteria 44375
86 Ga0207664_10401521 3300025929 Bacteria 1219
87 Ga0207690_10006070 3300025932 Bacteria 7157
88 Ga0207686_10000032 3300025934 Bacteria 150341
89 Ga0207686_10056488 3300025934 Bacteria 2468
90 Ga0207686_10593688 3300025934 Bacteria 871
91 Ga0207709_10550590 3300025935 Bacteria 907
92 Ga0207704_10000025 3300025938 Bacteria 135523
93 Ga0207704_10764444 3300025938 Bacteria 805
94 Ga0207711_10000132 3300025941 Bacteria 78834
95 Ga0207711_10000304 3300025941 Bacteria 52792
96 Ga0207711_11258326 3300025941 Bacteria 682
97 Ga0207661_10003103 3300025944 Bacteria 11507
98 Ga0207712_10000037 3300025961 Bacteria 195906
99 Ga0207640_10009188 3300025981 Bacteria 5524
100 Ga0207658_10312235 3300025986 Bacteria 1358
101 Ga0207703_10000089 3300026035 Bacteria 105959
102 Ga0207703_10000091 3300026035 Bacteria 105608
103 Ga0207703_10000126 3300026035 Bacteria 91860
104 Ga0207639_10001697 3300026041 Bacteria 14869
105 Ga0207678_10298389 3300026067 Bacteria 1384
106 Ga0207702_10006884 3300026078 Bacteria 9743
107 Ga0207702_10116026 3300026078 Bacteria 2389
108 Ga0207674_10035565 3300026116 Bacteria 5198
109 Ga0207675_100316906 3300026118 Bacteria 1522
110 Ga0207698_10808702 3300026142 Bacteria 940
111 Ga0209813_10030071 3300027866 Bacteria 1594
112 Ga0268266_10000020 3300028379 Bacteria 527065
113 Ga0265337_1000012 3300028556 Bacteria 85395
114 Ga0265326_10001927 3300028558 Bacteria 7096
115 Ga0265319_1000028 3300028563 Bacteria 135557
116 Ga0265334_10271815 3300028573 Bacteria 582
117 Ga0265322_10000001 3300028654 Bacteria 543854
118 Ga0265336_10006074 3300028666 Bacteria 4385
119 Ga0265338_10001943 3300028800 Bacteria 32266
120 Ga0265338_10003038 3300028800 Bacteria 24155
121 Ga0265338_10004524 3300028800 Bacteria 18741
122 Ga0265324_10002100 3300029957 Bacteria 10531
123 Ga0265332_10106958 3300031238 Bacteria 1179
124 Ga0265328_10000659 3300031239 Bacteria 16018
125 Ga0265320_10000002 3300031240 Bacteria 542875
126 Ga0265329_10012150 3300031242 Bacteria 3106
127 Ga0265339_10183898 3300031249 Bacteria 1039
128 Ga0265331_10000919 3300031250 Bacteria 23588
129 Ga0265327_10000011 3300031251 Bacteria 543807
130 Ga0265327_10022380 3300031251 Bacteria 3781
131 Ga0265327_10044859 3300031251 Bacteria 2354
132 Ga0265316_10107407 3300031344 Bacteria 2116
133 Ga0265316_10830647 3300031344 Bacteria 647
134 Ga0265313_10199185 3300031595 Bacteria 834
135 Ga0265313_10289056 3300031595 Bacteria 661
136 Ga0316579_10615820 3300031691 Bacteria 526
137 Ga0265314_10000224 3300031711 Bacteria 84325
138 Ga0265342_10153288 3300031712 Bacteria 1278
139 Ga0373953_0168268 3300035117 Bacteria 943
140 Ga0373956_0317647 3300035119 Bacteria 742
141 Ga0373947_0793144 3300035725 Bacteria 647
142 Ga0373937_0340649 3300036401 Bacteria 1420
143 Ga0436364_0647765 3300037853 Bacteria 2212
144 Ga0451800_0314821 3300041459 Bacteria 852
145 Ga0451807_1812733 3300041486 Bacteria 1059
146 Ga0451807_2046680 3300041486 Bacteria 629
147 Ga0451833_0204672 3300041491 Bacteria 841
148 Ga0451849_0174761 3300041505 Bacteria 861
149 Ga0466966_0218843 3300044684 Unclassified 1150
150 Ga0466966_0225172 3300044684 Bacteria 1132
151 Ga0466966_0287301 3300044684 Bacteria 989
152 Ga0466961_0162678 3300044693 Bacteria 1391
153 Ga0466963_0000025 3300044694 Bacteria 51171
154 Ga0466963_0113015 3300044694 Bacteria 1865
155 Ga0466971_0209398 3300044719 Bacteria 922
156 Ga0466970_0886166 3300044765 Bacteria 524
157 Ga0466957_0058393 3300044842 Bacteria 2364
158 Ga0466957_0435446 3300044842 Bacteria 901
159 Ga0466959_0046404 3300045049 Bacteria 3197
160 Ga0466959_0094988 3300045049 Bacteria 2138
161 Ga0466958_0114070 3300045836 Bacteria 1688
162 Ga0466958_0549466 3300045836 Bacteria 750
163 Ga0466967_0000045 3300045976 Bacteria 45085
164 Ga0466967_1648235 3300045976 Bacteria 639
165 Ga0466967_1750981 3300045976 Bacteria 619
166 Ga0495590_0186293 3300046457 Bacteria 760
167 Ga0495629_0003346 3300046459 Bacteria 12111
168 Ga0495651_0174799 3300046462 Bacteria 1526
169 Ga0495653_0127657 3300046463 Bacteria 1804
170 Ga0495653_0188600 3300046463 Bacteria 1409
171 Ga0495639_0554968 3300046475 Bacteria 589
172 Ga0495662_0001984 3300046476 Bacteria 10266
173 Ga0495584_0308913 3300046491 Bacteria 803
174 Ga0495596_0030296 3300046500 Bacteria 2167
