F412974
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 230 | 328 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100467783|Ga0068867_1004677832 |
| Length | 270 |
| Sequence | MSARVAAEQWRTRPMTEQRWPDRLWIIRHGESAGNVARDAAHAAGLARIDIDYRDVDVPLSELGERQSCALGRWYASLPKDHRPDVVMTSPYVRARQTGELMRKEGGFALEADEAFKSDERLREKEFGILDRLTRTGITELHPDQAEFRRLLGKFYHRPPGGESWCDVILRLRSALDTISLHYSGRRVLILTHQVVVLCMRYLLENLTENEILEIDRQKDVANCAITEYRFDSTAGAGGGLVLERYNYLTPMEAAGAPVTAKPDFSVGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 2 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 3 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 4 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 5 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 6 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 7 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 8 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 9 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 176 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 225 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 226 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 227 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 228 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.03 |
| Metatranscriptomes | 0.3 |
| Isolates | 2.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.72 |
| Nodule | 0.3 |
| Rhizoplane | 3.86 |
| Rhizosphere | 81.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000109 | 3300003214 | Bacteria | 149484 |
| 2 | rootL2_10192996 | 3300003322 | Bacteria | 2747 |
| 3 | Ga0055524_1036205 | 3300003775 | Bacteria | 1331 |
| 4 | Ga0055536_1000910 | 3300003781 | Bacteria | 19125 |
| 5 | Ga0055530_10010429 | 3300003791 | Bacteria | 3435 |
| 6 | Ga0055531_10011259 | 3300003794 | Bacteria | 4340 |
| 7 | Ga0065715_10091066 | 3300005293 | Bacteria | 6153 |
| 8 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 9 | Ga0070658_10529610 | 3300005327 | Unclassified | 1019 |
| 10 | Ga0070676_10065121 | 3300005328 | Bacteria | 2175 |
| 11 | Ga0070676_10118279 | 3300005328 | Unclassified | 1659 |
| 12 | Ga0070683_100006827 | 3300005329 | Bacteria | 9593 |
| 13 | Ga0070683_100021508 | 3300005329 | Bacteria | 5758 |
| 14 | Ga0070670_100086692 | 3300005331 | Bacteria | 2690 |
| 15 | Ga0070670_100237913 | 3300005331 | Bacteria | 1585 |
| 16 | Ga0070680_100010441 | 3300005336 | Bacteria | 7161 |
| 17 | Ga0070680_100064634 | 3300005336 | Bacteria | 2999 |
| 18 | Ga0070680_100221995 | 3300005336 | Bacteria | 1595 |
| 19 | Ga0070682_100000451 | 3300005337 | Bacteria | 26141 |
| 20 | Ga0070682_100010042 | 3300005337 | Bacteria | 5364 |
| 21 | Ga0070682_100087607 | 3300005337 | Bacteria | 2030 |
| 22 | Ga0068868_100020286 | 3300005338 | Bacteria | 4989 |
| 23 | Ga0068868_100313283 | 3300005338 | Bacteria | 1335 |
| 24 | Ga0068868_100370203 | 3300005338 | Bacteria | 1231 |
| 25 | Ga0070660_100000535 | 3300005339 | Bacteria | 25358 |
| 26 | Ga0070660_100149858 | 3300005339 | Bacteria | 1875 |
| 27 | Ga0070691_10050790 | 3300005341 | Bacteria | 1979 |
| 28 | Ga0070687_100046734 | 3300005343 | Bacteria | 2217 |
| 29 | Ga0070661_100009980 | 3300005344 | Bacteria | 6589 |
| 30 | Ga0070692_10039731 | 3300005345 | Bacteria | 2403 |
| 31 | Ga0070692_10180783 | 3300005345 | Bacteria | 1222 |
| 32 | Ga0070692_10181965 | 3300005345 | Unclassified | 1219 |
| 33 | Ga0070668_100023471 | 3300005347 | Bacteria | 4665 |
| 34 | Ga0070668_100157306 | 3300005347 | Bacteria | 1842 |
| 35 | Ga0070669_100007761 | 3300005353 | Bacteria | 7669 |
| 36 | Ga0070671_100003622 | 3300005355 | Bacteria | 12090 |
| 37 | Ga0070671_100098202 | 3300005355 | Bacteria | 2456 |
| 38 | Ga0070671_100277998 | 3300005355 | Bacteria | 1424 |
| 39 | Ga0070674_100060298 | 3300005356 | Bacteria | 2644 |
| 40 | Ga0070674_100157954 | 3300005356 | Bacteria | 1718 |
| 41 | Ga0070674_100213573 | 3300005356 | Bacteria | 1497 |
| 42 | Ga0070673_100303623 | 3300005364 | Bacteria | 1406 |
| 43 | Ga0070659_100003683 | 3300005366 | Bacteria | 10928 |
| 44 | Ga0070667_100000128 | 3300005367 | Bacteria | 95780 |
| 45 | Ga0070667_100299234 | 3300005367 | Bacteria | 1448 |
| 46 | Ga0070701_10141277 | 3300005438 | Bacteria | 1377 |
| 47 | Ga0070700_100563412 | 3300005441 | Bacteria | 887 |
| 48 | Ga0070694_100132332 | 3300005444 | Bacteria | 1803 |
| 49 | Ga0070708_100000064 | 3300005445 | Bacteria | 69617 |
| 50 | Ga0070662_100044982 | 3300005457 | Bacteria | 3165 |
| 51 | Ga0070662_100145151 | 3300005457 | Bacteria | 1843 |
| 52 | Ga0070681_10006776 | 3300005458 | Bacteria | 11152 |
| 53 | Ga0070681_10018870 | 3300005458 | Bacteria | 6900 |
| 54 | Ga0070681_10036254 | 3300005458 | Bacteria | 4952 |
| 55 | Ga0068867_100049542 | 3300005459 | Bacteria | 3093 |
| 56 | Ga0068867_100088312 | 3300005459 | Bacteria | 2349 |
| 57 | Ga0068867_100467783 | 3300005459 | Unclassified | 1078 |
| 58 | Ga0070706_100063360 | 3300005467 | Bacteria | 3417 |
| 59 | Ga0070707_100000322 | 3300005468 | Bacteria | 47149 |
| 60 | Ga0070707_100295200 | 3300005468 | Bacteria | 1575 |
| 61 | Ga0070707_100482505 | 3300005468 | Bacteria | 1201 |
| 62 | Ga0070699_100057712 | 3300005518 | Bacteria | 3362 |
| 63 | Ga0070699_100161652 | 3300005518 | Bacteria | 1982 |
| 64 | Ga0070679_100003241 | 3300005530 | Bacteria | 14870 |
| 65 | Ga0070679_100019799 | 3300005530 | Bacteria | 6551 |
| 66 | Ga0070679_100020712 | 3300005530 | Bacteria | 6416 |
| 67 | Ga0070684_100012125 | 3300005535 | Bacteria | 6893 |
| 68 | Ga0070684_100305101 | 3300005535 | Bacteria | 1461 |
| 69 | Ga0070697_100013371 | 3300005536 | Bacteria | 6437 |
| 70 | Ga0070697_100058235 | 3300005536 | Bacteria | 3144 |
| 71 | Ga0068853_100096417 | 3300005539 | Bacteria | 2609 |
| 72 | Ga0070672_100141501 | 3300005543 | Bacteria | 1985 |
| 73 | Ga0070686_100011199 | 3300005544 | Bacteria | 5081 |
| 74 | Ga0070695_100034821 | 3300005545 | Unclassified | 3160 |
