F412974

General Info

Members Datasets Scaffolds Average Seq Length
337 230 328 256

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100467783|Ga0068867_1004677832
Length 270
Sequence MSARVAAEQWRTRPMTEQRWPDRLWIIRHGESAGNVARDAAHAAGLARIDIDYRDVDVPLSELGERQSCALGRWYASLPKDHRPDVVMTSPYVRARQTGELMRKEGGFALEADEAFKSDERLREKEFGILDRLTRTGITELHPDQAEFRRLLGKFYHRPPGGESWCDVILRLRSALDTISLHYSGRRVLILTHQVVVLCMRYLLENLTENEILEIDRQKDVANCAITEYRFDSTAGAGGGLVLERYNYLTPMEAAGAPVTAKPDFSVGAR

Samples

Sample ID Description Type Environment
1 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
2 2643221584 Caulobacter sp. Root656 Isolate Unclassified
3 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
4 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
5 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
6 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
7 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
8 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
9 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0.3
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 0.3
Rhizoplane 3.86
Rhizosphere 81.01
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000109 3300003214 Bacteria 149484
2 rootL2_10192996 3300003322 Bacteria 2747
3 Ga0055524_1036205 3300003775 Bacteria 1331
4 Ga0055536_1000910 3300003781 Bacteria 19125
5 Ga0055530_10010429 3300003791 Bacteria 3435
6 Ga0055531_10011259 3300003794 Bacteria 4340
7 Ga0065715_10091066 3300005293 Bacteria 6153
8 Ga0070658_10000002 3300005327 Bacteria 637290
9 Ga0070658_10529610 3300005327 Unclassified 1019
10 Ga0070676_10065121 3300005328 Bacteria 2175
11 Ga0070676_10118279 3300005328 Unclassified 1659
12 Ga0070683_100006827 3300005329 Bacteria 9593
13 Ga0070683_100021508 3300005329 Bacteria 5758
14 Ga0070670_100086692 3300005331 Bacteria 2690
15 Ga0070670_100237913 3300005331 Bacteria 1585
16 Ga0070680_100010441 3300005336 Bacteria 7161
17 Ga0070680_100064634 3300005336 Bacteria 2999
18 Ga0070680_100221995 3300005336 Bacteria 1595
19 Ga0070682_100000451 3300005337 Bacteria 26141
20 Ga0070682_100010042 3300005337 Bacteria 5364
21 Ga0070682_100087607 3300005337 Bacteria 2030
22 Ga0068868_100020286 3300005338 Bacteria 4989
23 Ga0068868_100313283 3300005338 Bacteria 1335
24 Ga0068868_100370203 3300005338 Bacteria 1231
25 Ga0070660_100000535 3300005339 Bacteria 25358
26 Ga0070660_100149858 3300005339 Bacteria 1875
27 Ga0070691_10050790 3300005341 Bacteria 1979
28 Ga0070687_100046734 3300005343 Bacteria 2217
29 Ga0070661_100009980 3300005344 Bacteria 6589
30 Ga0070692_10039731 3300005345 Bacteria 2403
31 Ga0070692_10180783 3300005345 Bacteria 1222
32 Ga0070692_10181965 3300005345 Unclassified 1219
33 Ga0070668_100023471 3300005347 Bacteria 4665
34 Ga0070668_100157306 3300005347 Bacteria 1842
35 Ga0070669_100007761 3300005353 Bacteria 7669
36 Ga0070671_100003622 3300005355 Bacteria 12090
37 Ga0070671_100098202 3300005355 Bacteria 2456
38 Ga0070671_100277998 3300005355 Bacteria 1424
39 Ga0070674_100060298 3300005356 Bacteria 2644
40 Ga0070674_100157954 3300005356 Bacteria 1718
41 Ga0070674_100213573 3300005356 Bacteria 1497
42 Ga0070673_100303623 3300005364 Bacteria 1406
43 Ga0070659_100003683 3300005366 Bacteria 10928
44 Ga0070667_100000128 3300005367 Bacteria 95780
45 Ga0070667_100299234 3300005367 Bacteria 1448
46 Ga0070701_10141277 3300005438 Bacteria 1377
47 Ga0070700_100563412 3300005441 Bacteria 887
48 Ga0070694_100132332 3300005444 Bacteria 1803
49 Ga0070708_100000064 3300005445 Bacteria 69617
50 Ga0070662_100044982 3300005457 Bacteria 3165
51 Ga0070662_100145151 3300005457 Bacteria 1843
52 Ga0070681_10006776 3300005458 Bacteria 11152
53 Ga0070681_10018870 3300005458 Bacteria 6900
54 Ga0070681_10036254 3300005458 Bacteria 4952
55 Ga0068867_100049542 3300005459 Bacteria 3093
56 Ga0068867_100088312 3300005459 Bacteria 2349
57 Ga0068867_100467783 3300005459 Unclassified 1078
58 Ga0070706_100063360 3300005467 Bacteria 3417
59 Ga0070707_100000322 3300005468 Bacteria 47149
60 Ga0070707_100295200 3300005468 Bacteria 1575
61 Ga0070707_100482505 3300005468 Bacteria 1201
62 Ga0070699_100057712 3300005518 Bacteria 3362
63 Ga0070699_100161652 3300005518 Bacteria 1982
64 Ga0070679_100003241 3300005530 Bacteria 14870
65 Ga0070679_100019799 3300005530 Bacteria 6551
66 Ga0070679_100020712 3300005530 Bacteria 6416
67 Ga0070684_100012125 3300005535 Bacteria 6893
68 Ga0070684_100305101 3300005535 Bacteria 1461
69 Ga0070697_100013371 3300005536 Bacteria 6437
70 Ga0070697_100058235 3300005536 Bacteria 3144
71 Ga0068853_100096417 3300005539 Bacteria 2609
72 Ga0070672_100141501 3300005543 Bacteria 1985
73 Ga0070686_100011199 3300005544 Bacteria 5081
74 Ga0070695_100034821 3300005545 Unclassified 3160
75 Ga0070695_100423223 3300005545 Bacteria 1014
76 Ga0070696_100004290 3300005546 Bacteria 9501
77 Ga0070693_100048034 3300005547 Unclassified 2430