175 Ga0495608_0000056 3300046511 Bacteria 91026
176 Ga0495616_0437352 3300046513 Bacteria 532
177 Ga0495618_0277562 3300046514 Bacteria 1046
178 Ga0495618_0421982 3300046514 Bacteria 813
179 Ga0495628_0001941 3300046516 Bacteria 18745
180 Ga0495628_0019228 3300046516 Bacteria 5649
181 Ga0495630_0049794 3300046517 Bacteria 3135
182 Ga0495630_0141665 3300046517 Bacteria 1828
183 Ga0495630_0321654 3300046517 Bacteria 1183
184 Ga0495642_0164128 3300046528 Bacteria 964
185 Ga0495652_0231740 3300046529 Bacteria 1381
186 Ga0495652_0267477 3300046529 Bacteria 1258
187 Ga0495640_0127080 3300046533 Bacteria 1652
188 Ga0495640_0673090 3300046533 Bacteria 622
189 Ga0495586_0001701 3300046535 Bacteria 12041
190 Ga0495586_0086854 3300046535 Bacteria 1724
191 Ga0495587_0053342 3300046536 Bacteria 2384
192 Ga0495621_0478886 3300046539 Bacteria 535
193 Ga0495645_0049534 3300046543 Bacteria 3059
194 Ga0495645_0336946 3300046543 Bacteria 975
195 Ga0495656_0000342 3300046615 Bacteria 15822
196 Ga0495656_0644995 3300046615 Bacteria 568
197 Ga0495634_0000212 3300046642 Bacteria 53864
198 Ga0495625_0620611 3300046660 Bacteria 647
199 Ga0495635_0059883 3300046663 Bacteria 2618
200 Ga0495657_0000023 3300046675 Bacteria 145522
201 Ga0495646_0080527 3300046680 Bacteria 1899
202 Ga0495646_0114096 3300046680 Bacteria 1535
203 Ga0495658_0246809 3300046683 Bacteria 1122
204 Ga0495669_0000130 3300046684 Bacteria 48500
205 Ga0495624_0082596 3300046690 Bacteria 1988
206 Ga0495649_0006497 3300046694 Bacteria 7276
207 Ga0495649_0334659 3300046694 Bacteria 767
208 Ga0495589_0045398 3300046794 Bacteria 2183
209 Ga0495604_0000806 3300047317 Bacteria 26348
210 Ga0495604_0001326 3300047317 Bacteria 20202
211 Ga0495604_0064803 3300047317 Bacteria 2783
212 Ga0495604_0165826 3300047317 Bacteria 1557
213 Ga0495674_0094370 3300047319 Bacteria 2552
214 Ga0495676_0000283 3300047321 Bacteria 40939
215 Ga0495676_0005012 3300047321 Bacteria 12147
216 Ga0495680_0004998 3300047322 Bacteria 12542
217 Ga0495680_0179360 3300047322 Bacteria 1529
218 Ga0495683_0363796 3300047323 Bacteria 608
219 Ga0495675_0000039 3300047444 Bacteria 91025
220 Ga0495675_0368947 3300047444 Bacteria 841
221 Ga0495679_033422 3300047446 Bacteria 1643
222 Ga0495602_0000032 3300048088 Bacteria 141185
223 Ga0495602_0172400 3300048088 Bacteria 1678
224 Ga0496100_0000007 3300048903 Bacteria 261266
225 Ga0496100_0000049 3300048903 Bacteria 75590
226 Ga0496100_0054174 3300048903 Bacteria 2615
227 Ga0496101_0000010 3300048904 Bacteria 281990
228 Ga0496101_0000013 3300048904 Bacteria 261266
229 Ga0496101_0152146 3300048904 Bacteria 1770
230 Ga0496102_0000546 3300048905 Bacteria 40572
231 Ga0496102_0229478 3300048905 Bacteria 1750
232 Ga0496102_0509536 3300048905 Bacteria 1126
233 Ga0496102_1096491 3300048905 Bacteria 716
234 Ga0496102_1576306 3300048905 Bacteria 575
235 Ga0496103_0000368 3300048906 Bacteria 40572
236 Ga0496104_0000001 3300048907 Bacteria 711867
237 Ga0496104_0000002 3300048907 Bacteria 686017
238 Ga0496104_0000013 3300048907 Bacteria 397163
239 Ga0496104_0011315 3300048907 Bacteria 7987
240 Ga0496104_0176165 3300048907 Bacteria 2049
241 Ga0496105_0000001 3300048908 Bacteria 1328178
242 Ga0496105_0000006 3300048908 Bacteria 393578
243 Ga0496106_0000006 3300048909 Bacteria 251855
244 Ga0496106_0000018 3300048909 Bacteria 175028
245 Ga0496106_0029190 3300048909 Bacteria 4109
246 Ga0496107_0000007 3300048910 Bacteria 257113
247 Ga0496107_0000032 3300048910 Bacteria 99848
248 Ga0496107_0021611 3300048910 Bacteria 4548
249 Ga0496108_0000001 3300048911 Bacteria 919044
250 Ga0496108_0178984 3300048911 Bacteria 1836
251 Ga0496109_0000006 3300048912 Bacteria 325513
252 Ga0496109_0183293 3300048912 Bacteria 1967
253 Ga0496109_0917274 3300048912 Bacteria 814
254 Ga0496110_0001924 3300048913 Bacteria 15367
255 Ga0496110_0159058 3300048913 Bacteria 2047
256 Ga0496111_0112129 3300048914 Bacteria 2009
257 Ga0496112_0000258 3300048915 Bacteria 33904
258 Ga0496113_0000009 3300048916 Bacteria 88223
259 Ga0496113_0206626 3300048916 Bacteria 1562
260 Ga0496114_0000003 3300048917 Bacteria 630981
261 Ga0496114_0002643 3300048917 Bacteria 13674
262 Ga0496114_0135894 3300048917 Bacteria 2126
263 Ga0496114_0466028 3300048917 Bacteria 1118