| 75 | Ga0070695_100423223 | 3300005545 | Bacteria | 1014 |
| 76 | Ga0070696_100004290 | 3300005546 | Bacteria | 9501 |
| 77 | Ga0070693_100048034 | 3300005547 | Unclassified | 2430 |
| 78 | Ga0070665_100000152 | 3300005548 | Bacteria | 126430 |
| 79 | Ga0070704_100093590 | 3300005549 | Bacteria | 2246 |
| 80 | Ga0068855_100242134 | 3300005563 | Bacteria | 2015 |
| 81 | Ga0070664_100000821 | 3300005564 | Bacteria | 23917 |
| 82 | Ga0070664_100231557 | 3300005564 | Bacteria | 1656 |
| 83 | Ga0068857_100002910 | 3300005577 | Bacteria | 14105 |
| 84 | Ga0068857_100276756 | 3300005577 | Bacteria | 1543 |
| 85 | Ga0068854_100087385 | 3300005578 | Bacteria | 2313 |
| 86 | Ga0068856_100120312 | 3300005614 | Bacteria | 2627 |
| 87 | Ga0068852_100603828 | 3300005616 | Bacteria | 1102 |
| 88 | Ga0068859_100431561 | 3300005617 | Bacteria | 1414 |
| 89 | Ga0068864_100017024 | 3300005618 | Bacteria | 6059 |
| 90 | Ga0068861_100063230 | 3300005719 | Unclassified | 2845 |
| 91 | Ga0068863_100003348 | 3300005841 | Bacteria | 15829 |
| 92 | Ga0068863_100025806 | 3300005841 | Bacteria | 5606 |
| 93 | Ga0068860_100071704 | 3300005843 | Bacteria | 3291 |
| 94 | Ga0068862_100003871 | 3300005844 | Bacteria | 12737 |
| 95 | Ga0068862_100172916 | 3300005844 | Bacteria | 1935 |
| 96 | Ga0070717_10090107 | 3300006028 | Bacteria | 2588 |
| 97 | Ga0075364_10147586 | 3300006051 | Bacteria | 1584 |
| 98 | Ga0070712_100464293 | 3300006175 | Bacteria | 1056 |
| 99 | Ga0075362_10049571 | 3300006177 | Bacteria | 1876 |
| 100 | Ga0075367_10241708 | 3300006178 | Bacteria | 1131 |
| 101 | Ga0075370_10072878 | 3300006353 | Bacteria | 1966 |
| 102 | Ga0068871_100385210 | 3300006358 | Bacteria | 1246 |
| 103 | Ga0075430_100165375 | 3300006846 | Bacteria | 1841 |
| 104 | Ga0075433_10005862 | 3300006852 | Bacteria | 9677 |
| 105 | Ga0075434_100004770 | 3300006871 | Bacteria | 12277 |
| 106 | Ga0068865_100020195 | 3300006881 | Bacteria | 4319 |
| 107 | Ga0075436_100050437 | 3300006914 | Bacteria | 2872 |
| 108 | Ga0097620_100431552 | 3300006931 | Bacteria | 1414 |
| 109 | Ga0075435_100004722 | 3300007076 | Bacteria | 9398 |
| 110 | Ga0105251_10000231 | 3300009011 | Bacteria | 56229 |
| 111 | Ga0105245_10046358 | 3300009098 | Bacteria | 3884 |
| 112 | Ga0105245_10061959 | 3300009098 | Bacteria | 3374 |
| 113 | Ga0114129_10034433 | 3300009147 | Bacteria | 7154 |
| 114 | Ga0105242_10086452 | 3300009176 | Unclassified | 2631 |
| 115 | Ga0105242_10166908 | 3300009176 | Bacteria | 1932 |
| 116 | Ga0105248_10053296 | 3300009177 | Bacteria | 4539 |
| 117 | Ga0105248_10092321 | 3300009177 | Bacteria | 3409 |
| 118 | Ga0105249_10053015 | 3300009553 | Bacteria | 3706 |
| 119 | Ga0157373_10085975 | 3300013100 | Bacteria | 2216 |
| 120 | Ga0157373_10227638 | 3300013100 | Bacteria | 1316 |
| 121 | Ga0157370_10325224 | 3300013104 | Bacteria | 1418 |
| 122 | Ga0157374_10138007 | 3300013296 | Bacteria | 2365 |
| 123 | Ga0157374_10369712 | 3300013296 | Bacteria | 1427 |
| 124 | Ga0163162_10105466 | 3300013306 | Unclassified | 2913 |
| 125 | Ga0163162_10655818 | 3300013306 | Bacteria | 1173 |
| 126 | Ga0157372_10630887 | 3300013307 | Bacteria | 1248 |
| 127 | Ga0157375_10046449 | 3300013308 | Bacteria | 4234 |
| 128 | Ga0163163_10069483 | 3300014325 | Bacteria | 3506 |
| 129 | Ga0157380_10614153 | 3300014326 | Bacteria | 1078 |
| 130 | Ga0157377_10300539 | 3300014745 | Bacteria | 1059 |
| 131 | Ga0163161_10187495 | 3300017792 | Unclassified | 1589 |
| 132 | Ga0213876_10094980 | 3300021384 | Bacteria | 1579 |
| 133 | Ga0213875_10002552 | 3300021388 | Bacteria | 10852 |
| 134 | Ga0224712_10044690 | 3300022467 | Bacteria | 1691 |
| 135 | Ga0209026_1003682 | 3300025250 | Bacteria | 4910 |
| 136 | Ga0209233_1000167 | 3300025261 | Bacteria | 149536 |
| 137 | Ga0209676_1000392 | 3300025292 | Bacteria | 79950 |
| 138 | Ga0209050_1001959 | 3300025298 | Bacteria | 19483 |
| 139 | Ga0209256_1000360 | 3300025299 | Bacteria | 74074 |
| 140 | Ga0209257_1000616 | 3300025304 | Bacteria | 57900 |
| 141 | Ga0207713_1007815 | 3300025735 | Bacteria | 6238 |
| 142 | Ga0207645_10007309 | 3300025907 | Bacteria | 7811 |
| 143 | Ga0207645_10022410 | 3300025907 | Bacteria | 4109 |
| 144 | Ga0207645_10182025 | 3300025907 | Unclassified | 1379 |
| 145 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 146 | Ga0207684_10036660 | 3300025910 | Bacteria | 4162 |
| 147 | Ga0207707_10001396 | 3300025912 | Bacteria | 22390 |
| 148 | Ga0207707_10037394 | 3300025912 | Bacteria | 4243 |
| 149 | Ga0207707_10038263 | 3300025912 | Bacteria | 4192 |
| 150 | Ga0207695_10063379 | 3300025913 | Bacteria | 3812 |
| 151 | Ga0207663_10548261 | 3300025916 | Bacteria | 904 |
| 152 | Ga0207660_10018883 | 3300025917 | Bacteria | 4604 |
| 153 | Ga0207660_10035539 | 3300025917 | Bacteria | 3460 |
| 154 | Ga0207660_10264928 | 3300025917 | Bacteria | 1360 |
| 155 | Ga0207662_10043750 | 3300025918 | Bacteria | 2642 |
| 156 | Ga0207657_10005736 | 3300025919 | Bacteria | 12954 |
| 157 | Ga0207649_10008511 | 3300025920 | Bacteria | 5595 |
| 158 | Ga0207649_10159734 | 3300025920 | Bacteria | 1561 |
| 159 | Ga0207652_10003141 | 3300025921 | Bacteria | 13758 |
| 160 | Ga0207652_10103540 | 3300025921 | Bacteria | 2517 |
| 161 | Ga0207652_10129352 | 3300025921 | Bacteria | 2251 |
| 162 | Ga0207652_10718827 | 3300025921 | Bacteria | 890 |
| 163 | Ga0207646_10000686 | 3300025922 | Bacteria | 43791 |
| 164 | Ga0207646_10147175 | 3300025922 | Bacteria | 2123 |
| 165 | Ga0207681_10005590 | 3300025923 | Bacteria | 7721 |
| 166 | Ga0207650_10255369 | 3300025925 | Bacteria | 1420 |
| 167 | Ga0207687_10525153 | 3300025927 | Bacteria | 990 |
| 168 | Ga0207644_10009833 | 3300025931 | Bacteria | 6291 |
| 169 | Ga0207644_10133695 | 3300025931 | Bacteria | 1902 |
| 170 | Ga0207690_10008234 | 3300025932 | Bacteria | 6184 |
| 171 | Ga0207690_10026555 | 3300025932 | Bacteria | 3647 |
| 172 | Ga0207706_10001267 | 3300025933 | Bacteria | 25478 |