78 Ga0070665_100000152 3300005548 Bacteria 126430
79 Ga0070704_100093590 3300005549 Bacteria 2246
80 Ga0068855_100242134 3300005563 Bacteria 2015
81 Ga0070664_100000821 3300005564 Bacteria 23917
82 Ga0070664_100231557 3300005564 Bacteria 1656
83 Ga0068857_100002910 3300005577 Bacteria 14105
84 Ga0068857_100276756 3300005577 Bacteria 1543
85 Ga0068854_100087385 3300005578 Bacteria 2313
86 Ga0068856_100120312 3300005614 Bacteria 2627
87 Ga0068852_100603828 3300005616 Bacteria 1102
88 Ga0068859_100431561 3300005617 Bacteria 1414
89 Ga0068864_100017024 3300005618 Bacteria 6059
90 Ga0068861_100063230 3300005719 Unclassified 2845
91 Ga0068863_100003348 3300005841 Bacteria 15829
92 Ga0068863_100025806 3300005841 Bacteria 5606
93 Ga0068860_100071704 3300005843 Bacteria 3291
94 Ga0068862_100003871 3300005844 Bacteria 12737
95 Ga0068862_100172916 3300005844 Bacteria 1935
96 Ga0070717_10090107 3300006028 Bacteria 2588
97 Ga0075364_10147586 3300006051 Bacteria 1584
98 Ga0070712_100464293 3300006175 Bacteria 1056
99 Ga0075362_10049571 3300006177 Bacteria 1876
100 Ga0075367_10241708 3300006178 Bacteria 1131
101 Ga0075370_10072878 3300006353 Bacteria 1966
102 Ga0068871_100385210 3300006358 Bacteria 1246
103 Ga0075430_100165375 3300006846 Bacteria 1841
104 Ga0075433_10005862 3300006852 Bacteria 9677
105 Ga0075434_100004770 3300006871 Bacteria 12277
106 Ga0068865_100020195 3300006881 Bacteria 4319
107 Ga0075436_100050437 3300006914 Bacteria 2872
108 Ga0097620_100431552 3300006931 Bacteria 1414
109 Ga0075435_100004722 3300007076 Bacteria 9398
110 Ga0105251_10000231 3300009011 Bacteria 56229
111 Ga0105245_10046358 3300009098 Bacteria 3884
112 Ga0105245_10061959 3300009098 Bacteria 3374
113 Ga0114129_10034433 3300009147 Bacteria 7154
114 Ga0105242_10086452 3300009176 Unclassified 2631
115 Ga0105242_10166908 3300009176 Bacteria 1932
116 Ga0105248_10053296 3300009177 Bacteria 4539
117 Ga0105248_10092321 3300009177 Bacteria 3409
118 Ga0105249_10053015 3300009553 Bacteria 3706
119 Ga0157373_10085975 3300013100 Bacteria 2216
120 Ga0157373_10227638 3300013100 Bacteria 1316
121 Ga0157370_10325224 3300013104 Bacteria 1418
122 Ga0157374_10138007 3300013296 Bacteria 2365
123 Ga0157374_10369712 3300013296 Bacteria 1427
124 Ga0163162_10105466 3300013306 Unclassified 2913
125 Ga0163162_10655818 3300013306 Bacteria 1173
126 Ga0157372_10630887 3300013307 Bacteria 1248
127 Ga0157375_10046449 3300013308 Bacteria 4234
128 Ga0163163_10069483 3300014325 Bacteria 3506
129 Ga0157380_10614153 3300014326 Bacteria 1078
130 Ga0157377_10300539 3300014745 Bacteria 1059
131 Ga0163161_10187495 3300017792 Unclassified 1589
132 Ga0213876_10094980 3300021384 Bacteria 1579
133 Ga0213875_10002552 3300021388 Bacteria 10852
134 Ga0224712_10044690 3300022467 Bacteria 1691
135 Ga0209026_1003682 3300025250 Bacteria 4910
136 Ga0209233_1000167 3300025261 Bacteria 149536
137 Ga0209676_1000392 3300025292 Bacteria 79950
138 Ga0209050_1001959 3300025298 Bacteria 19483
139 Ga0209256_1000360 3300025299 Bacteria 74074
140 Ga0209257_1000616 3300025304 Bacteria 57900
141 Ga0207713_1007815 3300025735 Bacteria 6238
142 Ga0207645_10007309 3300025907 Bacteria 7811
143 Ga0207645_10022410 3300025907 Bacteria 4109
144 Ga0207645_10182025 3300025907 Unclassified 1379
145 Ga0207705_10000005 3300025909 Bacteria 673478
146 Ga0207684_10036660 3300025910 Bacteria 4162
147 Ga0207707_10001396 3300025912 Bacteria 22390
148 Ga0207707_10037394 3300025912 Bacteria 4243
149 Ga0207707_10038263 3300025912 Bacteria 4192
150 Ga0207695_10063379 3300025913 Bacteria 3812
151 Ga0207663_10548261 3300025916 Bacteria 904
152 Ga0207660_10018883 3300025917 Bacteria 4604
153 Ga0207660_10035539 3300025917 Bacteria 3460
154 Ga0207660_10264928 3300025917 Bacteria 1360
155 Ga0207662_10043750 3300025918 Bacteria 2642
156 Ga0207657_10005736 3300025919 Bacteria 12954
157 Ga0207649_10008511 3300025920 Bacteria 5595
158 Ga0207649_10159734 3300025920 Bacteria 1561
159 Ga0207652_10003141 3300025921 Bacteria 13758
160 Ga0207652_10103540 3300025921 Bacteria 2517
161 Ga0207652_10129352 3300025921 Bacteria 2251
162 Ga0207652_10718827 3300025921 Bacteria 890
163 Ga0207646_10000686 3300025922 Bacteria 43791
164 Ga0207646_10147175 3300025922 Bacteria 2123
165 Ga0207681_10005590 3300025923 Bacteria 7721
166 Ga0207650_10255369 3300025925 Bacteria 1420
167 Ga0207687_10525153 3300025927 Bacteria 990
168 Ga0207644_10009833 3300025931 Bacteria 6291
169 Ga0207644_10133695 3300025931 Bacteria 1902
170 Ga0207690_10008234 3300025932 Bacteria 6184
171 Ga0207690_10026555 3300025932 Bacteria 3647
172 Ga0207706_10001267 3300025933 Bacteria 25478
173 Ga0207706_10193858 3300025933 Bacteria 1783
174 Ga0207669_10037681 3300025937 Bacteria 2777
175 Ga0207669_10380158 3300025937 Bacteria 1100
176 Ga0207704_10487750 3300025938 Bacteria 991