264 Ga0496115_0000036 3300048918 Bacteria 127774
265 Ga0496115_0013647 3300048918 Bacteria 6148
266 Ga0496115_0387933 3300048918 Bacteria 1135
267 Ga0496117_0016112 3300048920 Bacteria 6325
268 Ga0496118_0005870 3300048921 Bacteria 13757
269 Ga0496119_0021835 3300048922 Bacteria 4607
270 Ga0496120_0101123 3300048923 Bacteria 1523
271 Ga0496121_0005287 3300048924 Bacteria 16629
272 Ga0501032_0217831 3300049569 Bacteria 1243
273 Ga0501038_0443858 3300049574 Bacteria 999
274 Ga0501039_0486753 3300049575 Bacteria 969
275 Ga0501040_0367615 3300049576 Bacteria 1031
276 Ga0501041_0119458 3300049577 Bacteria 1638
277 Ga0501042_0038053 3300049578 Bacteria 3416
278 Ga0501046_0079841 3300049580 Bacteria 2529
279 Ga0501047_0032687 3300049581 Bacteria 5024
280 Ga0501067_0248111 3300049583 Bacteria 991
281 Ga0501068_0147183 3300049584 Bacteria 1479
282 Ga0501069_0144240 3300049585 Bacteria 1367
283 Ga0501070_0027078 3300049586 Bacteria 4809
284 Ga0501070_0030677 3300049586 Bacteria 4504
285 Ga0501070_0274775 3300049586 Bacteria 1375
286 Ga0501070_0275938 3300049586 Bacteria 1372
287 Ga0501071_0236128 3300049587 Bacteria 1378
288 Ga0501073_0203351 3300049589 Bacteria 1369
289 Ga0501073_0787165 3300049589 Bacteria 656
290 Ga0501074_0002038 3300049590 Bacteria 13944
291 Ga0501074_0005646 3300049590 Bacteria 9013
292 Ga0501074_0363731 3300049590 Bacteria 1026
293 Ga0501074_1191174 3300049590 Bacteria 534
294 Ga0501075_0380013 3300049591 Bacteria 1077
295 Ga0501076_0370518 3300049592 Bacteria 1177
296 Ga0501079_0333373 3300049741 Bacteria 1188
297 Ga0501080_0024118 3300049742 Bacteria 5639
298 Ga0501080_0039062 3300049742 Bacteria 4429
299 Ga0501080_0937798 3300049742 Bacteria 753
300 Ga0501045_0179982 3300049824 Bacteria 1575
301 Ga0501045_0420872 3300049824 Bacteria 994
302 Ga0501045_0910612 3300049824 Bacteria 646
303 nmdc:mga03683_10666_c2 3300050489 Bacteria 2190
304 nmdc:mga00v17_10171_c1 3300050491 Bacteria 5127
305 nmdc:mga00v17_98604_c1 3300050491 Bacteria 1843
306 nmdc:mga0yw44_32919_c1 3300050492 Bacteria 3024
307 nmdc:mga0yw44_468470_c1 3300050492 Bacteria 854
308 nmdc:mga0yw44_523218_c1 3300050492 Bacteria 805
309 nmdc:mga06z11_35263_c1 3300050494 Bacteria 2461
310 nmdc:mga06z11_7947_c1 3300050494 Bacteria 4393
311 nmdc:mga06z11_8550_c1 3300050494 Bacteria 4279
312 nmdc:mga04h51_1078_c1 3300050495 Bacteria 6293
313 nmdc:mga07m45_12848_c1 3300050496 Bacteria 4430
314 nmdc:mga07m45_30734_c1 3300050496 Bacteria 2976
315 nmdc:mga0rr50_415363_c1 3300050513 Bacteria 1138
316 Ga0495601_0000260 3300053077 Bacteria 28505
317 Ga0495601_0014155 3300053077 Bacteria 4806
318 Ga0495601_0031420 3300053077 Bacteria 3300
319 Ga0495655_0000004 3300053083 Bacteria 293683
320 Ga0495655_0328003 3300053083 Bacteria 531
321 Ga0495595_0000029 3300053084 Bacteria 91026
322 Ga0495595_0019170 3300053084 Bacteria 2966
323 Ga0495619_0000029 3300053085 Bacteria 158166
324 Ga0495619_0000075 3300053085 Bacteria 76341
325 Ga0495619_0001065 3300053085 Bacteria 18004
326 Ga0495619_0038401 3300053085 Bacteria 3123
327 Ga0495619_0429172 3300053085 Bacteria 912
328 Ga0500566_0001322 3300053094 Bacteria 14466
329 Ga0500628_000049 3300053129 Bacteria 41425
330 Ga0501084_0112273 3300054114 Bacteria 2290
331 Ga0501084_0559061 3300054114 Bacteria 967
332 Ga0530510_0343456 3300061734 Bacteria 1121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100100284 Ga0068853_1001002842 108
2 3300005614 Ga0068856_100008862 Ga0068856_1000088628 108
3 3300026041 Ga0207639_10001697 Ga0207639_100016977 108
4 3300026078 Ga0207702_10006884 Ga0207702_100068846 108
5 3300049587 Ga0501071_0236128 Ga0501071_0236128_149_544 128
6 3300025929 Ga0207664_10401521 Ga0207664_104015214 129
7 3300006038 Ga0075365_10301513 Ga0075365_103015131 131
8 3300006042 Ga0075368_10014845 Ga0075368_100148453 131
9 3300006048 Ga0075363_100006935 Ga0075363_1000069357 131
10 3300006048 Ga0075363_100100753 Ga0075363_1001007533 131
11 3300006051 Ga0075364_10006562 Ga0075364_100065625 131
12 3300006051 Ga0075364_10030834 Ga0075364_100308346 131
13 3300006177 Ga0075362_10013392 Ga0075362_100133923 131
14 3300006178 Ga0075367_10002919 Ga0075367_100029196 131
15 3300006178 Ga0075367_10021589 Ga0075367_100215892 131
16 3300006353 Ga0075370_10003859 Ga0075370_100038597 131