| 173 | Ga0207706_10193858 | 3300025933 | Bacteria | 1783 |
| 174 | Ga0207669_10037681 | 3300025937 | Bacteria | 2777 |
| 175 | Ga0207669_10380158 | 3300025937 | Bacteria | 1100 |
| 176 | Ga0207704_10487750 | 3300025938 | Bacteria | 991 |
| 177 | Ga0207711_10010503 | 3300025941 | Bacteria | 7691 |
| 178 | Ga0207661_10001172 | 3300025944 | Bacteria | 17516 |
| 179 | Ga0207661_10015214 | 3300025944 | Bacteria | 5658 |
| 180 | Ga0207661_10049391 | 3300025944 | Bacteria | 3349 |
| 181 | Ga0207679_10061987 | 3300025945 | Bacteria | 2785 |
| 182 | Ga0207679_10073110 | 3300025945 | Bacteria | 2593 |
| 183 | Ga0207651_10361194 | 3300025960 | Bacteria | 1226 |
| 184 | Ga0207668_10005497 | 3300025972 | Bacteria | 7469 |
| 185 | Ga0207640_10087656 | 3300025981 | Bacteria | 2146 |
| 186 | Ga0207658_10006277 | 3300025986 | Bacteria | 8122 |
| 187 | Ga0207658_10008713 | 3300025986 | Bacteria | 6892 |
| 188 | Ga0207677_10131841 | 3300026023 | Bacteria | 1899 |
| 189 | Ga0207639_10054415 | 3300026041 | Bacteria | 3058 |
| 190 | Ga0207678_10468349 | 3300026067 | Bacteria | 1096 |
| 191 | Ga0207708_10015751 | 3300026075 | Bacteria | 5673 |
| 192 | Ga0207708_10023598 | 3300026075 | Bacteria | 4651 |
| 193 | Ga0207702_10211162 | 3300026078 | Bacteria | 1805 |
| 194 | Ga0207641_10001645 | 3300026088 | Bacteria | 21795 |
| 195 | Ga0207641_10013703 | 3300026088 | Bacteria | 6654 |
| 196 | Ga0207641_10017149 | 3300026088 | Bacteria | 5924 |
| 197 | Ga0207648_10014478 | 3300026089 | Bacteria | 7286 |
| 198 | Ga0207648_10090596 | 3300026089 | Bacteria | 2672 |
| 199 | Ga0207648_10293399 | 3300026089 | Bacteria | 1456 |
| 200 | Ga0207676_10014958 | 3300026095 | Bacteria | 5591 |
| 201 | Ga0207674_10001612 | 3300026116 | Bacteria | 29060 |
| 202 | Ga0207674_10248127 | 3300026116 | Bacteria | 1727 |
| 203 | Ga0207675_100093027 | 3300026118 | Unclassified | 2835 |
| 204 | Ga0207683_10006044 | 3300026121 | Bacteria | 10364 |
| 205 | Ga0207698_10131606 | 3300026142 | Bacteria | 2139 |
| 206 | Ga0209981_1008869 | 3300027378 | Bacteria | 1368 |
| 207 | Ga0209999_1000768 | 3300027543 | Bacteria | 5258 |
| 208 | Ga0209974_10042705 | 3300027876 | Bacteria | 1509 |
| 209 | Ga0268266_10000125 | 3300028379 | Bacteria | 151647 |
| 210 | Ga0268265_10082645 | 3300028380 | Bacteria | 2540 |
| 211 | Ga0268265_10480367 | 3300028380 | Bacteria | 1167 |
| 212 | Ga0268264_10602845 | 3300028381 | Bacteria | 1082 |
| 213 | Ga0307513_10000063 | 3300031456 | Bacteria | 142538 |
| 214 | Ga0307513_10311557 | 3300031456 | Bacteria | 1336 |
| 215 | Ga0307408_100005022 | 3300031548 | Bacteria | 8872 |
| 216 | Ga0307408_100010039 | 3300031548 | Bacteria | 6241 |
| 217 | Ga0307405_10259325 | 3300031731 | Bacteria | 1297 |
| 218 | Ga0307405_10314687 | 3300031731 | Bacteria | 1193 |
| 219 | Ga0307413_10000476 | 3300031824 | Bacteria | 13075 |
| 220 | Ga0307413_10045389 | 3300031824 | Bacteria | 2604 |
| 221 | Ga0307413_10352347 | 3300031824 | Bacteria | 1136 |
| 222 | Ga0307410_10001560 | 3300031852 | Bacteria | 10462 |
| 223 | Ga0307410_10068882 | 3300031852 | Bacteria | 2445 |
| 224 | Ga0307406_10001480 | 3300031901 | Bacteria | 12968 |
| 225 | Ga0307406_10019277 | 3300031901 | Bacteria | 4001 |
| 226 | Ga0307406_10052311 | 3300031901 | Bacteria | 2597 |
| 227 | Ga0307407_10006194 | 3300031903 | Bacteria | 5286 |
| 228 | Ga0307407_10007464 | 3300031903 | Bacteria | 4954 |
| 229 | Ga0307407_10074698 | 3300031903 | Bacteria | 2029 |
| 230 | Ga0307412_10000752 | 3300031911 | Bacteria | 18803 |
| 231 | Ga0307412_10140264 | 3300031911 | Bacteria | 1769 |
| 232 | Ga0307409_100006277 | 3300031995 | Bacteria | 6963 |
| 233 | Ga0307409_100084731 | 3300031995 | Bacteria | 2574 |
| 234 | Ga0307416_100483642 | 3300032002 | Bacteria | 1299 |
| 235 | Ga0307414_10001645 | 3300032004 | Bacteria | 11627 |
| 236 | Ga0307414_10545988 | 3300032004 | Bacteria | 1032 |
| 237 | Ga0307414_10701142 | 3300032004 | Bacteria | 916 |
| 238 | Ga0307411_10000921 | 3300032005 | Bacteria | 11186 |
| 239 | Ga0307411_10002803 | 3300032005 | Bacteria | 7851 |
| 240 | Ga0307411_10117818 | 3300032005 | Bacteria | 1914 |
| 241 | Ga0307411_10157784 | 3300032005 | Bacteria | 1695 |
| 242 | Ga0307415_100002100 | 3300032126 | Bacteria | 9853 |
| 243 | Ga0307415_100016853 | 3300032126 | Bacteria | 4367 |
| 244 | Ga0307415_100379737 | 3300032126 | Bacteria | 1199 |
| 245 | Ga0307415_100563110 | 3300032126 | Bacteria | 1008 |
| 246 | Ga0373959_0015380 | 3300034820 | Bacteria | 1405 |
| 247 | Ga0373929_0016538 | 3300035085 | Bacteria | 1446 |
| 248 | Ga0373941_0007702 | 3300035115 | Bacteria | 2645 |
| 249 | Ga0373942_0001237 | 3300035207 | Bacteria | 6709 |
| 250 | Ga0395905_0171634 | 3300037471 | Bacteria | 2037 |
| 251 | Ga0436364_0838050 | 3300037853 | Bacteria | 8858 |
| 252 | Ga0436365_0573163 | 3300039437 | Bacteria | 7193 |
| 253 | Ga0451853_3045660 | 3300041512 | Bacteria | 1018 |
| 254 | Ga0439446_0002529 | 3300042156 | Bacteria | 4398 |
| 255 | Ga0439459_0001606 | 3300042438 | Bacteria | 3366 |
| 256 | Ga0466963_0320873 | 3300044694 | Bacteria | 1090 |
| 257 | Ga0466968_0052339 | 3300044735 | Bacteria | 1746 |
| 258 | Ga0466967_0335015 | 3300045976 | Bacteria | 1462 |
| 259 | Ga0495638_0000598 | 3300046460 | Bacteria | 40631 |
| 260 | Ga0495638_0011362 | 3300046460 | Bacteria | 6136 |
| 261 | Ga0495650_0000069 | 3300046471 | Bacteria | 261124 |
| 262 | Ga0495606_0046122 | 3300046507 | Bacteria | 2883 |
| 263 | Ga0495616_0110813 | 3300046513 | Bacteria | 1275 |
| 264 | Ga0495643_0000512 | 3300046522 | Bacteria | 48356 |
| 265 | Ga0495643_0076936 | 3300046522 | Bacteria | 1744 |
| 266 | Ga0495643_0098033 | 3300046522 | Bacteria | 1505 |
| 267 | Ga0495668_0000067 | 3300046616 | Bacteria | 176418 |
| 268 | Ga0495668_0003524 | 3300046616 | Bacteria | 11657 |
| 269 | Ga0495668_0008921 | 3300046616 | Bacteria | 6201 |
| 270 | Ga0495668_0021543 | 3300046616 | Bacteria | 3694 |