177 Ga0207711_10010503 3300025941 Bacteria 7691
178 Ga0207661_10001172 3300025944 Bacteria 17516
179 Ga0207661_10015214 3300025944 Bacteria 5658
180 Ga0207661_10049391 3300025944 Bacteria 3349
181 Ga0207679_10061987 3300025945 Bacteria 2785
182 Ga0207679_10073110 3300025945 Bacteria 2593
183 Ga0207651_10361194 3300025960 Bacteria 1226
184 Ga0207668_10005497 3300025972 Bacteria 7469
185 Ga0207640_10087656 3300025981 Bacteria 2146
186 Ga0207658_10006277 3300025986 Bacteria 8122
187 Ga0207658_10008713 3300025986 Bacteria 6892
188 Ga0207677_10131841 3300026023 Bacteria 1899
189 Ga0207639_10054415 3300026041 Bacteria 3058
190 Ga0207678_10468349 3300026067 Bacteria 1096
191 Ga0207708_10015751 3300026075 Bacteria 5673
192 Ga0207708_10023598 3300026075 Bacteria 4651
193 Ga0207702_10211162 3300026078 Bacteria 1805
194 Ga0207641_10001645 3300026088 Bacteria 21795
195 Ga0207641_10013703 3300026088 Bacteria 6654
196 Ga0207641_10017149 3300026088 Bacteria 5924
197 Ga0207648_10014478 3300026089 Bacteria 7286
198 Ga0207648_10090596 3300026089 Bacteria 2672
199 Ga0207648_10293399 3300026089 Bacteria 1456
200 Ga0207676_10014958 3300026095 Bacteria 5591
201 Ga0207674_10001612 3300026116 Bacteria 29060
202 Ga0207674_10248127 3300026116 Bacteria 1727
203 Ga0207675_100093027 3300026118 Unclassified 2835
204 Ga0207683_10006044 3300026121 Bacteria 10364
205 Ga0207698_10131606 3300026142 Bacteria 2139
206 Ga0209981_1008869 3300027378 Bacteria 1368
207 Ga0209999_1000768 3300027543 Bacteria 5258
208 Ga0209974_10042705 3300027876 Bacteria 1509
209 Ga0268266_10000125 3300028379 Bacteria 151647
210 Ga0268265_10082645 3300028380 Bacteria 2540
211 Ga0268265_10480367 3300028380 Bacteria 1167
212 Ga0268264_10602845 3300028381 Bacteria 1082
213 Ga0307513_10000063 3300031456 Bacteria 142538
214 Ga0307513_10311557 3300031456 Bacteria 1336
215 Ga0307408_100005022 3300031548 Bacteria 8872
216 Ga0307408_100010039 3300031548 Bacteria 6241
217 Ga0307405_10259325 3300031731 Bacteria 1297
218 Ga0307405_10314687 3300031731 Bacteria 1193
219 Ga0307413_10000476 3300031824 Bacteria 13075
220 Ga0307413_10045389 3300031824 Bacteria 2604
221 Ga0307413_10352347 3300031824 Bacteria 1136
222 Ga0307410_10001560 3300031852 Bacteria 10462
223 Ga0307410_10068882 3300031852 Bacteria 2445
224 Ga0307406_10001480 3300031901 Bacteria 12968
225 Ga0307406_10019277 3300031901 Bacteria 4001
226 Ga0307406_10052311 3300031901 Bacteria 2597
227 Ga0307407_10006194 3300031903 Bacteria 5286
228 Ga0307407_10007464 3300031903 Bacteria 4954
229 Ga0307407_10074698 3300031903 Bacteria 2029
230 Ga0307412_10000752 3300031911 Bacteria 18803
231 Ga0307412_10140264 3300031911 Bacteria 1769
232 Ga0307409_100006277 3300031995 Bacteria 6963
233 Ga0307409_100084731 3300031995 Bacteria 2574
234 Ga0307416_100483642 3300032002 Bacteria 1299
235 Ga0307414_10001645 3300032004 Bacteria 11627
236 Ga0307414_10545988 3300032004 Bacteria 1032
237 Ga0307414_10701142 3300032004 Bacteria 916
238 Ga0307411_10000921 3300032005 Bacteria 11186
239 Ga0307411_10002803 3300032005 Bacteria 7851
240 Ga0307411_10117818 3300032005 Bacteria 1914
241 Ga0307411_10157784 3300032005 Bacteria 1695
242 Ga0307415_100002100 3300032126 Bacteria 9853
243 Ga0307415_100016853 3300032126 Bacteria 4367
244 Ga0307415_100379737 3300032126 Bacteria 1199
245 Ga0307415_100563110 3300032126 Bacteria 1008
246 Ga0373959_0015380 3300034820 Bacteria 1405
247 Ga0373929_0016538 3300035085 Bacteria 1446
248 Ga0373941_0007702 3300035115 Bacteria 2645
249 Ga0373942_0001237 3300035207 Bacteria 6709
250 Ga0395905_0171634 3300037471 Bacteria 2037
251 Ga0436364_0838050 3300037853 Bacteria 8858
252 Ga0436365_0573163 3300039437 Bacteria 7193
253 Ga0451853_3045660 3300041512 Bacteria 1018
254 Ga0439446_0002529 3300042156 Bacteria 4398
255 Ga0439459_0001606 3300042438 Bacteria 3366
256 Ga0466963_0320873 3300044694 Bacteria 1090
257 Ga0466968_0052339 3300044735 Bacteria 1746
258 Ga0466967_0335015 3300045976 Bacteria 1462
259 Ga0495638_0000598 3300046460 Bacteria 40631
260 Ga0495638_0011362 3300046460 Bacteria 6136
261 Ga0495650_0000069 3300046471 Bacteria 261124
262 Ga0495606_0046122 3300046507 Bacteria 2883
263 Ga0495616_0110813 3300046513 Bacteria 1275
264 Ga0495643_0000512 3300046522 Bacteria 48356
265 Ga0495643_0076936 3300046522 Bacteria 1744
266 Ga0495643_0098033 3300046522 Bacteria 1505
267 Ga0495668_0000067 3300046616 Bacteria 176418
268 Ga0495668_0003524 3300046616 Bacteria 11657
269 Ga0495668_0008921 3300046616 Bacteria 6201
270 Ga0495668_0021543 3300046616 Bacteria 3694
271 Ga0495625_0000011 3300046660 Bacteria 377120
272 Ga0495625_0000979 3300046660 Bacteria 37941
273 Ga0495625_0004535 3300046660 Bacteria 13093
274 Ga0495669_0010816 3300046684 Bacteria 3863
275 Ga0495679_009934 3300047446 Bacteria 3771
276 Ga0495685_083049 3300047447 Bacteria 1066
277 Ga0495673_0000115 3300047469 Bacteria 154414