17 3300006353 Ga0075370_10006366 Ga0075370_100063668 131
18 3300026116 Ga0207674_10035565 Ga0207674_100355652 131
19 3300027866 Ga0209813_10030071 Ga0209813_100300713 131
20 3300041486 Ga0451807_2046680 Ga0451807_2046680_145_555 131
21 3300049576 Ga0501040_0367615 Ga0501040_0367615_460_870 131
22 3300049577 Ga0501041_0119458 Ga0501041_0119458_395_805 131
23 3300049583 Ga0501067_0248111 Ga0501067_0248111_330_740 131
24 3300049585 Ga0501069_0144240 Ga0501069_0144240_906_1316 131
25 3300049586 Ga0501070_0274775 Ga0501070_0274775_242_661 131
26 3300049589 Ga0501073_0787165 Ga0501073_0787165_108_518 131
27 3300049590 Ga0501074_0363731 Ga0501074_0363731_461_871 131
28 3300049591 Ga0501075_0380013 Ga0501075_0380013_239_649 131
29 3300049741 Ga0501079_0333373 Ga0501079_0333373_590_1000 131
30 3300049742 Ga0501080_0937798 Ga0501080_0937798_53_463 131
31 3300049824 Ga0501045_0420872 Ga0501045_0420872_460_870 131
32 3300050489 nmdc:mga03683_10666_c2 nmdc:mga03683_10666_c2_1158_1568 131
33 3300050491 nmdc:mga00v17_10171_c1 nmdc:mga00v17_10171_c1_4405_4815 131
34 3300050491 nmdc:mga00v17_98604_c1 nmdc:mga00v17_98604_c1_220_630 131
35 3300050492 nmdc:mga0yw44_32919_c1 nmdc:mga0yw44_32919_c1_955_1365 131
36 3300050492 nmdc:mga0yw44_468470_c1 nmdc:mga0yw44_468470_c1_183_593 131
37 3300050492 nmdc:mga0yw44_523218_c1 nmdc:mga0yw44_523218_c1_166_576 131
38 3300050494 nmdc:mga06z11_35263_c1 nmdc:mga06z11_35263_c1_1340_1750 131
39 3300050494 nmdc:mga06z11_7947_c1 nmdc:mga06z11_7947_c1_3301_3720 131
40 3300050494 nmdc:mga06z11_8550_c1 nmdc:mga06z11_8550_c1_2610_3020 131
41 3300050495 nmdc:mga04h51_1078_c1 nmdc:mga04h51_1078_c1_1250_1660 131
42 3300050496 nmdc:mga07m45_12848_c1 nmdc:mga07m45_12848_c1_958_1368 131
43 3300050496 nmdc:mga07m45_30734_c1 nmdc:mga07m45_30734_c1_1558_1968 131
44 3300006051 Ga0075364_10707260 Ga0075364_107072602 132
45 3300044684 Ga0466966_0225172 Ga0466966_0225172_138_536 132
46 3300044765 Ga0466970_0886166 Ga0466970_0886166_116_514 132
47 3300045049 Ga0466959_0046404 Ga0466959_0046404_2418_2816 132
48 iso_pu_bacteria 2508501039 2508675579 132
49 iso_pu_bacteria 2675902999 2676199988 132
50 iso_pu_bacteria 2687453737 2689962637 132
51 iso_pu_bacteria 2773857921 2774844566 132
52 iso_pu_bacteria 8002775197 8002781688 132
53 3300044693 Ga0466961_0162678 Ga0466961_0162678_664_1065 133
54 3300049586 Ga0501070_0030677 Ga0501070_0030677_1425_1826 133
55 3300049589 Ga0501073_0203351 Ga0501073_0203351_103_504 133
56 3300049590 Ga0501074_0002038 Ga0501074_0002038_1802_2203 133
57 3300049742 Ga0501080_0024118 Ga0501080_0024118_362_763 133
58 3300049742 Ga0501080_0039062 Ga0501080_0039062_1464_1865 133
59 3300005337 Ga0070682_100247186 Ga0070682_1002471863 134
60 3300005339 Ga0070660_100119418 Ga0070660_1001194183 134
61 3300005435 Ga0070714_101799179 Ga0070714_1017991791 134
62 3300005436 Ga0070713_100000112 Ga0070713_10000011253 134
63 3300005436 Ga0070713_100983538 Ga0070713_1009835382 134
64 3300005437 Ga0070710_11126597 Ga0070710_111265972 134
65 3300005458 Ga0070681_10004765 Ga0070681_1000476514 134
66 3300005459 Ga0068867_100420983 Ga0068867_1004209832 134
67 3300005530 Ga0070679_100000401 Ga0070679_10000040138 134
68 3300005563 Ga0068855_101874821 Ga0068855_1018748212 134
69 3300005719 Ga0068861_100270172 Ga0068861_1002701722 134
70 3300006353 Ga0075370_10582177 Ga0075370_105821772 134
71 3300006358 Ga0068871_100364209 Ga0068871_1003642093 134
72 3300006881 Ga0068865_100000017 Ga0068865_10000001724 134
73 3300007265 Ga0099794_10371308 Ga0099794_103713082 134
74 3300009093 Ga0105240_10328139 Ga0105240_103281393 134
75 3300009101 Ga0105247_11167969 Ga0105247_111679691 134
76 3300009176 Ga0105242_10001190 Ga0105242_100011906 134
77 3300013104 Ga0157370_10195774 Ga0157370_101957742 134
78 3300013296 Ga0157374_10030619 Ga0157374_100306194 134
79 3300013296 Ga0157374_10142188 Ga0157374_101421883 134
80 3300013308 Ga0157375_10002684 Ga0157375_100026843 134
81 3300014745 Ga0157377_10329536 Ga0157377_103295361 134
82 3300025912 Ga0207707_10017049 Ga0207707_100170492 134
83 3300025913 Ga0207695_10401910 Ga0207695_104019103 134
84 3300025921 Ga0207652_10000577 Ga0207652_100005772 134
85 3300025928 Ga0207700_10000008 Ga0207700_10000008235 134