| 271 | Ga0495625_0000011 | 3300046660 | Bacteria | 377120 |
| 272 | Ga0495625_0000979 | 3300046660 | Bacteria | 37941 |
| 273 | Ga0495625_0004535 | 3300046660 | Bacteria | 13093 |
| 274 | Ga0495669_0010816 | 3300046684 | Bacteria | 3863 |
| 275 | Ga0495679_009934 | 3300047446 | Bacteria | 3771 |
| 276 | Ga0495685_083049 | 3300047447 | Bacteria | 1066 |
| 277 | Ga0495673_0000115 | 3300047469 | Bacteria | 154414 |
| 278 | Ga0495673_0000160 | 3300047469 | Bacteria | 115718 |
| 279 | Ga0495673_0000885 | 3300047469 | Bacteria | 27564 |
| 280 | Ga0495673_0005215 | 3300047469 | Bacteria | 7900 |
| 281 | Ga0495686_0000217 | 3300047472 | Bacteria | 105681 |
| 282 | Ga0496102_0025192 | 3300048905 | Bacteria | 5293 |
| 283 | Ga0496102_0770200 | 3300048905 | Bacteria | 885 |
| 284 | Ga0496104_0246085 | 3300048907 | Unclassified | 1701 |
| 285 | Ga0496105_0158103 | 3300048908 | Bacteria | 1861 |
| 286 | Ga0496106_0080207 | 3300048909 | Plasmid | 2506 |
| 287 | Ga0496107_0000036 | 3300048910 | Bacteria | 79369 |
| 288 | Ga0496108_0397789 | 3300048911 | Unclassified | 1203 |
| 289 | Ga0496109_0186450 | 3300048912 | Bacteria | 1949 |
| 290 | Ga0496110_0302299 | 3300048913 | Unclassified | 1457 |
| 291 | Ga0496112_0001580 | 3300048915 | Bacteria | 17611 |
| 292 | Ga0496112_0288985 | 3300048915 | Bacteria | 1586 |
| 293 | Ga0496113_0062330 | 3300048916 | Bacteria | 2816 |
| 294 | Ga0496114_0178799 | 3300048917 | Unclassified | 1852 |
| 295 | Ga0496116_0047728 | 3300048919 | Bacteria | 2880 |
| 296 | Ga0496121_0000833 | 3300048924 | Bacteria | 56021 |
| 297 | Ga0496121_0003144 | 3300048924 | Bacteria | 23828 |
| 298 | Ga0496122_0026670 | 3300048925 | Bacteria | 4972 |
| 299 | Ga0496123_0065182 | 3300048926 | Bacteria | 2317 |
| 300 | Ga0496125_0034397 | 3300048928 | Bacteria | 4467 |
| 301 | Ga0496125_0191774 | 3300048928 | Bacteria | 1348 |
| 302 | Ga0496126_0001931 | 3300048929 | Bacteria | 29568 |
| 303 | Ga0496126_0069223 | 3300048929 | Bacteria | 3149 |
| 304 | Ga0501033_0000389 | 3300049570 | Bacteria | 42230 |
| 305 | Ga0501034_0004974 | 3300049571 | Bacteria | 14623 |
| 306 | Ga0501034_0577563 | 3300049571 | Bacteria | 1031 |
| 307 | Ga0501037_0016740 | 3300049573 | Bacteria | 5394 |
| 308 | Ga0501047_0345204 | 3300049581 | Bacteria | 1326 |
| 309 | Ga0501070_0041956 | 3300049586 | Bacteria | 3810 |
| 310 | Ga0501044_0001888 | 3300049823 | Bacteria | 24278 |
| 311 | Ga0501044_0376992 | 3300049823 | Bacteria | 1334 |
| 312 | Ga0501044_0476366 | 3300049823 | Bacteria | 1152 |
| 313 | nmdc:mga03683_42849_c1 | 3300050489 | Bacteria | 1864 |
| 314 | nmdc:mga00v17_131543_c1 | 3300050491 | Bacteria | 1599 |
| 315 | nmdc:mga0yw44_1727_c1 | 3300050492 | Bacteria | 8872 |
| 316 | nmdc:mga07m45_97558_c1 | 3300050496 | Bacteria | 1686 |
| 317 | nmdc:mga05p37_15143_c1 | 3300050507 | Bacteria | 9260 |
| 318 | nmdc:mga0n895_94418_c1 | 3300050512 | Bacteria | 2995 |
| 319 | nmdc:mga08x19_95757_c1 | 3300050514 | Bacteria | 1964 |
| 320 | nmdc:mga0a205_10737_c1 | 3300050515 | Bacteria | 8420 |
| 321 | nmdc:mga0sz30_74785_c1 | 3300050516 | Bacteria | 864 |
| 322 | Ga0500643_038924 | 3300053087 | Bacteria | 1407 |
| 323 | Ga0500644_0000084 | 3300053088 | Bacteria | 57829 |
| 324 | Ga0500566_0258107 | 3300053094 | Bacteria | 843 |
| 325 | Ga0500628_000811 | 3300053129 | Bacteria | 5551 |
| 326 | Ga0500658_0014206 | 3300053134 | Bacteria | 2946 |
| 327 | Ga0500622_0059912 | 3300053156 | Bacteria | 1943 |
| 328 | Ga0500645_000124 | 3300053730 | Bacteria | 61241 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026142 | Ga0207698_10131606 | Ga0207698_101316061 | 233 |
| 2 | 3300049586 | Ga0501070_0041956 | Ga0501070_0041956_640_1347 | 235 |
| 3 | 3300005535 | Ga0070684_100305101 | Ga0070684_1003051011 | 240 |
| 4 | 3300005564 | Ga0070664_100231557 | Ga0070664_1002315572 | 240 |
| 5 | 3300025945 | Ga0207679_10073110 | Ga0207679_100731102 | 240 |
| 6 | 3300031548 | Ga0307408_100005022 | Ga0307408_1000050223 | 240 |
| 7 | 3300031548 | Ga0307408_100010039 | Ga0307408_1000100396 | 240 |
| 8 | 3300031731 | Ga0307405_10259325 | Ga0307405_102593251 | 240 |
| 9 | 3300031824 | Ga0307413_10045389 | Ga0307413_100453893 | 240 |
| 10 | 3300031852 | Ga0307410_10001560 | Ga0307410_100015602 | 240 |
| 11 | 3300031901 | Ga0307406_10001480 | Ga0307406_100014808 | 240 |
| 12 | 3300031901 | Ga0307406_10019277 | Ga0307406_100192774 | 240 |
| 13 | 3300031903 | Ga0307407_10006194 | Ga0307407_100061945 | 240 |
| 14 | 3300031903 | Ga0307407_10007464 | Ga0307407_100074641 | 240 |
| 15 | 3300031911 | Ga0307412_10000752 | Ga0307412_100007527 | 240 |
| 16 | 3300031911 | Ga0307412_10140264 | Ga0307412_101402641 | 240 |
| 17 | 3300031995 | Ga0307409_100084731 | Ga0307409_1000847311 | 240 |
| 18 | 3300032004 | Ga0307414_10001645 | Ga0307414_1000164510 | 240 |
| 19 | 3300032004 | Ga0307414_10701142 | Ga0307414_107011421 | 240 |
| 20 | 3300032005 | Ga0307411_10000921 | Ga0307411_1000092110 | 240 |
| 21 | 3300032005 | Ga0307411_10117818 | Ga0307411_101178182 | 240 |
| 22 | 3300032126 | Ga0307415_100002100 | Ga0307415_1000021003 | 240 |
| 23 | 3300031731 | Ga0307405_10314687 | Ga0307405_103146871 | 242 |
| 24 | 3300031824 | Ga0307413_10000476 | Ga0307413_1000047612 | 242 |
| 25 | 3300031852 | Ga0307410_10068882 | Ga0307410_100688822 | 242 |
| 26 | 3300031901 | Ga0307406_10052311 | Ga0307406_100523113 | 242 |
| 27 | 3300031903 | Ga0307407_10074698 | Ga0307407_100746982 | 242 |
| 28 | 3300031995 | Ga0307409_100006277 | Ga0307409_1000062776 | 242 |
| 29 | 3300032005 | Ga0307411_10002803 | Ga0307411_100028031 | 242 |
| 30 | 3300032126 | Ga0307415_100016853 | Ga0307415_1000168532 | 242 |
| 31 | 3300032126 | Ga0307415_100379737 | Ga0307415_1003797372 | 242 |
| 32 | 3300005617 | Ga0068859_100431561 | Ga0068859_1004315612 | 250 |
| 33 | 3300006931 | Ga0097620_100431552 | Ga0097620_1004315522 | 250 |
| 34 | iso_pu_bacteria | 2643221552 | 2643782400 | 250 |