278 Ga0495673_0000160 3300047469 Bacteria 115718
279 Ga0495673_0000885 3300047469 Bacteria 27564
280 Ga0495673_0005215 3300047469 Bacteria 7900
281 Ga0495686_0000217 3300047472 Bacteria 105681
282 Ga0496102_0025192 3300048905 Bacteria 5293
283 Ga0496102_0770200 3300048905 Bacteria 885
284 Ga0496104_0246085 3300048907 Unclassified 1701
285 Ga0496105_0158103 3300048908 Bacteria 1861
286 Ga0496106_0080207 3300048909 Plasmid 2506
287 Ga0496107_0000036 3300048910 Bacteria 79369
288 Ga0496108_0397789 3300048911 Unclassified 1203
289 Ga0496109_0186450 3300048912 Bacteria 1949
290 Ga0496110_0302299 3300048913 Unclassified 1457
291 Ga0496112_0001580 3300048915 Bacteria 17611
292 Ga0496112_0288985 3300048915 Bacteria 1586
293 Ga0496113_0062330 3300048916 Bacteria 2816
294 Ga0496114_0178799 3300048917 Unclassified 1852
295 Ga0496116_0047728 3300048919 Bacteria 2880
296 Ga0496121_0000833 3300048924 Bacteria 56021
297 Ga0496121_0003144 3300048924 Bacteria 23828
298 Ga0496122_0026670 3300048925 Bacteria 4972
299 Ga0496123_0065182 3300048926 Bacteria 2317
300 Ga0496125_0034397 3300048928 Bacteria 4467
301 Ga0496125_0191774 3300048928 Bacteria 1348
302 Ga0496126_0001931 3300048929 Bacteria 29568
303 Ga0496126_0069223 3300048929 Bacteria 3149
304 Ga0501033_0000389 3300049570 Bacteria 42230
305 Ga0501034_0004974 3300049571 Bacteria 14623
306 Ga0501034_0577563 3300049571 Bacteria 1031
307 Ga0501037_0016740 3300049573 Bacteria 5394
308 Ga0501047_0345204 3300049581 Bacteria 1326
309 Ga0501070_0041956 3300049586 Bacteria 3810
310 Ga0501044_0001888 3300049823 Bacteria 24278
311 Ga0501044_0376992 3300049823 Bacteria 1334
312 Ga0501044_0476366 3300049823 Bacteria 1152
313 nmdc:mga03683_42849_c1 3300050489 Bacteria 1864
314 nmdc:mga00v17_131543_c1 3300050491 Bacteria 1599
315 nmdc:mga0yw44_1727_c1 3300050492 Bacteria 8872
316 nmdc:mga07m45_97558_c1 3300050496 Bacteria 1686
317 nmdc:mga05p37_15143_c1 3300050507 Bacteria 9260
318 nmdc:mga0n895_94418_c1 3300050512 Bacteria 2995
319 nmdc:mga08x19_95757_c1 3300050514 Bacteria 1964
320 nmdc:mga0a205_10737_c1 3300050515 Bacteria 8420
321 nmdc:mga0sz30_74785_c1 3300050516 Bacteria 864
322 Ga0500643_038924 3300053087 Bacteria 1407
323 Ga0500644_0000084 3300053088 Bacteria 57829
324 Ga0500566_0258107 3300053094 Bacteria 843
325 Ga0500628_000811 3300053129 Bacteria 5551
326 Ga0500658_0014206 3300053134 Bacteria 2946
327 Ga0500622_0059912 3300053156 Bacteria 1943
328 Ga0500645_000124 3300053730 Bacteria 61241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10131606 Ga0207698_101316061 233
2 3300049586 Ga0501070_0041956 Ga0501070_0041956_640_1347 235
3 3300005535 Ga0070684_100305101 Ga0070684_1003051011 240
4 3300005564 Ga0070664_100231557 Ga0070664_1002315572 240
5 3300025945 Ga0207679_10073110 Ga0207679_100731102 240
6 3300031548 Ga0307408_100005022 Ga0307408_1000050223 240
7 3300031548 Ga0307408_100010039 Ga0307408_1000100396 240
8 3300031731 Ga0307405_10259325 Ga0307405_102593251 240
9 3300031824 Ga0307413_10045389 Ga0307413_100453893 240
10 3300031852 Ga0307410_10001560 Ga0307410_100015602 240
11 3300031901 Ga0307406_10001480 Ga0307406_100014808 240
12 3300031901 Ga0307406_10019277 Ga0307406_100192774 240
13 3300031903 Ga0307407_10006194 Ga0307407_100061945 240
14 3300031903 Ga0307407_10007464 Ga0307407_100074641 240
15 3300031911 Ga0307412_10000752 Ga0307412_100007527 240
16 3300031911 Ga0307412_10140264 Ga0307412_101402641 240
17 3300031995 Ga0307409_100084731 Ga0307409_1000847311 240
18 3300032004 Ga0307414_10001645 Ga0307414_1000164510 240
19 3300032004 Ga0307414_10701142 Ga0307414_107011421 240
20 3300032005 Ga0307411_10000921 Ga0307411_1000092110 240
21 3300032005 Ga0307411_10117818 Ga0307411_101178182 240
22 3300032126 Ga0307415_100002100 Ga0307415_1000021003 240
23 3300031731 Ga0307405_10314687 Ga0307405_103146871 242
24 3300031824 Ga0307413_10000476 Ga0307413_1000047612 242
25 3300031852 Ga0307410_10068882 Ga0307410_100688822 242
26 3300031901 Ga0307406_10052311 Ga0307406_100523113 242
27 3300031903 Ga0307407_10074698 Ga0307407_100746982 242
28 3300031995 Ga0307409_100006277 Ga0307409_1000062776 242
29 3300032005 Ga0307411_10002803 Ga0307411_100028031 242
30 3300032126 Ga0307415_100016853 Ga0307415_1000168532 242
31 3300032126 Ga0307415_100379737 Ga0307415_1003797372 242
32 3300005617 Ga0068859_100431561 Ga0068859_1004315612 250
33 3300006931 Ga0097620_100431552 Ga0097620_1004315522 250
34 iso_pu_bacteria 2643221552 2643782400 250
35 iso_pu_bacteria 2643221584 2643930938 250
36 iso_pu_bacteria 2738541281 2738747250 250
37 iso_pu_bacteria 2738543032 2739356479 250
38 iso_pu_bacteria 2791355048 2792462534 250
39 iso_pu_bacteria 2842333319 2842336555 250
40 iso_pu_bacteria 2843744320 2843748582 250
41 iso_pu_bacteria 2857504554 2857508601 250
42 iso_pu_bacteria 2883577096 2883579930 250