86 3300025932 Ga0207690_10006070 Ga0207690_100060706 134
87 3300025934 Ga0207686_10000032 Ga0207686_1000003274 134
88 3300025938 Ga0207704_10000025 Ga0207704_1000002515 134
89 3300026118 Ga0207675_100316906 Ga0207675_1003169063 134
90 3300026142 Ga0207698_10808702 Ga0207698_108087022 134
91 3300028573 Ga0265334_10271815 Ga0265334_102718151 134
92 3300031691 Ga0316579_10615820 Ga0316579_106158201 134
93 3300041491 Ga0451833_0204672 Ga0451833_0204672_72_476 134
94 3300044842 Ga0466957_0435446 Ga0466957_0435446_237_641 134
95 3300045836 Ga0466958_0549466 Ga0466958_0549466_280_684 134
96 3300045976 Ga0466967_0000045 Ga0466967_0000045_7733_8137 134
97 3300045976 Ga0466967_1648235 Ga0466967_1648235_47_451 134
98 3300045976 Ga0466967_1750981 Ga0466967_1750981_165_572 134
99 3300046459 Ga0495629_0003346 Ga0495629_0003346_7691_8095 134
100 3300046511 Ga0495608_0000056 Ga0495608_0000056_17427_17831 134
101 3300046533 Ga0495640_0673090 Ga0495640_0673090_74_478 134
102 3300046675 Ga0495657_0000023 Ga0495657_0000023_73196_73600 134
103 3300046694 Ga0495649_0006497 Ga0495649_0006497_1488_1892 134
104 3300047317 Ga0495604_0001326 Ga0495604_0001326_14463_14867 134
105 3300047444 Ga0495675_0000039 Ga0495675_0000039_17426_17830 134
106 3300048088 Ga0495602_0000032 Ga0495602_0000032_51370_51774 134
107 3300048088 Ga0495602_0172400 Ga0495602_0172400_1165_1569 134
108 3300048903 Ga0496100_0000049 Ga0496100_0000049_29831_30235 134
109 3300048904 Ga0496101_0000010 Ga0496101_0000010_70325_70729 134
110 3300048905 Ga0496102_0000546 Ga0496102_0000546_32655_33059 134
111 3300048906 Ga0496103_0000368 Ga0496103_0000368_7514_7918 134
112 3300048907 Ga0496104_0176165 Ga0496104_0176165_981_1385 134
113 3300048909 Ga0496106_0000018 Ga0496106_0000018_2550_2954 134
114 3300048910 Ga0496107_0000032 Ga0496107_0000032_29168_29572 134
115 3300048915 Ga0496112_0000258 Ga0496112_0000258_6787_7191 134
116 3300048916 Ga0496113_0000009 Ga0496113_0000009_28094_28498 134
117 3300048916 Ga0496113_0206626 Ga0496113_0206626_326_730 134
118 3300048917 Ga0496114_0002643 Ga0496114_0002643_1526_1930 134
119 3300049575 Ga0501039_0486753 Ga0501039_0486753_302_721 134
120 3300049592 Ga0501076_0370518 Ga0501076_0370518_194_613 134
121 3300049824 Ga0501045_0910612 Ga0501045_0910612_20_439 134
122 3300053083 Ga0495655_0000004 Ga0495655_0000004_11205_11609 134
123 3300053084 Ga0495595_0000029 Ga0495595_0000029_17427_17831 134
124 3300053084 Ga0495595_0019170 Ga0495595_0019170_161_565 134
125 3300053085 Ga0495619_0000029 Ga0495619_0000029_85848_86252 134
126 3300053085 Ga0495619_0000075 Ga0495619_0000075_41195_41599 134
127 3300053085 Ga0495619_0429172 Ga0495619_0429172_267_671 134
128 3300053094 Ga0500566_0001322 Ga0500566_0001322_7778_8182 134
129 3300053129 Ga0500628_000049 Ga0500628_000049_11145_11549 134
130 3300005337 Ga0070682_100000028 Ga0070682_100000028126 135
131 3300005438 Ga0070701_10564472 Ga0070701_105644722 135
132 3300005614 Ga0068856_100145108 Ga0068856_1001451083 135
133 3300005718 Ga0068866_10041860 Ga0068866_100418603 135
134 3300005842 Ga0068858_100000033 Ga0068858_10000003380 135
135 3300005937 Ga0081455_10026544 Ga0081455_100265441 135
136 3300006175 Ga0070712_100000006 Ga0070712_10000000612 135
137 3300006844 Ga0075428_102096782 Ga0075428_1020967821 135
138 3300007076 Ga0075435_100618344 Ga0075435_1006183442 135
139 3300009101 Ga0105247_10000105 Ga0105247_1000010516 135
140 3300009174 Ga0105241_10810945 Ga0105241_108109452 135
141 3300009176 Ga0105242_12410761 Ga0105242_124107611 135
142 3300013104 Ga0157370_10004853 Ga0157370_1000485312 135
143 3300013297 Ga0157378_10045623 Ga0157378_100456232 135
144 3300013308 Ga0157375_10498308 Ga0157375_104983082 135
145 3300013308 Ga0157375_12206974 Ga0157375_122069742 135
146 3300014326 Ga0157380_10000028 Ga0157380_1000002848 135
147 3300014968 Ga0157379_10341125 Ga0157379_103411253 135
148 3300014969 Ga0157376_12073847 Ga0157376_120738471 135
149 3300025900 Ga0207710_10009817 Ga0207710_100098174 135
150 3300025915 Ga0207693_10001638 Ga0207693_1000163812 135
151 3300025934 Ga0207686_10593688 Ga0207686_105936882 135
152 3300025935 Ga0207709_10550590 Ga0207709_105505902 135
153 3300025938 Ga0207704_10764444 Ga0207704_107644442 135
154 3300025986 Ga0207658_10312235 Ga0207658_103122352 135