| 35 | iso_pu_bacteria | 2643221584 | 2643930938 | 250 |
| 36 | iso_pu_bacteria | 2738541281 | 2738747250 | 250 |
| 37 | iso_pu_bacteria | 2738543032 | 2739356479 | 250 |
| 38 | iso_pu_bacteria | 2791355048 | 2792462534 | 250 |
| 39 | iso_pu_bacteria | 2842333319 | 2842336555 | 250 |
| 40 | iso_pu_bacteria | 2843744320 | 2843748582 | 250 |
| 41 | iso_pu_bacteria | 2857504554 | 2857508601 | 250 |
| 42 | iso_pu_bacteria | 2883577096 | 2883579930 | 250 |
| 43 | 3300048919 | Ga0496116_0047728 | Ga0496116_0047728_1446_2207 | 251 |
| 44 | 3300021388 | Ga0213875_10002552 | Ga0213875_100025527 | 252 |
| 45 | 3300037853 | Ga0436364_0838050 | Ga0436364_0838050_4343_5101 | 252 |
| 46 | 3300005328 | Ga0070676_10118279 | Ga0070676_101182792 | 253 |
| 47 | 3300005616 | Ga0068852_100603828 | Ga0068852_1006038282 | 253 |
| 48 | 3300006177 | Ga0075362_10049571 | Ga0075362_100495712 | 253 |
| 49 | 3300013104 | Ga0157370_10325224 | Ga0157370_103252242 | 253 |
| 50 | 3300025907 | Ga0207645_10182025 | Ga0207645_101820252 | 253 |
| 51 | 3300031456 | Ga0307513_10000063 | Ga0307513_1000006315 | 253 |
| 52 | 3300049823 | Ga0501044_0376992 | Ga0501044_0376992_53_814 | 253 |
| 53 | 3300050489 | nmdc:mga03683_42849_c1 | nmdc:mga03683_42849_c1_725_1486 | 253 |
| 54 | 3300003322 | rootL2_10192996 | rootL2_101929965 | 254 |
| 55 | 3300003775 | Ga0055524_1036205 | Ga0055524_10362051 | 254 |
| 56 | 3300003781 | Ga0055536_1000910 | Ga0055536_10009102 | 254 |
| 57 | 3300003791 | Ga0055530_10010429 | Ga0055530_100104293 | 254 |
| 58 | 3300003794 | Ga0055531_10011259 | Ga0055531_100112595 | 254 |
| 59 | 3300005293 | Ga0065715_10091066 | Ga0065715_100910666 | 254 |
| 60 | 3300005327 | Ga0070658_10000002 | Ga0070658_1000000221 | 254 |
| 61 | 3300005327 | Ga0070658_10529610 | Ga0070658_105296102 | 254 |
| 62 | 3300005328 | Ga0070676_10065121 | Ga0070676_100651213 | 254 |
| 63 | 3300005329 | Ga0070683_100006827 | Ga0070683_1000068274 | 254 |
| 64 | 3300005329 | Ga0070683_100021508 | Ga0070683_1000215085 | 254 |
| 65 | 3300005331 | Ga0070670_100237913 | Ga0070670_1002379132 | 254 |
| 66 | 3300005336 | Ga0070680_100010441 | Ga0070680_1000104413 | 254 |
| 67 | 3300005336 | Ga0070680_100064634 | Ga0070680_1000646342 | 254 |
| 68 | 3300005336 | Ga0070680_100221995 | Ga0070680_1002219951 | 254 |
| 69 | 3300005337 | Ga0070682_100000451 | Ga0070682_10000045119 | 254 |
| 70 | 3300005337 | Ga0070682_100010042 | Ga0070682_1000100422 | 254 |
| 71 | 3300005337 | Ga0070682_100087607 | Ga0070682_1000876072 | 254 |
| 72 | 3300005338 | Ga0068868_100020286 | Ga0068868_1000202863 | 254 |
| 73 | 3300005338 | Ga0068868_100313283 | Ga0068868_1003132832 | 254 |
| 74 | 3300005338 | Ga0068868_100370203 | Ga0068868_1003702031 | 254 |
| 75 | 3300005339 | Ga0070660_100000535 | Ga0070660_10000053513 | 254 |
| 76 | 3300005339 | Ga0070660_100149858 | Ga0070660_1001498582 | 254 |
| 77 | 3300005341 | Ga0070691_10050790 | Ga0070691_100507902 | 254 |
| 78 | 3300005343 | Ga0070687_100046734 | Ga0070687_1000467343 | 254 |
| 79 | 3300005344 | Ga0070661_100009980 | Ga0070661_1000099805 | 254 |
| 80 | 3300005345 | Ga0070692_10039731 | Ga0070692_100397312 | 254 |
| 81 | 3300005345 | Ga0070692_10180783 | Ga0070692_101807831 | 254 |
| 82 | 3300005345 | Ga0070692_10181965 | Ga0070692_101819652 | 254 |
| 83 | 3300005347 | Ga0070668_100157306 | Ga0070668_1001573063 | 254 |
| 84 | 3300005355 | Ga0070671_100098202 | Ga0070671_1000982021 | 254 |
| 85 | 3300005355 | Ga0070671_100277998 | Ga0070671_1002779981 | 254 |
| 86 | 3300005356 | Ga0070674_100060298 | Ga0070674_1000602982 | 254 |
| 87 | 3300005356 | Ga0070674_100157954 | Ga0070674_1001579543 | 254 |
| 88 | 3300005356 | Ga0070674_100213573 | Ga0070674_1002135732 | 254 |
| 89 | 3300005364 | Ga0070673_100303623 | Ga0070673_1003036232 | 254 |
| 90 | 3300005366 | Ga0070659_100003683 | Ga0070659_1000036836 | 254 |
| 91 | 3300005438 | Ga0070701_10141277 | Ga0070701_101412772 | 254 |
| 92 | 3300005441 | Ga0070700_100563412 | Ga0070700_1005634121 | 254 |
| 93 | 3300005444 | Ga0070694_100132332 | Ga0070694_1001323322 | 254 |
| 94 | 3300005445 | Ga0070708_100000064 | Ga0070708_10000006449 | 254 |
| 95 | 3300005457 | Ga0070662_100044982 | Ga0070662_1000449823 | 254 |
| 96 | 3300005457 | Ga0070662_100145151 | Ga0070662_1001451512 | 254 |
| 97 | 3300005458 | Ga0070681_10006776 | Ga0070681_100067764 | 254 |
| 98 | 3300005458 | Ga0070681_10018870 | Ga0070681_100188704 | 254 |
| 99 | 3300005458 | Ga0070681_10036254 | Ga0070681_100362545 | 254 |
| 100 | 3300005459 | Ga0068867_100049542 | Ga0068867_1000495423 | 254 |
| 101 | 3300005459 | Ga0068867_100088312 | Ga0068867_1000883123 | 254 |
| 102 | 3300005459 | Ga0068867_100467783 | Ga0068867_1004677832 | 254 |
| 103 | 3300005467 | Ga0070706_100063360 | Ga0070706_1000633604 | 254 |
| 104 | 3300005468 | Ga0070707_100000322 | Ga0070707_10000032224 | 254 |
| 105 | 3300005468 | Ga0070707_100295200 | Ga0070707_1002952002 | 254 |
| 106 | 3300005468 | Ga0070707_100482505 | Ga0070707_1004825051 | 254 |
| 107 | 3300005518 | Ga0070699_100057712 | Ga0070699_1000577122 | 254 |
| 108 | 3300005518 | Ga0070699_100161652 | Ga0070699_1001616522 | 254 |
| 109 | 3300005530 | Ga0070679_100003241 | Ga0070679_1000032419 | 254 |
| 110 | 3300005530 | Ga0070679_100019799 | Ga0070679_1000197992 | 254 |
| 111 | 3300005530 | Ga0070679_100020712 | Ga0070679_1000207122 | 254 |
| 112 | 3300005535 | Ga0070684_100012125 | Ga0070684_1000121256 | 254 |
| 113 | 3300005536 | Ga0070697_100013371 | Ga0070697_1000133713 | 254 |
| 114 | 3300005536 | Ga0070697_100058235 | Ga0070697_1000582352 | 254 |
| 115 | 3300005539 | Ga0068853_100096417 | Ga0068853_1000964172 | 254 |
| 116 | 3300005543 | Ga0070672_100141501 | Ga0070672_1001415013 | 254 |
| 117 | 3300005544 | Ga0070686_100011199 | Ga0070686_1000111994 | 254 |
| 118 | 3300005545 | Ga0070695_100034821 | Ga0070695_1000348213 | 254 |