43 3300048919 Ga0496116_0047728 Ga0496116_0047728_1446_2207 251
44 3300021388 Ga0213875_10002552 Ga0213875_100025527 252
45 3300037853 Ga0436364_0838050 Ga0436364_0838050_4343_5101 252
46 3300005328 Ga0070676_10118279 Ga0070676_101182792 253
47 3300005616 Ga0068852_100603828 Ga0068852_1006038282 253
48 3300006177 Ga0075362_10049571 Ga0075362_100495712 253
49 3300013104 Ga0157370_10325224 Ga0157370_103252242 253
50 3300025907 Ga0207645_10182025 Ga0207645_101820252 253
51 3300031456 Ga0307513_10000063 Ga0307513_1000006315 253
52 3300049823 Ga0501044_0376992 Ga0501044_0376992_53_814 253
53 3300050489 nmdc:mga03683_42849_c1 nmdc:mga03683_42849_c1_725_1486 253
54 3300003322 rootL2_10192996 rootL2_101929965 254
55 3300003775 Ga0055524_1036205 Ga0055524_10362051 254
56 3300003781 Ga0055536_1000910 Ga0055536_10009102 254
57 3300003791 Ga0055530_10010429 Ga0055530_100104293 254
58 3300003794 Ga0055531_10011259 Ga0055531_100112595 254
59 3300005293 Ga0065715_10091066 Ga0065715_100910666 254
60 3300005327 Ga0070658_10000002 Ga0070658_1000000221 254
61 3300005327 Ga0070658_10529610 Ga0070658_105296102 254
62 3300005328 Ga0070676_10065121 Ga0070676_100651213 254
63 3300005329 Ga0070683_100006827 Ga0070683_1000068274 254
64 3300005329 Ga0070683_100021508 Ga0070683_1000215085 254
65 3300005331 Ga0070670_100237913 Ga0070670_1002379132 254
66 3300005336 Ga0070680_100010441 Ga0070680_1000104413 254
67 3300005336 Ga0070680_100064634 Ga0070680_1000646342 254
68 3300005336 Ga0070680_100221995 Ga0070680_1002219951 254
69 3300005337 Ga0070682_100000451 Ga0070682_10000045119 254
70 3300005337 Ga0070682_100010042 Ga0070682_1000100422 254
71 3300005337 Ga0070682_100087607 Ga0070682_1000876072 254
72 3300005338 Ga0068868_100020286 Ga0068868_1000202863 254
73 3300005338 Ga0068868_100313283 Ga0068868_1003132832 254
74 3300005338 Ga0068868_100370203 Ga0068868_1003702031 254
75 3300005339 Ga0070660_100000535 Ga0070660_10000053513 254
76 3300005339 Ga0070660_100149858 Ga0070660_1001498582 254
77 3300005341 Ga0070691_10050790 Ga0070691_100507902 254
78 3300005343 Ga0070687_100046734 Ga0070687_1000467343 254
79 3300005344 Ga0070661_100009980 Ga0070661_1000099805 254
80 3300005345 Ga0070692_10039731 Ga0070692_100397312 254
81 3300005345 Ga0070692_10180783 Ga0070692_101807831 254
82 3300005345 Ga0070692_10181965 Ga0070692_101819652 254
83 3300005347 Ga0070668_100157306 Ga0070668_1001573063 254
84 3300005355 Ga0070671_100098202 Ga0070671_1000982021 254
85 3300005355 Ga0070671_100277998 Ga0070671_1002779981 254
86 3300005356 Ga0070674_100060298 Ga0070674_1000602982 254
87 3300005356 Ga0070674_100157954 Ga0070674_1001579543 254
88 3300005356 Ga0070674_100213573 Ga0070674_1002135732 254
89 3300005364 Ga0070673_100303623 Ga0070673_1003036232 254
90 3300005366 Ga0070659_100003683 Ga0070659_1000036836 254
91 3300005438 Ga0070701_10141277 Ga0070701_101412772 254
92 3300005441 Ga0070700_100563412 Ga0070700_1005634121 254
93 3300005444 Ga0070694_100132332 Ga0070694_1001323322 254
94 3300005445 Ga0070708_100000064 Ga0070708_10000006449 254
95 3300005457 Ga0070662_100044982 Ga0070662_1000449823 254
96 3300005457 Ga0070662_100145151 Ga0070662_1001451512 254
97 3300005458 Ga0070681_10006776 Ga0070681_100067764 254
98 3300005458 Ga0070681_10018870 Ga0070681_100188704 254
99 3300005458 Ga0070681_10036254 Ga0070681_100362545 254
100 3300005459 Ga0068867_100049542 Ga0068867_1000495423 254
101 3300005459 Ga0068867_100088312 Ga0068867_1000883123 254
102 3300005459 Ga0068867_100467783 Ga0068867_1004677832 254
103 3300005467 Ga0070706_100063360 Ga0070706_1000633604 254
104 3300005468 Ga0070707_100000322 Ga0070707_10000032224 254
105 3300005468 Ga0070707_100295200 Ga0070707_1002952002 254
106 3300005468 Ga0070707_100482505 Ga0070707_1004825051 254
107 3300005518 Ga0070699_100057712 Ga0070699_1000577122 254
108 3300005518 Ga0070699_100161652 Ga0070699_1001616522 254
109 3300005530 Ga0070679_100003241 Ga0070679_1000032419 254
110 3300005530 Ga0070679_100019799 Ga0070679_1000197992 254
111 3300005530 Ga0070679_100020712 Ga0070679_1000207122 254
112 3300005535 Ga0070684_100012125 Ga0070684_1000121256 254
113 3300005536 Ga0070697_100013371 Ga0070697_1000133713 254
114 3300005536 Ga0070697_100058235 Ga0070697_1000582352 254
115 3300005539 Ga0068853_100096417 Ga0068853_1000964172 254
116 3300005543 Ga0070672_100141501 Ga0070672_1001415013 254
117 3300005544 Ga0070686_100011199 Ga0070686_1000111994 254
118 3300005545 Ga0070695_100034821 Ga0070695_1000348213 254
119 3300005545 Ga0070695_100423223 Ga0070695_1004232231 254
120 3300005546 Ga0070696_100004290 Ga0070696_1000042908 254
121 3300005547 Ga0070693_100048034 Ga0070693_1000480342 254
122 3300005549 Ga0070704_100093590 Ga0070704_1000935903 254
123 3300005563 Ga0068855_100242134 Ga0068855_1002421342 254
124 3300005564 Ga0070664_100000821 Ga0070664_10000082118 254
125 3300005577 Ga0068857_100002910 Ga0068857_1000029108 254
126 3300005577 Ga0068857_100276756 Ga0068857_1002767562 254
127 3300005578 Ga0068854_100087385 Ga0068854_1000873853 254
128 3300005614 Ga0068856_100120312 Ga0068856_1001203122 254
129 3300005618 Ga0068864_100017024 Ga0068864_1000170247 254
130 3300005719 Ga0068861_100063230 Ga0068861_1000632302 254
131 3300005843 Ga0068860_100071704 Ga0068860_1000717042 254
132 3300005844 Ga0068862_100172916 Ga0068862_1001729161 254
133 3300006028 Ga0070717_10090107 Ga0070717_100901072 254
134 3300006051 Ga0075364_10147586 Ga0075364_101475861 254
135 3300006175 Ga0070712_100464293 Ga0070712_1004642931 254
136 3300006178 Ga0075367_10241708 Ga0075367_102417082 254
137 3300006353 Ga0075370_10072878 Ga0075370_100728782 254
138 3300006358 Ga0068871_100385210 Ga0068871_1003852102 254
139 3300006846 Ga0075430_100165375 Ga0075430_1001653752 254
140 3300006852 Ga0075433_10005862 Ga0075433_100058625 254
141 3300006871 Ga0075434_100004770 Ga0075434_1000047709 254
142 3300006881 Ga0068865_100020195 Ga0068865_1000201953 254
143 3300006914 Ga0075436_100050437 Ga0075436_1000504373 254
144 3300007076 Ga0075435_100004722 Ga0075435_1000047227 254
145 3300009098 Ga0105245_10046358 Ga0105245_100463584 254
146 3300009098 Ga0105245_10061959 Ga0105245_100619593 254
147 3300009147 Ga0114129_10034433 Ga0114129_100344336 254
148 3300009176 Ga0105242_10086452 Ga0105242_100864522 254
149 3300009176 Ga0105242_10166908 Ga0105242_101669081 254
150 3300009177 Ga0105248_10092321 Ga0105248_100923213 254
151 3300009553 Ga0105249_10053015 Ga0105249_100530154 254
152 3300013100 Ga0157373_10085975 Ga0157373_100859752 254
153 3300013100 Ga0157373_10227638 Ga0157373_102276382 254
154 3300013296 Ga0157374_10138007 Ga0157374_101380072 254
155 3300013296 Ga0157374_10369712 Ga0157374_103697122 254
156 3300013306 Ga0163162_10105466 Ga0163162_101054662 254
157 3300013306 Ga0163162_10655818 Ga0163162_106558182 254
158 3300013307 Ga0157372_10630887 Ga0157372_106308872 254
159 3300013308 Ga0157375_10046449 Ga0157375_100464492 254
160 3300014325 Ga0163163_10069483 Ga0163163_100694834 254
161 3300014326 Ga0157380_10614153 Ga0157380_106141531 254
162 3300014745 Ga0157377_10300539 Ga0157377_103005391 254
163 3300017792 Ga0163161_10187495 Ga0163161_101874952 254
164 3300021384 Ga0213876_10094980 Ga0213876_100949802 254
165 3300022467 Ga0224712_10044690 Ga0224712_100446902 254
166 3300025250 Ga0209026_1003682 Ga0209026_10036822 254
167 3300025292 Ga0209676_1000392 Ga0209676_100039266 254
168 3300025298 Ga0209050_1001959 Ga0209050_100195920 254
169 3300025299 Ga0209256_1000360 Ga0209256_100036037 254
170 3300025304 Ga0209257_1000616 Ga0209257_10006162 254
171 3300025907 Ga0207645_10007309 Ga0207645_100073092 254
172 3300025907 Ga0207645_10022410 Ga0207645_100224103 254
173 3300025909 Ga0207705_10000005 Ga0207705_10000005468 254
174 3300025910 Ga0207684_10036660 Ga0207684_100366602 254
175 3300025912 Ga0207707_10001396 Ga0207707_1000139620 254
176 3300025912 Ga0207707_10037394 Ga0207707_100373942 254
177 3300025912 Ga0207707_10038263 Ga0207707_100382632 254
178 3300025913 Ga0207695_10063379 Ga0207695_100633793 254
179 3300025916 Ga0207663_10548261 Ga0207663_105482612 254
180 3300025917 Ga0207660_10018883 Ga0207660_100188834 254
181 3300025917 Ga0207660_10035539 Ga0207660_100355392 254
182 3300025917 Ga0207660_10264928 Ga0207660_102649281 254
183 3300025918 Ga0207662_10043750 Ga0207662_100437503 254
184 3300025919 Ga0207657_10005736 Ga0207657_1000573614 254
185 3300025920 Ga0207649_10008511 Ga0207649_100085114 254
186 3300025920 Ga0207649_10159734 Ga0207649_101597342 254
187 3300025921 Ga0207652_10003141 Ga0207652_100031413 254
188 3300025921 Ga0207652_10103540 Ga0207652_101035403 254
189 3300025921 Ga0207652_10129352 Ga0207652_101293522 254
190 3300025921 Ga0207652_10718827 Ga0207652_107188271 254
191 3300025922 Ga0207646_10000686 Ga0207646_100006868 254
192 3300025922 Ga0207646_10147175 Ga0207646_101471752 254
193 3300025925 Ga0207650_10255369 Ga0207650_102553692 254
194 3300025927 Ga0207687_10525153 Ga0207687_105251531 254
195 3300025931 Ga0207644_10133695 Ga0207644_101336952 254
196 3300025932 Ga0207690_10008234 Ga0207690_100082346 254
197 3300025932 Ga0207690_10026555 Ga0207690_100265553 254
198 3300025933 Ga0207706_10001267 Ga0207706_100012678 254
199 3300025933 Ga0207706_10193858 Ga0207706_101938582 254
200 3300025937 Ga0207669_10037681 Ga0207669_100376814 254
201 3300025937 Ga0207669_10380158 Ga0207669_103801581 254
202 3300025938 Ga0207704_10487750 Ga0207704_104877502 254
203 3300025944 Ga0207661_10001172 Ga0207661_1000117218 254
204 3300025944 Ga0207661_10015214 Ga0207661_100152145 254
205 3300025944 Ga0207661_10049391 Ga0207661_100493911 254
206 3300025945 Ga0207679_10061987 Ga0207679_100619873 254
207 3300025960 Ga0207651_10361194 Ga0207651_103611942 254
208 3300025981 Ga0207640_10087656 Ga0207640_100876563 254
209 3300026023 Ga0207677_10131841 Ga0207677_101318413 254
210 3300026041 Ga0207639_10054415 Ga0207639_100544153 254
211 3300026067 Ga0207678_10468349 Ga0207678_104683491 254
212 3300026075 Ga0207708_10015751 Ga0207708_100157515 254
213 3300026075 Ga0207708_10023598 Ga0207708_100235985 254
214 3300026078 Ga0207702_10211162 Ga0207702_102111622 254
215 3300026088 Ga0207641_10013703 Ga0207641_100137037 254
216 3300026089 Ga0207648_10014478 Ga0207648_100144784 254
217 3300026089 Ga0207648_10090596 Ga0207648_100905962 254
218 3300026089 Ga0207648_10293399 Ga0207648_102933992 254
219 3300026095 Ga0207676_10014958 Ga0207676_100149585 254
220 3300026116 Ga0207674_10001612 Ga0207674_1000161220 254
221 3300026116 Ga0207674_10248127 Ga0207674_102481271 254
222 3300026118 Ga0207675_100093027 Ga0207675_1000930273 254
223 3300026121 Ga0207683_10006044 Ga0207683_100060444 254
224 3300027378 Ga0209981_1008869 Ga0209981_10088692 254
225 3300027543 Ga0209999_1000768 Ga0209999_10007683 254
226 3300027876 Ga0209974_10042705 Ga0209974_100427052 254
227 3300028381 Ga0268264_10602845 Ga0268264_106028451 254
228 3300031456 Ga0307513_10311557 Ga0307513_103115572 254
229 3300031824 Ga0307413_10352347 Ga0307413_103523471 254
230 3300032002 Ga0307416_100483642 Ga0307416_1004836421 254
231 3300032004 Ga0307414_10545988 Ga0307414_105459881 254
232 3300032005 Ga0307411_10157784 Ga0307411_101577842 254
233 3300032126 Ga0307415_100563110 Ga0307415_1005631101 254
234 3300034820 Ga0373959_0015380 Ga0373959_0015380_218_988 254
235 3300035085 Ga0373929_0016538 Ga0373929_0016538_465_1316 254
236 3300035115 Ga0373941_0007702 Ga0373941_0007702_793_1644 254
237 3300035207 Ga0373942_0001237 Ga0373942_0001237_5791_6642 254
238 3300037471 Ga0395905_0171634 Ga0395905_0171634_1201_1965 254
239 3300039437 Ga0436365_0573163 Ga0436365_0573163_497_1264 254
240 3300042156 Ga0439446_0002529 Ga0439446_0002529_1143_1907 254
241 3300042438 Ga0439459_0001606 Ga0439459_0001606_360_1124 254
242 3300044694 Ga0466963_0320873 Ga0466963_0320873_110_877 254
243 3300044735 Ga0466968_0052339 Ga0466968_0052339_384_1148 254
244 3300045976 Ga0466967_0335015 Ga0466967_0335015_645_1409 254
245 3300046460 Ga0495638_0000598 Ga0495638_0000598_6182_6946 254
246 3300046460 Ga0495638_0011362 Ga0495638_0011362_3578_4342 254
247 3300046471 Ga0495650_0000069 Ga0495650_0000069_144029_144793 254
248 3300046507 Ga0495606_0046122 Ga0495606_0046122_62_826 254
249 3300046513 Ga0495616_0110813 Ga0495616_0110813_203_967 254
250 3300046522 Ga0495643_0000512 Ga0495643_0000512_18737_19501 254
251 3300046522 Ga0495643_0076936 Ga0495643_0076936_498_1262 254
252 3300046522 Ga0495643_0098033 Ga0495643_0098033_43_807 254
253 3300046616 Ga0495668_0000067 Ga0495668_0000067_126840_127604 254
254 3300046616 Ga0495668_0003524 Ga0495668_0003524_5221_5985 254
255 3300046616 Ga0495668_0008921 Ga0495668_0008921_4898_5662 254
256 3300046616 Ga0495668_0021543 Ga0495668_0021543_948_1712 254
257 3300046660 Ga0495625_0000011 Ga0495625_0000011_25376_26140 254
258 3300046660 Ga0495625_0000979 Ga0495625_0000979_33930_34694 254
259 3300046660 Ga0495625_0004535 Ga0495625_0004535_11368_12132 254
260 3300046684 Ga0495669_0010816 Ga0495669_0010816_623_1387 254
261 3300047446 Ga0495679_009934 Ga0495679_009934_282_1046 254
262 3300047447 Ga0495685_083049 Ga0495685_083049_89_853 254
263 3300047469 Ga0495673_0000115 Ga0495673_0000115_76308_77072 254
264 3300047469 Ga0495673_0000160 Ga0495673_0000160_59767_60531 254
265 3300047469 Ga0495673_0000885 Ga0495673_0000885_21626_22390 254
266 3300047469 Ga0495673_0005215 Ga0495673_0005215_5506_6270 254
267 3300047472 Ga0495686_0000217 Ga0495686_0000217_61085_61849 254
268 3300048905 Ga0496102_0025192 Ga0496102_0025192_1533_2297 254
269 3300048905 Ga0496102_0770200 Ga0496102_0770200_10_777 254
270 3300048907 Ga0496104_0246085 Ga0496104_0246085_694_1461 254
271 3300048908 Ga0496105_0158103 Ga0496105_0158103_647_1414 254
272 3300048909 Ga0496106_0080207 Ga0496106_0080207_900_1667 254
273 3300048910 Ga0496107_0000036 Ga0496107_0000036_67671_68435 254
274 3300048911 Ga0496108_0397789 Ga0496108_0397789_304_1071 254
275 3300048912 Ga0496109_0186450 Ga0496109_0186450_1000_1767 254
276 3300048913 Ga0496110_0302299 Ga0496110_0302299_143_910 254
277 3300048915 Ga0496112_0001580 Ga0496112_0001580_8665_9516 254
278 3300048915 Ga0496112_0288985 Ga0496112_0288985_48_812 254
279 3300048916 Ga0496113_0062330 Ga0496113_0062330_1713_2564 254
280 3300048917 Ga0496114_0178799 Ga0496114_0178799_186_953 254
281 3300048924 Ga0496121_0000833 Ga0496121_0000833_33438_34202 254
282 3300048925 Ga0496122_0026670 Ga0496122_0026670_252_1016 254
283 3300048929 Ga0496126_0001931 Ga0496126_0001931_24744_25508 254
284 3300048929 Ga0496126_0069223 Ga0496126_0069223_654_1418 254
285 3300049570 Ga0501033_0000389 Ga0501033_0000389_8330_9094 254
286 3300049571 Ga0501034_0004974 Ga0501034_0004974_5324_6088 254
287 3300049571 Ga0501034_0577563 Ga0501034_0577563_12_776 254
288 3300049573 Ga0501037_0016740 Ga0501037_0016740_3983_4747 254
289 3300049581 Ga0501047_0345204 Ga0501047_0345204_287_1051 254
290 3300049823 Ga0501044_0001888 Ga0501044_0001888_19675_20439 254
291 3300049823 Ga0501044_0476366 Ga0501044_0476366_273_1037 254
292 3300050491 nmdc:mga00v17_131543_c1 nmdc:mga00v17_131543_c1_766_1539 254
293 3300050492 nmdc:mga0yw44_1727_c1 nmdc:mga0yw44_1727_c1_955_1728 254
294 3300050496 nmdc:mga07m45_97558_c1 nmdc:mga07m45_97558_c1_393_1157 254
295 3300050507 nmdc:mga05p37_15143_c1 nmdc:mga05p37_15143_c1_3019_3846 254
296 3300050512 nmdc:mga0n895_94418_c1 nmdc:mga0n895_94418_c1_281_1132 254
297 3300050514 nmdc:mga08x19_95757_c1 nmdc:mga08x19_95757_c1_1115_1885 254
298 3300050515 nmdc:mga0a205_10737_c1 nmdc:mga0a205_10737_c1_5042_5893 254
299 3300050516 nmdc:mga0sz30_74785_c1 nmdc:mga0sz30_74785_c1_76_849 254
300 3300053087 Ga0500643_038924 Ga0500643_038924_429_1193 254
301 3300053088 Ga0500644_0000084 Ga0500644_0000084_10941_11705 254
302 3300053094 Ga0500566_0258107 Ga0500566_0258107_13_777 254
303 3300053129 Ga0500628_000811 Ga0500628_000811_1652_2416 254
304 3300053134 Ga0500658_0014206 Ga0500658_0014206_100_864 254
305 3300053156 Ga0500622_0059912 Ga0500622_0059912_609_1373 254
306 3300053730 Ga0500645_000124 Ga0500645_000124_6679_7443 254
307 3300003214 JGI25165J46597_1000109 JGI25165J46597_1000109129 255
308 3300005331 Ga0070670_100086692 Ga0070670_1000866923 255
309 3300005347 Ga0070668_100023471 Ga0070668_1000234712 255
310 3300005353 Ga0070669_100007761 Ga0070669_1000077612 255
311 3300005355 Ga0070671_100003622 Ga0070671_1000036226 255
312 3300005367 Ga0070667_100000128 Ga0070667_1000001287 255
313 3300005367 Ga0070667_100299234 Ga0070667_1002992341 255
314 3300005548 Ga0070665_100000152 Ga0070665_1000001524 255
315 3300005841 Ga0068863_100003348 Ga0068863_10000334811 255
316 3300005841 Ga0068863_100025806 Ga0068863_1000258062 255
317 3300005844 Ga0068862_100003871 Ga0068862_1000038719 255
318 3300009011 Ga0105251_10000231 Ga0105251_1000023117 255
319 3300009177 Ga0105248_10053296 Ga0105248_100532965 255
320 3300025261 Ga0209233_1000167 Ga0209233_100016713 255
321 3300025735 Ga0207713_1007815 Ga0207713_10078152 255
322 3300025923 Ga0207681_10005590 Ga0207681_100055906 255
323 3300025931 Ga0207644_10009833 Ga0207644_100098332 255
324 3300025941 Ga0207711_10010503 Ga0207711_100105035 255
325 3300025972 Ga0207668_10005497 Ga0207668_100054975 255
326 3300025986 Ga0207658_10006277 Ga0207658_100062776 255
327 3300025986 Ga0207658_10008713 Ga0207658_100087132 255
328 3300026088 Ga0207641_10001645 Ga0207641_100016457 255
329 3300026088 Ga0207641_10017149 Ga0207641_100171493 255
330 3300028379 Ga0268266_10000125 Ga0268266_1000012512 255
331 3300028380 Ga0268265_10082645 Ga0268265_100826452 255
332 3300028380 Ga0268265_10480367 Ga0268265_104803671 255
333 3300041512 Ga0451853_3045660 Ga0451853_3045660_112_882 255
334 3300048924 Ga0496121_0003144 Ga0496121_0003144_20461_21231 255
335 3300048926 Ga0496123_0065182 Ga0496123_0065182_231_1001 255
336 3300048928 Ga0496125_0034397 Ga0496125_0034397_1874_2644 255
337 3300048928 Ga0496125_0191774 Ga0496125_0191774_374_1144 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

24

244

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8595 8 233
6nru-assembly5.cif.gz_E crystal structure of the alpha-ribazole phosphatase from shigella flexneri 0.8563 8 233
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8533 6 233
1c7z-assembly1.cif.gz_B regulatory complex of fructose-2,6-bisphosphatase 0.8472 7 235
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8457 8 231
ID Description Score Start End Superfamily
af_Q54SI2_327_480_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8728 68 200 3.40.50.1240
af_A0A368UGZ2_77_264_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8658 9 231 3.40.50.1240
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8639 8 231 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.861 9 210 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8595 8 233 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A2G1LJM6-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.989 1 228 GO:0006096
GO:0016868
AF-A0A4Q3YKX2-F1-model_v4 Histidine phosphatase family protein 0.9827 5 84 GO:0003824
AF-A0A1W1Y2R4-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9784 22 229 GO:0006096
GO:0016868
AF-A0A543HHW6-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9754 1 231 GO:0006096
GO:0016868
AF-A0A354IUG5-F1-model_v4 Histidine phosphatase family protein 0.9738 1 236 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
90.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map