155 3300026035 Ga0207703_10000126 Ga0207703_1000012615 135
156 3300026067 Ga0207678_10298389 Ga0207678_102983893 135
157 3300026078 Ga0207702_10116026 Ga0207702_101160263 135
158 3300028556 Ga0265337_1000012 Ga0265337_100001258 135
159 3300028558 Ga0265326_10001927 Ga0265326_100019272 135
160 3300028654 Ga0265322_10000001 Ga0265322_1000000167 135
161 3300028666 Ga0265336_10006074 Ga0265336_100060743 135
162 3300028800 Ga0265338_10001943 Ga0265338_1000194322 135
163 3300029957 Ga0265324_10002100 Ga0265324_100021004 135
164 3300031238 Ga0265332_10106958 Ga0265332_101069582 135
165 3300031239 Ga0265328_10000659 Ga0265328_100006597 135
166 3300031240 Ga0265320_10000002 Ga0265320_1000000267 135
167 3300031242 Ga0265329_10012150 Ga0265329_100121502 135
168 3300031249 Ga0265339_10183898 Ga0265339_101838982 135
169 3300031250 Ga0265331_10000919 Ga0265331_1000091914 135
170 3300031251 Ga0265327_10000011 Ga0265327_1000001167 135
171 3300031251 Ga0265327_10022380 Ga0265327_100223801 135
172 3300031251 Ga0265327_10044859 Ga0265327_100448594 135
173 3300031344 Ga0265316_10107407 Ga0265316_101074072 135
174 3300031595 Ga0265313_10289056 Ga0265313_102890561 135
175 3300031711 Ga0265314_10000224 Ga0265314_1000022427 135
176 3300035119 Ga0373956_0317647 Ga0373956_0317647_25_432 135
177 3300035725 Ga0373947_0793144 Ga0373947_0793144_61_468 135
178 3300036401 Ga0373937_0340649 Ga0373937_0340649_34_441 135
179 3300037853 Ga0436364_0647765 Ga0436364_0647765_61_468 135
180 3300041459 Ga0451800_0314821 Ga0451800_0314821_132_539 135
181 3300041486 Ga0451807_1812733 Ga0451807_1812733_58_465 135
182 3300041505 Ga0451849_0174761 Ga0451849_0174761_85_492 135
183 3300044684 Ga0466966_0218843 Ga0466966_0218843_174_581 135
184 3300044694 Ga0466963_0000025 Ga0466963_0000025_41473_41880 135
185 3300046457 Ga0495590_0186293 Ga0495590_0186293_212_619 135
186 3300046463 Ga0495653_0188600 Ga0495653_0188600_65_472 135
187 3300046476 Ga0495662_0001984 Ga0495662_0001984_6470_6877 135
188 3300046491 Ga0495584_0308913 Ga0495584_0308913_345_752 135
189 3300046500 Ga0495596_0030296 Ga0495596_0030296_69_476 135
190 3300046513 Ga0495616_0437352 Ga0495616_0437352_35_442 135
191 3300046514 Ga0495618_0277562 Ga0495618_0277562_379_786 135
192 3300046516 Ga0495628_0001941 Ga0495628_0001941_2137_2544 135
193 3300046528 Ga0495642_0164128 Ga0495642_0164128_538_945 135
194 3300046529 Ga0495652_0267477 Ga0495652_0267477_436_843 135
195 3300046535 Ga0495586_0001701 Ga0495586_0001701_6606_7013 135
196 3300046536 Ga0495587_0053342 Ga0495587_0053342_1685_2092 135
197 3300046539 Ga0495621_0478886 Ga0495621_0478886_12_419 135
198 3300046543 Ga0495645_0049534 Ga0495645_0049534_1519_1926 135
199 3300046615 Ga0495656_0000342 Ga0495656_0000342_3092_3499 135
200 3300046615 Ga0495656_0644995 Ga0495656_0644995_24_431 135
201 3300046642 Ga0495634_0000212 Ga0495634_0000212_3630_4037 135
202 3300046660 Ga0495625_0620611 Ga0495625_0620611_41_448 135
203 3300046663 Ga0495635_0059883 Ga0495635_0059883_765_1172 135
204 3300046680 Ga0495646_0080527 Ga0495646_0080527_1420_1827 135
205 3300046694 Ga0495649_0334659 Ga0495649_0334659_114_521 135
206 3300046794 Ga0495589_0045398 Ga0495589_0045398_1390_1797 135
207 3300047317 Ga0495604_0000806 Ga0495604_0000806_16315_16722 135
208 3300047317 Ga0495604_0165826 Ga0495604_0165826_418_825 135
209 3300047321 Ga0495676_0000283 Ga0495676_0000283_7525_7932 135
210 3300047322 Ga0495680_0004998 Ga0495680_0004998_4640_5047 135
211 3300047323 Ga0495683_0363796 Ga0495683_0363796_95_502 135
212 3300047446 Ga0495679_033422 Ga0495679_033422_67_474 135
213 3300048903 Ga0496100_0054174 Ga0496100_0054174_1816_2223 135
214 3300048904 Ga0496101_0152146 Ga0496101_0152146_925_1332 135
215 3300048905 Ga0496102_0229478 Ga0496102_0229478_1030_1437 135
216 3300048905 Ga0496102_1096491 Ga0496102_1096491_86_493 135
217 3300048907 Ga0496104_0011315 Ga0496104_0011315_3122_3529 135
218 3300048909 Ga0496106_0029190 Ga0496106_0029190_2718_3125 135
219 3300048910 Ga0496107_0021611 Ga0496107_0021611_3180_3587 135
220 3300048912 Ga0496109_0917274 Ga0496109_0917274_340_747 135
221 3300048913 Ga0496110_0159058 Ga0496110_0159058_1541_1948 135
222 3300048914 Ga0496111_0112129 Ga0496111_0112129_1488_1895 135