| 119 | 3300005545 | Ga0070695_100423223 | Ga0070695_1004232231 | 254 |
| 120 | 3300005546 | Ga0070696_100004290 | Ga0070696_1000042908 | 254 |
| 121 | 3300005547 | Ga0070693_100048034 | Ga0070693_1000480342 | 254 |
| 122 | 3300005549 | Ga0070704_100093590 | Ga0070704_1000935903 | 254 |
| 123 | 3300005563 | Ga0068855_100242134 | Ga0068855_1002421342 | 254 |
| 124 | 3300005564 | Ga0070664_100000821 | Ga0070664_10000082118 | 254 |
| 125 | 3300005577 | Ga0068857_100002910 | Ga0068857_1000029108 | 254 |
| 126 | 3300005577 | Ga0068857_100276756 | Ga0068857_1002767562 | 254 |
| 127 | 3300005578 | Ga0068854_100087385 | Ga0068854_1000873853 | 254 |
| 128 | 3300005614 | Ga0068856_100120312 | Ga0068856_1001203122 | 254 |
| 129 | 3300005618 | Ga0068864_100017024 | Ga0068864_1000170247 | 254 |
| 130 | 3300005719 | Ga0068861_100063230 | Ga0068861_1000632302 | 254 |
| 131 | 3300005843 | Ga0068860_100071704 | Ga0068860_1000717042 | 254 |
| 132 | 3300005844 | Ga0068862_100172916 | Ga0068862_1001729161 | 254 |
| 133 | 3300006028 | Ga0070717_10090107 | Ga0070717_100901072 | 254 |
| 134 | 3300006051 | Ga0075364_10147586 | Ga0075364_101475861 | 254 |
| 135 | 3300006175 | Ga0070712_100464293 | Ga0070712_1004642931 | 254 |
| 136 | 3300006178 | Ga0075367_10241708 | Ga0075367_102417082 | 254 |
| 137 | 3300006353 | Ga0075370_10072878 | Ga0075370_100728782 | 254 |
| 138 | 3300006358 | Ga0068871_100385210 | Ga0068871_1003852102 | 254 |
| 139 | 3300006846 | Ga0075430_100165375 | Ga0075430_1001653752 | 254 |
| 140 | 3300006852 | Ga0075433_10005862 | Ga0075433_100058625 | 254 |
| 141 | 3300006871 | Ga0075434_100004770 | Ga0075434_1000047709 | 254 |
| 142 | 3300006881 | Ga0068865_100020195 | Ga0068865_1000201953 | 254 |
| 143 | 3300006914 | Ga0075436_100050437 | Ga0075436_1000504373 | 254 |
| 144 | 3300007076 | Ga0075435_100004722 | Ga0075435_1000047227 | 254 |
| 145 | 3300009098 | Ga0105245_10046358 | Ga0105245_100463584 | 254 |
| 146 | 3300009098 | Ga0105245_10061959 | Ga0105245_100619593 | 254 |
| 147 | 3300009147 | Ga0114129_10034433 | Ga0114129_100344336 | 254 |
| 148 | 3300009176 | Ga0105242_10086452 | Ga0105242_100864522 | 254 |
| 149 | 3300009176 | Ga0105242_10166908 | Ga0105242_101669081 | 254 |
| 150 | 3300009177 | Ga0105248_10092321 | Ga0105248_100923213 | 254 |
| 151 | 3300009553 | Ga0105249_10053015 | Ga0105249_100530154 | 254 |
| 152 | 3300013100 | Ga0157373_10085975 | Ga0157373_100859752 | 254 |
| 153 | 3300013100 | Ga0157373_10227638 | Ga0157373_102276382 | 254 |
| 154 | 3300013296 | Ga0157374_10138007 | Ga0157374_101380072 | 254 |
| 155 | 3300013296 | Ga0157374_10369712 | Ga0157374_103697122 | 254 |
| 156 | 3300013306 | Ga0163162_10105466 | Ga0163162_101054662 | 254 |
| 157 | 3300013306 | Ga0163162_10655818 | Ga0163162_106558182 | 254 |
| 158 | 3300013307 | Ga0157372_10630887 | Ga0157372_106308872 | 254 |
| 159 | 3300013308 | Ga0157375_10046449 | Ga0157375_100464492 | 254 |
| 160 | 3300014325 | Ga0163163_10069483 | Ga0163163_100694834 | 254 |
| 161 | 3300014326 | Ga0157380_10614153 | Ga0157380_106141531 | 254 |
| 162 | 3300014745 | Ga0157377_10300539 | Ga0157377_103005391 | 254 |
| 163 | 3300017792 | Ga0163161_10187495 | Ga0163161_101874952 | 254 |
| 164 | 3300021384 | Ga0213876_10094980 | Ga0213876_100949802 | 254 |
| 165 | 3300022467 | Ga0224712_10044690 | Ga0224712_100446902 | 254 |
| 166 | 3300025250 | Ga0209026_1003682 | Ga0209026_10036822 | 254 |
| 167 | 3300025292 | Ga0209676_1000392 | Ga0209676_100039266 | 254 |
| 168 | 3300025298 | Ga0209050_1001959 | Ga0209050_100195920 | 254 |
| 169 | 3300025299 | Ga0209256_1000360 | Ga0209256_100036037 | 254 |
| 170 | 3300025304 | Ga0209257_1000616 | Ga0209257_10006162 | 254 |
| 171 | 3300025907 | Ga0207645_10007309 | Ga0207645_100073092 | 254 |
| 172 | 3300025907 | Ga0207645_10022410 | Ga0207645_100224103 | 254 |
| 173 | 3300025909 | Ga0207705_10000005 | Ga0207705_10000005468 | 254 |
| 174 | 3300025910 | Ga0207684_10036660 | Ga0207684_100366602 | 254 |
| 175 | 3300025912 | Ga0207707_10001396 | Ga0207707_1000139620 | 254 |
| 176 | 3300025912 | Ga0207707_10037394 | Ga0207707_100373942 | 254 |
| 177 | 3300025912 | Ga0207707_10038263 | Ga0207707_100382632 | 254 |
| 178 | 3300025913 | Ga0207695_10063379 | Ga0207695_100633793 | 254 |
| 179 | 3300025916 | Ga0207663_10548261 | Ga0207663_105482612 | 254 |
| 180 | 3300025917 | Ga0207660_10018883 | Ga0207660_100188834 | 254 |
| 181 | 3300025917 | Ga0207660_10035539 | Ga0207660_100355392 | 254 |
| 182 | 3300025917 | Ga0207660_10264928 | Ga0207660_102649281 | 254 |
| 183 | 3300025918 | Ga0207662_10043750 | Ga0207662_100437503 | 254 |
| 184 | 3300025919 | Ga0207657_10005736 | Ga0207657_1000573614 | 254 |
| 185 | 3300025920 | Ga0207649_10008511 | Ga0207649_100085114 | 254 |
| 186 | 3300025920 | Ga0207649_10159734 | Ga0207649_101597342 | 254 |
| 187 | 3300025921 | Ga0207652_10003141 | Ga0207652_100031413 | 254 |
| 188 | 3300025921 | Ga0207652_10103540 | Ga0207652_101035403 | 254 |
| 189 | 3300025921 | Ga0207652_10129352 | Ga0207652_101293522 | 254 |
| 190 | 3300025921 | Ga0207652_10718827 | Ga0207652_107188271 | 254 |
| 191 | 3300025922 | Ga0207646_10000686 | Ga0207646_100006868 | 254 |
| 192 | 3300025922 | Ga0207646_10147175 | Ga0207646_101471752 | 254 |
| 193 | 3300025925 | Ga0207650_10255369 | Ga0207650_102553692 | 254 |
| 194 | 3300025927 | Ga0207687_10525153 | Ga0207687_105251531 | 254 |
| 195 | 3300025931 | Ga0207644_10133695 | Ga0207644_101336952 | 254 |
| 196 | 3300025932 | Ga0207690_10008234 | Ga0207690_100082346 | 254 |
| 197 | 3300025932 | Ga0207690_10026555 | Ga0207690_100265553 | 254 |
| 198 | 3300025933 | Ga0207706_10001267 | Ga0207706_100012678 | 254 |
| 199 | 3300025933 | Ga0207706_10193858 | Ga0207706_101938582 | 254 |
| 200 | 3300025937 | Ga0207669_10037681 | Ga0207669_100376814 | 254 |
| 201 | 3300025937 | Ga0207669_10380158 | Ga0207669_103801581 | 254 |
| 202 | 3300025938 | Ga0207704_10487750 | Ga0207704_104877502 | 254 |
| 203 | 3300025944 | Ga0207661_10001172 | Ga0207661_1000117218 | 254 |
| 204 | 3300025944 | Ga0207661_10015214 | Ga0207661_100152145 | 254 |
| 205 | 3300025944 | Ga0207661_10049391 | Ga0207661_100493911 | 254 |
| 206 | 3300025945 | Ga0207679_10061987 | Ga0207679_100619873 | 254 |
| 207 | 3300025960 | Ga0207651_10361194 | Ga0207651_103611942 | 254 |
| 208 | 3300025981 | Ga0207640_10087656 | Ga0207640_100876563 | 254 |
| 209 | 3300026023 | Ga0207677_10131841 | Ga0207677_101318413 | 254 |
| 210 | 3300026041 | Ga0207639_10054415 | Ga0207639_100544153 | 254 |
| 211 | 3300026067 | Ga0207678_10468349 | Ga0207678_104683491 | 254 |
| 212 | 3300026075 | Ga0207708_10015751 | Ga0207708_100157515 | 254 |
| 213 | 3300026075 | Ga0207708_10023598 | Ga0207708_100235985 | 254 |
| 214 | 3300026078 | Ga0207702_10211162 | Ga0207702_102111622 | 254 |
| 215 | 3300026088 | Ga0207641_10013703 | Ga0207641_100137037 | 254 |
| 216 | 3300026089 | Ga0207648_10014478 | Ga0207648_100144784 | 254 |
| 217 | 3300026089 | Ga0207648_10090596 | Ga0207648_100905962 | 254 |
| 218 | 3300026089 | Ga0207648_10293399 | Ga0207648_102933992 | 254 |
| 219 | 3300026095 | Ga0207676_10014958 | Ga0207676_100149585 | 254 |
| 220 | 3300026116 | Ga0207674_10001612 | Ga0207674_1000161220 | 254 |
| 221 | 3300026116 | Ga0207674_10248127 | Ga0207674_102481271 | 254 |
| 222 | 3300026118 | Ga0207675_100093027 | Ga0207675_1000930273 | 254 |
| 223 | 3300026121 | Ga0207683_10006044 | Ga0207683_100060444 | 254 |
| 224 | 3300027378 | Ga0209981_1008869 | Ga0209981_10088692 | 254 |
| 225 | 3300027543 | Ga0209999_1000768 | Ga0209999_10007683 | 254 |
| 226 | 3300027876 | Ga0209974_10042705 | Ga0209974_100427052 | 254 |
| 227 | 3300028381 | Ga0268264_10602845 | Ga0268264_106028451 | 254 |
| 228 | 3300031456 | Ga0307513_10311557 | Ga0307513_103115572 | 254 |
| 229 | 3300031824 | Ga0307413_10352347 | Ga0307413_103523471 | 254 |
| 230 | 3300032002 | Ga0307416_100483642 | Ga0307416_1004836421 | 254 |
| 231 | 3300032004 | Ga0307414_10545988 | Ga0307414_105459881 | 254 |
| 232 | 3300032005 | Ga0307411_10157784 | Ga0307411_101577842 | 254 |
| 233 | 3300032126 | Ga0307415_100563110 | Ga0307415_1005631101 | 254 |
| 234 | 3300034820 | Ga0373959_0015380 | Ga0373959_0015380_218_988 | 254 |
| 235 | 3300035085 | Ga0373929_0016538 | Ga0373929_0016538_465_1316 | 254 |
| 236 | 3300035115 | Ga0373941_0007702 | Ga0373941_0007702_793_1644 | 254 |
| 237 | 3300035207 | Ga0373942_0001237 | Ga0373942_0001237_5791_6642 | 254 |
| 238 | 3300037471 | Ga0395905_0171634 | Ga0395905_0171634_1201_1965 | 254 |
| 239 | 3300039437 | Ga0436365_0573163 | Ga0436365_0573163_497_1264 | 254 |
| 240 | 3300042156 | Ga0439446_0002529 | Ga0439446_0002529_1143_1907 | 254 |
| 241 | 3300042438 | Ga0439459_0001606 | Ga0439459_0001606_360_1124 | 254 |
| 242 | 3300044694 | Ga0466963_0320873 | Ga0466963_0320873_110_877 | 254 |
| 243 | 3300044735 | Ga0466968_0052339 | Ga0466968_0052339_384_1148 | 254 |
| 244 | 3300045976 | Ga0466967_0335015 | Ga0466967_0335015_645_1409 | 254 |
| 245 | 3300046460 | Ga0495638_0000598 | Ga0495638_0000598_6182_6946 | 254 |
| 246 | 3300046460 | Ga0495638_0011362 | Ga0495638_0011362_3578_4342 | 254 |
| 247 | 3300046471 | Ga0495650_0000069 | Ga0495650_0000069_144029_144793 | 254 |
| 248 | 3300046507 | Ga0495606_0046122 | Ga0495606_0046122_62_826 | 254 |
| 249 | 3300046513 | Ga0495616_0110813 | Ga0495616_0110813_203_967 | 254 |
| 250 | 3300046522 | Ga0495643_0000512 | Ga0495643_0000512_18737_19501 | 254 |
| 251 | 3300046522 | Ga0495643_0076936 | Ga0495643_0076936_498_1262 | 254 |
| 252 | 3300046522 | Ga0495643_0098033 | Ga0495643_0098033_43_807 | 254 |
| 253 | 3300046616 | Ga0495668_0000067 | Ga0495668_0000067_126840_127604 | 254 |
| 254 | 3300046616 | Ga0495668_0003524 | Ga0495668_0003524_5221_5985 | 254 |
| 255 | 3300046616 | Ga0495668_0008921 | Ga0495668_0008921_4898_5662 | 254 |
| 256 | 3300046616 | Ga0495668_0021543 | Ga0495668_0021543_948_1712 | 254 |
| 257 | 3300046660 | Ga0495625_0000011 | Ga0495625_0000011_25376_26140 | 254 |
| 258 | 3300046660 | Ga0495625_0000979 | Ga0495625_0000979_33930_34694 | 254 |
| 259 | 3300046660 | Ga0495625_0004535 | Ga0495625_0004535_11368_12132 | 254 |
| 260 | 3300046684 | Ga0495669_0010816 | Ga0495669_0010816_623_1387 | 254 |
| 261 | 3300047446 | Ga0495679_009934 | Ga0495679_009934_282_1046 | 254 |
| 262 | 3300047447 | Ga0495685_083049 | Ga0495685_083049_89_853 | 254 |
| 263 | 3300047469 | Ga0495673_0000115 | Ga0495673_0000115_76308_77072 | 254 |
| 264 | 3300047469 | Ga0495673_0000160 | Ga0495673_0000160_59767_60531 | 254 |
| 265 | 3300047469 | Ga0495673_0000885 | Ga0495673_0000885_21626_22390 | 254 |
| 266 | 3300047469 | Ga0495673_0005215 | Ga0495673_0005215_5506_6270 | 254 |
| 267 | 3300047472 | Ga0495686_0000217 | Ga0495686_0000217_61085_61849 | 254 |
| 268 | 3300048905 | Ga0496102_0025192 | Ga0496102_0025192_1533_2297 | 254 |
| 269 | 3300048905 | Ga0496102_0770200 | Ga0496102_0770200_10_777 | 254 |
| 270 | 3300048907 | Ga0496104_0246085 | Ga0496104_0246085_694_1461 | 254 |
| 271 | 3300048908 | Ga0496105_0158103 | Ga0496105_0158103_647_1414 | 254 |
| 272 | 3300048909 | Ga0496106_0080207 | Ga0496106_0080207_900_1667 | 254 |
| 273 | 3300048910 | Ga0496107_0000036 | Ga0496107_0000036_67671_68435 | 254 |
| 274 | 3300048911 | Ga0496108_0397789 | Ga0496108_0397789_304_1071 | 254 |
| 275 | 3300048912 | Ga0496109_0186450 | Ga0496109_0186450_1000_1767 | 254 |
| 276 | 3300048913 | Ga0496110_0302299 | Ga0496110_0302299_143_910 | 254 |
| 277 | 3300048915 | Ga0496112_0001580 | Ga0496112_0001580_8665_9516 | 254 |
| 278 | 3300048915 | Ga0496112_0288985 | Ga0496112_0288985_48_812 | 254 |
| 279 | 3300048916 | Ga0496113_0062330 | Ga0496113_0062330_1713_2564 | 254 |
| 280 | 3300048917 | Ga0496114_0178799 | Ga0496114_0178799_186_953 | 254 |
| 281 | 3300048924 | Ga0496121_0000833 | Ga0496121_0000833_33438_34202 | 254 |
| 282 | 3300048925 | Ga0496122_0026670 | Ga0496122_0026670_252_1016 | 254 |