223 3300048917 Ga0496114_0000003 Ga0496114_0000003_197152_197559 135
224 3300048917 Ga0496114_0135894 Ga0496114_0135894_405_812 135
225 3300048918 Ga0496115_0000036 Ga0496115_0000036_72209_72616 135
226 3300048918 Ga0496115_0013647 Ga0496115_0013647_4014_4421 135
227 3300048924 Ga0496121_0005287 Ga0496121_0005287_15108_15515 135
228 3300049569 Ga0501032_0217831 Ga0501032_0217831_696_1106 135
229 3300049574 Ga0501038_0443858 Ga0501038_0443858_314_721 135
230 3300049578 Ga0501042_0038053 Ga0501042_0038053_2077_2484 135
231 3300049581 Ga0501047_0032687 Ga0501047_0032687_3222_3632 135
232 3300049586 Ga0501070_0027078 Ga0501070_0027078_2108_2515 135
233 3300049586 Ga0501070_0275938 Ga0501070_0275938_417_827 135
234 3300049590 Ga0501074_0005646 Ga0501074_0005646_557_967 135
235 3300050513 nmdc:mga0rr50_415363_c1 nmdc:mga0rr50_415363_c1_333_740 135
236 3300053077 Ga0495601_0014155 Ga0495601_0014155_3050_3457 135
237 3300053083 Ga0495655_0328003 Ga0495655_0328003_69_476 135
238 3300053085 Ga0495619_0001065 Ga0495619_0001065_8052_8459 135
239 3300054114 Ga0501084_0559061 Ga0501084_0559061_512_919 135
240 3300005333 Ga0070677_10000011 Ga0070677_1000001124 136
241 3300005435 Ga0070714_100012544 Ga0070714_1000125443 136
242 3300005548 Ga0070665_100000068 Ga0070665_100000068138 136
243 3300005578 Ga0068854_100037476 Ga0068854_1000374764 136
244 3300005842 Ga0068858_100000012 Ga0068858_100000012110 136
245 3300005842 Ga0068858_100000081 Ga0068858_10000008140 136
246 3300005983 Ga0081540_1009793 Ga0081540_10097934 136
247 3300009098 Ga0105245_10000161 Ga0105245_1000016126 136
248 3300009098 Ga0105245_10000295 Ga0105245_1000029541 136
249 3300009176 Ga0105242_10003454 Ga0105242_1000345411 136
250 3300009177 Ga0105248_10000028 Ga0105248_1000002833 136
251 3300009177 Ga0105248_10000941 Ga0105248_100009417 136
252 3300009177 Ga0105248_12267115 Ga0105248_122671151 136
253 3300009553 Ga0105249_10000165 Ga0105249_1000016570 136
254 3300013297 Ga0157378_11705251 Ga0157378_117052511 136
255 3300014325 Ga0163163_10003439 Ga0163163_100034399 136
256 3300014968 Ga0157379_10000042 Ga0157379_1000004257 136
257 3300014968 Ga0157379_10026743 Ga0157379_100267432 136
258 3300025893 Ga0207682_10000159 Ga0207682_100001599 136
259 3300025916 Ga0207663_10280078 Ga0207663_102800782 136
260 3300025927 Ga0207687_10000026 Ga0207687_1000002694 136
261 3300025927 Ga0207687_10000578 Ga0207687_100005787 136
262 3300025929 Ga0207664_10000210 Ga0207664_100002105 136
263 3300025934 Ga0207686_10056488 Ga0207686_100564884 136
264 3300025941 Ga0207711_10000132 Ga0207711_1000013248 136
265 3300025941 Ga0207711_10000304 Ga0207711_1000030421 136
266 3300025941 Ga0207711_11258326 Ga0207711_112583261 136
267 3300025944 Ga0207661_10003103 Ga0207661_100031032 136
268 3300025961 Ga0207712_10000037 Ga0207712_1000003718 136
269 3300025981 Ga0207640_10009188 Ga0207640_100091888 136
270 3300026035 Ga0207703_10000089 Ga0207703_1000008987 136
271 3300026035 Ga0207703_10000091 Ga0207703_1000009171 136
272 3300028379 Ga0268266_10000020 Ga0268266_10000020266 136
273 3300028563 Ga0265319_1000028 Ga0265319_100002823 136
274 3300028800 Ga0265338_10003038 Ga0265338_100030387 136
275 3300028800 Ga0265338_10004524 Ga0265338_100045248 136
276 3300031344 Ga0265316_10830647 Ga0265316_108306471 136
277 3300031595 Ga0265313_10199185 Ga0265313_101991851 136
278 3300031712 Ga0265342_10153288 Ga0265342_101532882 136
279 3300035117 Ga0373953_0168268 Ga0373953_0168268_328_741 136
280 3300044684 Ga0466966_0287301 Ga0466966_0287301_296_709 136
281 3300044694 Ga0466963_0113015 Ga0466963_0113015_683_1096 136
282 3300044719 Ga0466971_0209398 Ga0466971_0209398_334_747 136
283 3300044842 Ga0466957_0058393 Ga0466957_0058393_1408_1821 136
284 3300045049 Ga0466959_0094988 Ga0466959_0094988_606_1019 136
285 3300045836 Ga0466958_0114070 Ga0466958_0114070_1129_1542 136
286 3300046462 Ga0495651_0174799 Ga0495651_0174799_586_999 136
287 3300046463 Ga0495653_0127657 Ga0495653_0127657_501_914 136
288 3300046475 Ga0495639_0554968 Ga0495639_0554968_101_514 136
289 3300046514 Ga0495618_0421982 Ga0495618_0421982_302_715 136
290 3300046516 Ga0495628_0019228 Ga0495628_0019228_3508_3921 136
291 3300046517 Ga0495630_0049794 Ga0495630_0049794_1873_2286 136
292 3300046517 Ga0495630_0141665 Ga0495630_0141665_476_889 136
293 3300046517 Ga0495630_0321654 Ga0495630_0321654_495_911 136
294 3300046529 Ga0495652_0231740 Ga0495652_0231740_881_1297 136
295 3300046533 Ga0495640_0127080 Ga0495640_0127080_871_1284 136
296 3300046535 Ga0495586_0086854 Ga0495586_0086854_902_1315 136
297 3300046543 Ga0495645_0336946 Ga0495645_0336946_316_729 136
298 3300046680 Ga0495646_0114096 Ga0495646_0114096_265_678 136
299 3300046683 Ga0495658_0246809 Ga0495658_0246809_394_807 136
300 3300046684 Ga0495669_0000130 Ga0495669_0000130_23415_23825 136
301 3300046690 Ga0495624_0082596 Ga0495624_0082596_659_1072 136
302 3300047317 Ga0495604_0064803 Ga0495604_0064803_1099_1512 136
303 3300047319 Ga0495674_0094370 Ga0495674_0094370_1992_2405 136
304 3300047321 Ga0495676_0005012 Ga0495676_0005012_1340_1762 136
305 3300047322 Ga0495680_0179360 Ga0495680_0179360_308_721 136
306 3300047444 Ga0495675_0368947 Ga0495675_0368947_362_775 136
307 3300048903 Ga0496100_0000007 Ga0496100_0000007_90281_90691 136
308 3300048904 Ga0496101_0000013 Ga0496101_0000013_90281_90691 136
309 3300048905 Ga0496102_0509536 Ga0496102_0509536_196_609 136
310 3300048905 Ga0496102_1576306 Ga0496102_1576306_103_528 136
311 3300048907 Ga0496104_0000001 Ga0496104_0000001_459897_460310 136
312 3300048907 Ga0496104_0000002 Ga0496104_0000002_568672_569082 136
313 3300048907 Ga0496104_0000013 Ga0496104_0000013_211018_211428 136
314 3300048908 Ga0496105_0000001 Ga0496105_0000001_759097_759507 136
315 3300048908 Ga0496105_0000006 Ga0496105_0000006_185736_186146 136
316 3300048909 Ga0496106_0000006 Ga0496106_0000006_84420_84830 136
317 3300048910 Ga0496107_0000007 Ga0496107_0000007_84422_84832 136
318 3300048911 Ga0496108_0000001 Ga0496108_0000001_268103_268513 136
319 3300048911 Ga0496108_0178984 Ga0496108_0178984_1378_1791 136
320 3300048912 Ga0496109_0000006 Ga0496109_0000006_268103_268513 136
321 3300048912 Ga0496109_0183293 Ga0496109_0183293_705_1118 136
322 3300048913 Ga0496110_0001924 Ga0496110_0001924_9038_9451 136
323 3300048917 Ga0496114_0466028 Ga0496114_0466028_694_1107 136
324 3300048918 Ga0496115_0387933 Ga0496115_0387933_387_800 136
325 3300048920 Ga0496117_0016112 Ga0496117_0016112_319_744 136
326 3300048921 Ga0496118_0005870 Ga0496118_0005870_2548_2973 136
327 3300048922 Ga0496119_0021835 Ga0496119_0021835_3624_4034 136
328 3300048923 Ga0496120_0101123 Ga0496120_0101123_346_756 136
329 3300049580 Ga0501046_0079841 Ga0501046_0079841_1832_2251 136
330 3300049584 Ga0501068_0147183 Ga0501068_0147183_17_436 136
331 3300049590 Ga0501074_1191174 Ga0501074_1191174_49_468 136
332 3300049824 Ga0501045_0179982 Ga0501045_0179982_995_1414 136
333 3300053077 Ga0495601_0000260 Ga0495601_0000260_13362_13775 136
334 3300053077 Ga0495601_0031420 Ga0495601_0031420_1151_1564 136
335 3300053085 Ga0495619_0038401 Ga0495619_0038401_870_1283 136
336 3300054114 Ga0501084_0112273 Ga0501084_0112273_1632_2051 136
337 3300061734 Ga0530510_0343456 Ga0530510_0343456_318_737 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

143

0.93

PF18029

Glyoxalase_6

Glyoxalase-like domain

21

143

0.9

PF12681

Glyoxalase_2

Glyoxalase-like domain

19

146

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.862 1 130
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8605 2 131
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8578 1 133
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8446 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8408 1 131
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9436 82 129 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9291 80 131 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8944 80 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8531 80 131 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8511 1 59 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1G6UKA2-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9527 1 130
AF-A0A317LTC7-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9481 1 133
AF-A0A7W1BQU6-F1-model_v4 VOC family protein 0.948 59 133
AF-A0A7Y6VW70-F1-model_v4 deleted 0.9469 79 135
AF-A0A0Q1CJ93-F1-model_v4 Glyoxalase 0.9448 1 130

Feature Viewer

pLDDT pTM Quality
86.76 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map