| 283 | 3300048929 | Ga0496126_0001931 | Ga0496126_0001931_24744_25508 | 254 |
| 284 | 3300048929 | Ga0496126_0069223 | Ga0496126_0069223_654_1418 | 254 |
| 285 | 3300049570 | Ga0501033_0000389 | Ga0501033_0000389_8330_9094 | 254 |
| 286 | 3300049571 | Ga0501034_0004974 | Ga0501034_0004974_5324_6088 | 254 |
| 287 | 3300049571 | Ga0501034_0577563 | Ga0501034_0577563_12_776 | 254 |
| 288 | 3300049573 | Ga0501037_0016740 | Ga0501037_0016740_3983_4747 | 254 |
| 289 | 3300049581 | Ga0501047_0345204 | Ga0501047_0345204_287_1051 | 254 |
| 290 | 3300049823 | Ga0501044_0001888 | Ga0501044_0001888_19675_20439 | 254 |
| 291 | 3300049823 | Ga0501044_0476366 | Ga0501044_0476366_273_1037 | 254 |
| 292 | 3300050491 | nmdc:mga00v17_131543_c1 | nmdc:mga00v17_131543_c1_766_1539 | 254 |
| 293 | 3300050492 | nmdc:mga0yw44_1727_c1 | nmdc:mga0yw44_1727_c1_955_1728 | 254 |
| 294 | 3300050496 | nmdc:mga07m45_97558_c1 | nmdc:mga07m45_97558_c1_393_1157 | 254 |
| 295 | 3300050507 | nmdc:mga05p37_15143_c1 | nmdc:mga05p37_15143_c1_3019_3846 | 254 |
| 296 | 3300050512 | nmdc:mga0n895_94418_c1 | nmdc:mga0n895_94418_c1_281_1132 | 254 |
| 297 | 3300050514 | nmdc:mga08x19_95757_c1 | nmdc:mga08x19_95757_c1_1115_1885 | 254 |
| 298 | 3300050515 | nmdc:mga0a205_10737_c1 | nmdc:mga0a205_10737_c1_5042_5893 | 254 |
| 299 | 3300050516 | nmdc:mga0sz30_74785_c1 | nmdc:mga0sz30_74785_c1_76_849 | 254 |
| 300 | 3300053087 | Ga0500643_038924 | Ga0500643_038924_429_1193 | 254 |
| 301 | 3300053088 | Ga0500644_0000084 | Ga0500644_0000084_10941_11705 | 254 |
| 302 | 3300053094 | Ga0500566_0258107 | Ga0500566_0258107_13_777 | 254 |
| 303 | 3300053129 | Ga0500628_000811 | Ga0500628_000811_1652_2416 | 254 |
| 304 | 3300053134 | Ga0500658_0014206 | Ga0500658_0014206_100_864 | 254 |
| 305 | 3300053156 | Ga0500622_0059912 | Ga0500622_0059912_609_1373 | 254 |
| 306 | 3300053730 | Ga0500645_000124 | Ga0500645_000124_6679_7443 | 254 |
| 307 | 3300003214 | JGI25165J46597_1000109 | JGI25165J46597_1000109129 | 255 |
| 308 | 3300005331 | Ga0070670_100086692 | Ga0070670_1000866923 | 255 |
| 309 | 3300005347 | Ga0070668_100023471 | Ga0070668_1000234712 | 255 |
| 310 | 3300005353 | Ga0070669_100007761 | Ga0070669_1000077612 | 255 |
| 311 | 3300005355 | Ga0070671_100003622 | Ga0070671_1000036226 | 255 |
| 312 | 3300005367 | Ga0070667_100000128 | Ga0070667_1000001287 | 255 |
| 313 | 3300005367 | Ga0070667_100299234 | Ga0070667_1002992341 | 255 |
| 314 | 3300005548 | Ga0070665_100000152 | Ga0070665_1000001524 | 255 |
| 315 | 3300005841 | Ga0068863_100003348 | Ga0068863_10000334811 | 255 |
| 316 | 3300005841 | Ga0068863_100025806 | Ga0068863_1000258062 | 255 |
| 317 | 3300005844 | Ga0068862_100003871 | Ga0068862_1000038719 | 255 |
| 318 | 3300009011 | Ga0105251_10000231 | Ga0105251_1000023117 | 255 |
| 319 | 3300009177 | Ga0105248_10053296 | Ga0105248_100532965 | 255 |
| 320 | 3300025261 | Ga0209233_1000167 | Ga0209233_100016713 | 255 |
| 321 | 3300025735 | Ga0207713_1007815 | Ga0207713_10078152 | 255 |
| 322 | 3300025923 | Ga0207681_10005590 | Ga0207681_100055906 | 255 |
| 323 | 3300025931 | Ga0207644_10009833 | Ga0207644_100098332 | 255 |
| 324 | 3300025941 | Ga0207711_10010503 | Ga0207711_100105035 | 255 |
| 325 | 3300025972 | Ga0207668_10005497 | Ga0207668_100054975 | 255 |
| 326 | 3300025986 | Ga0207658_10006277 | Ga0207658_100062776 | 255 |
| 327 | 3300025986 | Ga0207658_10008713 | Ga0207658_100087132 | 255 |
| 328 | 3300026088 | Ga0207641_10001645 | Ga0207641_100016457 | 255 |
| 329 | 3300026088 | Ga0207641_10017149 | Ga0207641_100171493 | 255 |
| 330 | 3300028379 | Ga0268266_10000125 | Ga0268266_1000012512 | 255 |
| 331 | 3300028380 | Ga0268265_10082645 | Ga0268265_100826452 | 255 |
| 332 | 3300028380 | Ga0268265_10480367 | Ga0268265_104803671 | 255 |
| 333 | 3300041512 | Ga0451853_3045660 | Ga0451853_3045660_112_882 | 255 |
| 334 | 3300048924 | Ga0496121_0003144 | Ga0496121_0003144_20461_21231 | 255 |
| 335 | 3300048926 | Ga0496123_0065182 | Ga0496123_0065182_231_1001 | 255 |
| 336 | 3300048928 | Ga0496125_0034397 | Ga0496125_0034397_1874_2644 | 255 |
| 337 | 3300048928 | Ga0496125_0191774 | Ga0496125_0191774_374_1144 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ebb-assembly1.cif.gz_A | bacillus stearothermophilus yhfr | 0.8595 | 8 | 233 |
| 6nru-assembly5.cif.gz_E | crystal structure of the alpha-ribazole phosphatase from shigella flexneri | 0.8563 | 8 | 233 |
| 6e4b-assembly2.cif.gz_C | the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 | 0.8533 | 6 | 233 |
| 1c7z-assembly1.cif.gz_B | regulatory complex of fructose-2,6-bisphosphatase | 0.8472 | 7 | 235 |
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.8457 | 8 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SI2_327_480_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8728 | 68 | 200 | 3.40.50.1240 |
| af_A0A368UGZ2_77_264_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8658 | 9 | 231 | 3.40.50.1240 |
| af_F4KI56_14_225_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8639 | 8 | 231 | 3.40.50.1240 |
| af_Q86HD1_259_461_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.861 | 9 | 210 | 3.40.50.1240 |
| 1ebbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8595 | 8 | 233 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G1LJM6-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) | 0.989 | 1 | 228 |
GO:0006096
GO:0016868 |
| AF-A0A4Q3YKX2-F1-model_v4 | Histidine phosphatase family protein | 0.9827 | 5 | 84 |
GO:0003824
|
| AF-A0A1W1Y2R4-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) | 0.9784 | 22 | 229 |
GO:0006096
GO:0016868 |
| AF-A0A543HHW6-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) | 0.9754 | 1 | 231 |
GO:0006096
GO:0016868 |
| AF-A0A354IUG5-F1-model_v4 | Histidine phosphatase family protein | 0.9738 | 1 | 236 |
GO:0005737
GO:0016791 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar