F412943

General Info

Members Datasets Scaffolds Average Seq Length
337 180 674 193

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100151572|Ga0070671_1001515722
Length 213
Sequence MTSVGTRGSSRDRVFTWANLLTFVRIGLIPFFAIALVYQHMGWALIIFAIAGISDGIDGTVARLMKQESELGTVIDPIADKLLMTTAFIMVSLPSVMGTARHFPVPFWVTATVIGRDVAIVCVATSITVMTGFRGFKPSWLGKASTFVQVLGVLLVLIAAVFHVDNGLFLPTTYAVIAAFAVASGVHYIYHVARLMRADEKGAGPSPRAKIEI

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
166 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
171 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
172 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
173 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
174 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 98.22
Stem 0
Stem Tuber 0
Unclassified 28.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100151572 3300005355 Bacteria 1958
2 LJQas_1000240 3300000549 Bacteria 10053
3 JGI24743J22301_10048560 3300001991 Bacteria 862
4 rootH1_10058368 3300003316 Bacteria 2129
5 Ga0065704_10008748 3300005289 Unclassified 2813
6 Ga0070658_10002789 3300005327 Bacteria 14521
7 Ga0070683_100295360 3300005329 Bacteria 1541
8 Ga0070683_101086582 3300005329 Bacteria 768
9 Ga0070690_100008403 3300005330 Bacteria 5944
10 Ga0070670_100056754 3300005331 Bacteria 3361
11 Ga0070670_100316865 3300005331 Bacteria 1366
12 Ga0070670_100874136 3300005331 Bacteria 814
13 Ga0070670_100935259 3300005331 Bacteria 787
14 Ga0070666_10010023 3300005335 Bacteria 5914
15 Ga0070666_10014883 3300005335 Bacteria 4957
16 Ga0070680_100690040 3300005336 Unclassified 878
17 Ga0070682_100286295 3300005337 Bacteria 1203
18 Ga0068868_100005388 3300005338 Bacteria 8989
19 Ga0068868_100201773 3300005338 Bacteria 1658
20 Ga0070660_100591516 3300005339 Unclassified 927
21 Ga0070691_10285317 3300005341 Bacteria 897
22 Ga0070661_100817810 3300005344 Unclassified 765
23 Ga0070669_100000003 3300005353 Bacteria 338807
24 Ga0070669_100293284 3300005353 Bacteria 1306
25 Ga0070675_100035267 3300005354 Bacteria 4064
26 Ga0070675_100750147 3300005354 Bacteria 891
27 Ga0070675_100775699 3300005354 Unclassified 876
28 Ga0070671_100040341 3300005355 Bacteria 3876
29 Ga0070671_100082762 3300005355 Bacteria 2684
30 Ga0070671_100656524 3300005355 Unclassified 908
31 Ga0070674_100498315 3300005356 Unclassified 1014
32 Ga0070673_100027888 3300005364 Bacteria 4191
33 Ga0070673_100579889 3300005364 Bacteria 1021
34 Ga0070659_100154594 3300005366 Bacteria 1872
35 Ga0070667_100334651 3300005367 Unclassified 1368
36 Ga0070711_100245194 3300005439 Bacteria 1403
37 Ga0070694_100371756 3300005444 Bacteria 1113
38 Ga0070678_100086386 3300005456 Unclassified 2393
39 Ga0070662_100063426 3300005457 Bacteria 2703
40 Ga0070681_10246553 3300005458 Bacteria 1699
41 Ga0068867_100019654 3300005459 Bacteria 4811
42 Ga0068867_100294561 3300005459 Unclassified 1335
43 Ga0068867_100612150 3300005459 Unclassified 951
44 Ga0070685_10023386 3300005466 Bacteria 3383
45 Ga0070684_100043559 3300005535 Bacteria 3876
46 Ga0068853_100003730 3300005539 Bacteria 11686
47 Ga0068853_100017877 3300005539 Bacteria 5858
48 Ga0068853_100025284 3300005539 Bacteria 4982
49 Ga0068853_100028045 3300005539 Bacteria 4735
50 Ga0070672_100172570 3300005543 Bacteria 1799
51 Ga0070672_100257335 3300005543 Unclassified 1471
52 Ga0070672_100593200 3300005543 Unclassified 964
53 Ga0070686_100337263 3300005544 Bacteria 1129
54 Ga0070695_100052782 3300005545 Unclassified 2613
55 Ga0070704_100010377 3300005549 Bacteria 5664
56 Ga0070664_100032377 3300005564 Bacteria 4372
57 Ga0070664_100078399 3300005564 Unclassified 2842
58 Ga0068857_100007123 3300005577 Bacteria 9629
59 Ga0068857_100038887 3300005577 Bacteria 4212
60 Ga0068857_100052424 3300005577 Bacteria 3620
61 Ga0068854_100077574 3300005578 Bacteria 2446
62 Ga0068854_100355427 3300005578 Bacteria 1200
63 Ga0068854_100871454 3300005578 Bacteria 789
64 Ga0068852_100121212 3300005616 Bacteria 2395
65 Ga0068852_100245385 3300005616 Bacteria 1713
66 Ga0068852_100515806 3300005616 Bacteria 1192
67 Ga0068852_100780929 3300005616 Unclassified 968
68 Ga0068852_100835493 3300005616 Unclassified 936
69 Ga0068859_100036512 3300005617 Bacteria 4933
70 Ga0068859_100058560 3300005617 Bacteria 3880
71 Ga0068859_100072458 3300005617 Bacteria 3482
72 Ga0068859_100113093 3300005617 Unclassified 2778
73 Ga0068864_100017595 3300005618 Bacteria 5958
74 Ga0068864_100024758 3300005618 Bacteria 5050
75 Ga0068870_10139938 3300005840 Bacteria 1415
76 Ga0068863_100036235 3300005841 Unclassified 4699
77 Ga0068863_100057227 3300005841 Unclassified 3690
78 Ga0068863_100083901 3300005841 Bacteria 3020
79 Ga0068863_100606878 3300005841 Unclassified 1083
80 Ga0068858_100183129 3300005842 Bacteria 1978
81 Ga0068860_100007593 3300005843 Bacteria 10852
82 Ga0068860_100012704 3300005843 Bacteria 8284
83 Ga0068860_100083212 3300005843 Bacteria 3043
84 Ga0068860_100409111 3300005843 Bacteria 1343
85 Ga0068862_100040006 3300005844 Bacteria 3984
86 Ga0068862_100113881 3300005844 Bacteria 2377
87 Ga0068862_100239118 3300005844 Bacteria 1650
88 Ga0068862_100339539 3300005844 Unclassified 1391
89 Ga0070717_10017180 3300006028 Bacteria 5623
90 Ga0070716_100898943 3300006173 Bacteria 693
91 Ga0070712_100020965 3300006175 Bacteria 4284
92 Ga0097621_100039289 3300006237 Unclassified 3800
93 Ga0097621_100788171 3300006237 Unclassified 880
94 Ga0097621_100889116 3300006237 Bacteria 829
95 Ga0068871_100212588 3300006358 Unclassified 1673
96 Ga0075434_101231592 3300006871 Bacteria 760
97 Ga0075436_100017845 3300006914 Bacteria 4858
98 Ga0097620_100036511 3300006931 Bacteria 4933
99 Ga0097620_100058560 3300006931 Bacteria 3880
100 Ga0097620_100072456 3300006931 Bacteria 3482
101 Ga0097620_100113094 3300006931 Unclassified 2778
102 Ga0075435_100047268 3300007076 Unclassified 3455
103 Ga0105240_10156257 3300009093 Bacteria 2712
104 Ga0111539_10259338 3300009094 Bacteria 2024
105 Ga0105245_10205835 3300009098 Bacteria 1892
106 Ga0105247_10003566 3300009101 Bacteria 10108
107 Ga0114129_10925537 3300009147 Unclassified 1103
108 Ga0105241_10002677 3300009174 Bacteria 13350
109 Ga0105241_11078604 3300009174 Bacteria 755
110 Ga0105242_10047765 3300009176 Bacteria 3476
111 Ga0105248_10073872 3300009177 Unclassified 3833
112 Ga0105248_10101964 3300009177 Bacteria 3235
113 Ga0105248_10311000 3300009177 Unclassified 1774
114 Ga0105248_11856033 3300009177 Bacteria 684
115 Ga0105237_10039740 3300009545 Bacteria 4748
116 Ga0105237_10385136 3300009545 Unclassified 1407
117 Ga0105238_10591989 3300009551 Unclassified 1116
118 Ga0105249_10020595 3300009553 Bacteria 5897
119 Ga0105249_10084541 3300009553 Bacteria 2956
120 Ga0105249_10239227 3300009553 Bacteria 1794
121 Ga0105249_10636968 3300009553 Bacteria 1123
122 Ga0105239_10005767 3300010375 Bacteria 14446
123 Ga0157373_10029183 3300013100 Bacteria 3976
124 Ga0157373_10128154 3300013100 Bacteria 1784
125 Ga0157370_10180654 3300013104 Bacteria 1961
126 Ga0157369_10006994 3300013105 Bacteria 13018
127 Ga0157369_10288874 3300013105 Bacteria 1707
128 Ga0157378_10385190 3300013297 Bacteria 1378
129 Ga0157378_10483212 3300013297 Bacteria 1234
130 Ga0163162_10054398 3300013306 Unclassified 4026
131 Ga0163162_10097540 3300013306 Unclassified 3028
132 Ga0163162_10099033 3300013306 Bacteria 3005
133 Ga0163162_10311007 3300013306 Bacteria 1708
134 Ga0163162_10443684 3300013306 Unclassified 1430
135 Ga0163162_10671975 3300013306 Unclassified 1159
136 Ga0163162_11532690 3300013306 Bacteria 760
137 Ga0157372_10017870 3300013307 Bacteria 7618
138 Ga0157372_10178348 3300013307 Unclassified 2459
139 Ga0157372_10188333 3300013307 Bacteria 2390
140 Ga0157372_10557013 3300013307 Bacteria 1336
141 Ga0157372_10627687 3300013307 Bacteria 1252
142 Ga0157375_10027862 3300013308 Bacteria 5286
143 Ga0157375_10680390 3300013308 Bacteria 1183
144 Ga0157375_10727166 3300013308 Unclassified 1145
145 Ga0157375_10979285 3300013308 Unclassified 986
146 Ga0163163_10058751 3300014325 Bacteria 3803
147 Ga0163163_10139697 3300014325 Unclassified 2464
148 Ga0163163_10157753 3300014325 Unclassified 2314
149 Ga0157380_10026250 3300014326 Bacteria 4422
150 Ga0157380_10032503 3300014326 Bacteria 4015
151 Ga0157380_10393730 3300014326 Bacteria 1312
152 Ga0157380_10553421 3300014326 Unclassified 1129
153 Ga0157380_10891838 3300014326 Bacteria 915
154 Ga0182008_10196483 3300014497 Unclassified 1025
155 Ga0157377_10480072 3300014745 Unclassified 864
156 Ga0157379_10104750 3300014968 Bacteria 2539
157 Ga0163161_10105243 3300017792 Unclassified 2105
158 Ga0207710_10002322 3300025900 Bacteria 8884
159 Ga0207680_10010293 3300025903 Bacteria 4673
160 Ga0207680_10596216 3300025903 Unclassified 790
161 Ga0207705_10018957 3300025909 Bacteria 4920
162 Ga0207654_10107703 3300025911 Bacteria 1728
163 Ga0207707_10001681 3300025912 Bacteria 20385
164 Ga0207695_10591257 3300025913 Unclassified 991
165 Ga0207671_10014508 3300025914 Bacteria 6224
166 Ga0207693_10000812 3300025915 Bacteria 27865
167 Ga0207657_10303420 3300025919 Bacteria 1264
168 Ga0207649_10034456 3300025920 Bacteria 3034
169 Ga0207649_10087482 3300025920 Bacteria 2033
170 Ga0207652_10275967 3300025921 Unclassified 1516
171 Ga0207681_10000007 3300025923 Bacteria 483669
172 Ga0207681_10264508 3300025923 Unclassified 1348
173 Ga0207694_10313432 3300025924 Unclassified 1294
174 Ga0207650_10227564 3300025925 Bacteria 1503
175 Ga0207650_10234179 3300025925 Bacteria 1482
176 Ga0207650_10314715 3300025925 Unclassified 1281
177 Ga0207650_10631171 3300025925 Bacteria 902
178 Ga0207659_10033066 3300025926 Unclassified 3556
179 Ga0207687_10165615 3300025927 Bacteria 1700
180 Ga0207644_10025251 3300025931 Bacteria 4086
181 Ga0207644_10207490 3300025931 Bacteria 1548
182 Ga0207644_10368864 3300025931 Unclassified 1169
183 Ga0207644_10396594 3300025931 Bacteria 1127
184 Ga0207706_10273451 3300025933 Bacteria 1474
185 Ga0207670_10479386 3300025936 Bacteria 1007
186 Ga0207669_10662965 3300025937 Unclassified 854
187 Ga0207704_10361539 3300025938 Unclassified 1133
188 Ga0207691_10006835 3300025940 Bacteria 11005
189 Ga0207691_10419829 3300025940 Unclassified 1140
190 Ga0207711_10022391 3300025941 Bacteria 5283
191 Ga0207711_10316490 3300025941 Unclassified 1441
192 Ga0207689_10192131 3300025942 Bacteria 1684
193 Ga0207661_10226331 3300025944 Bacteria 1655
194 Ga0207661_10369766 3300025944 Bacteria 1296
195 Ga0207661_10469928 3300025944 Unclassified 1147
196 Ga0207679_10079893 3300025945 Bacteria 2495
197 Ga0207712_10005519 3300025961 Bacteria 7978
198 Ga0207668_11213446 3300025972 Unclassified 678
199 Ga0207640_10044278 3300025981 Bacteria 2850
200 Ga0207640_10228993 3300025981 Unclassified 1428
201 Ga0207640_10312891 3300025981 Bacteria 1247
202 Ga0207658_10132252 3300025986 Unclassified 2006
203 Ga0207658_10200601 3300025986 Unclassified 1665
204 Ga0207703_10376868 3300026035 Bacteria 1312
205 Ga0207703_10596886 3300026035 Unclassified 1044
206 Ga0207639_10002464 3300026041 Bacteria 12413
207 Ga0207639_10054680 3300026041 Bacteria 3052
208 Ga0207639_10742143 3300026041 Unclassified 913
209 Ga0207678_10081787 3300026067 Bacteria 2764
210 Ga0207708_10813912 3300026075 Unclassified 805
211 Ga0207641_10016782 3300026088 Bacteria 5997
212 Ga0207641_10968791 3300026088 Unclassified 846
213 Ga0207648_10349086 3300026089 Bacteria 1333
214 Ga0207648_10579491 3300026089 Unclassified 1033
215 Ga0207676_10015628 3300026095 Bacteria 5482
216 Ga0207676_10046782 3300026095 Bacteria 3350
217 Ga0207676_10171456 3300026095 Unclassified 1891
218 Ga0207676_10321536 3300026095 Unclassified 1420
219 Ga0207676_10617082 3300026095 Bacteria 1043
220 Ga0207674_10102049 3300026116 Bacteria 2849
221 Ga0207675_100636390 3300026118 Bacteria 1072
222 Ga0207675_100646661 3300026118 Bacteria 1063
223 Ga0207683_10087843 3300026121 Bacteria 2765
224 Ga0207698_10021726 3300026142 Bacteria 4444
225 Ga0207698_10069611 3300026142 Unclassified 2783
226 Ga0207698_10108822 3300026142 Unclassified 2317
227 Ga0207698_10698439 3300026142 Bacteria 1009
228 Ga0209974_10255719 3300027876 Bacteria 660
229 Ga0268266_10402776 3300028379 Unclassified 1294
230 Ga0268265_10005407 3300028380 Bacteria 8742
231 Ga0268265_10070777 3300028380 Bacteria 2714
232 Ga0268265_10110966 3300028380 Bacteria 2239
233 Ga0268264_10001997 3300028381 Bacteria 18318
234 Ga0268264_10021710 3300028381 Bacteria 5242
235 Ga0307408_100006931 3300031548 Bacteria 7501
236 Ga0307408_100069840 3300031548 Bacteria 2592
237 Ga0307408_100151351 3300031548 Bacteria 1832
238 Ga0307405_10000941 3300031731 Bacteria 11613
239 Ga0307405_10031149 3300031731 Bacteria 3136
240 Ga0307405_10600720 3300031731 Bacteria 898
241 Ga0307405_11191369 3300031731 Bacteria 658
242 Ga0307413_10000922 3300031824 Bacteria 10449
243 Ga0307413_10004290 3300031824 Bacteria 6180
244 Ga0307413_10004413 3300031824 Bacteria 6118
245 Ga0307413_10065795 3300031824 Unclassified 2258
246 Ga0307413_10347073 3300031824 Unclassified 1144
247 Ga0307413_10632367 3300031824 Bacteria 880
248 Ga0307410_10001197 3300031852 Bacteria 11507
249 Ga0307410_10016739 3300031852 Bacteria 4382
250 Ga0307410_10033101 3300031852 Bacteria 3334
251 Ga0307410_10048464 3300031852 Bacteria 2846
252 Ga0307410_10140621 3300031852 Bacteria 1785
253 Ga0307406_10007677 3300031901 Bacteria 5990
254 Ga0307406_10132450 3300031901 Bacteria 1752
255 Ga0307406_10310490 3300031901 Bacteria 1215
256 Ga0307406_10380737 3300031901 Bacteria 1112
257 Ga0307406_10566981 3300031901 Bacteria 931
258 Ga0307406_10625607 3300031901 Unclassified 891
259 Ga0307407_10002228 3300031903 Bacteria 7487
260 Ga0307407_10002731 3300031903 Bacteria 7014
261 Ga0307407_10012787 3300031903 Bacteria 4050
262 Ga0307407_10049139 3300031903 Bacteria 2405
263 Ga0307407_10120929 3300031903 Bacteria 1660
264 Ga0307407_10356778 3300031903 Bacteria 1037
265 Ga0307412_10009348 3300031911 Bacteria 5622
266 Ga0307412_10072167 3300031911 Bacteria 2359
267 Ga0307412_10428515 3300031911 Unclassified 1084
268 Ga0307412_10594111 3300031911 Bacteria 936
269 Ga0307409_100003885 3300031995 Bacteria 8258
270 Ga0307409_100021763 3300031995 Bacteria 4404
271 Ga0307409_100075018 3300031995 Bacteria 2706
272 Ga0307409_100081759 3300031995 Unclassified 2612
273 Ga0307409_100217499 3300031995 Bacteria 1722
274 Ga0307409_100298366 3300031995 Unclassified 1498
275 Ga0307409_100497902 3300031995 Bacteria 1186
276 Ga0307409_101318175 3300031995 Bacteria 747
277 Ga0307416_100056891 3300032002 Bacteria 3160
278 Ga0307416_100081937 3300032002 Bacteria 2731
279 Ga0307416_100136105 3300032002 Unclassified 2222
280 Ga0307416_100171073 3300032002 Bacteria 2022
281 Ga0307414_10007588 3300032004 Bacteria 6101
282 Ga0307414_10048260 3300032004 Bacteria 2936
283 Ga0307414_10084074 3300032004 Bacteria 2339
284 Ga0307411_10014753 3300032005 Bacteria 4360
285 Ga0307411_10015833 3300032005 Bacteria 4249
286 Ga0307411_10021984 3300032005 Bacteria 3746
287 Ga0307411_10057442 3300032005 Bacteria 2571
288 Ga0307411_10619542 3300032005 Unclassified 933
289 Ga0307411_10634573 3300032005 Bacteria 923
290 Ga0307415_100014057 3300032126 Bacteria 4692
291 Ga0307415_100020955 3300032126 Bacteria 4005
292 Ga0373961_0000696 3300035241 Bacteria 11729
293 Ga0395900_0333690 3300037418 Bacteria 1494
294 Ga0395905_0271616 3300037471 Bacteria 1581
295 Ga0436362_0423764 3300039453 Unclassified 842
296 Ga0451807_0300393 3300041486 Bacteria 1093
297 Ga0451807_1304981 3300041486 Bacteria 1474
298 Ga0451837_0450418 3300041494 Unclassified 2119
299 Ga0439432_173583 3300042006 Unclassified 629
300 Ga0439449_0233188 3300042007 Unclassified 691
301 Ga0451577_0271360 3300042876 Bacteria 1536
302 Ga0453684_0585361 3300044712 Bacteria 1225
303 Ga0495598_0017709 3300046537 Unclassified 1841
304 Ga0495645_0187116 3300046543 Unclassified 1414
305 Ga0495668_0000430 3300046616 Bacteria 54487
306 Ga0496108_0732705 3300048911 Unclassified 856
307 Ga0496114_0419604 3300048917 Unclassified 1185
308 Ga0501068_0005333 3300049584 Bacteria 7023
309 Ga0501074_0151440 3300049590 Bacteria 1658
310 Ga0501075_0000241 3300049591 Bacteria 29294
311 Ga0501077_0000207 3300049593 Bacteria 34262
312 Ga0501209_003307 3300049656 Bacteria 2639
313 Ga0501217_081782 3300049661 Unclassified 895
314 Ga0501224_043601 3300049664 Bacteria 680
315 Ga0501233_041175 3300049668 Unclassified 1086
316 Ga0501233_050384 3300049668 Unclassified 1007
317 Ga0501239_018853 3300049672 Unclassified 832
318 Ga0501249_005893 3300049679 Bacteria 2509
319 Ga0501249_028524 3300049679 Bacteria 1238
320 Ga0501256_012204 3300049685 Unclassified 836
321 Ga0501257_024149 3300049686 Bacteria 1443
322 Ga0501258_014238 3300049687 Unclassified 880
323 Ga0501221_062663 3300049704 Bacteria 863
324 Ga0501225_0023104 3300049705 Bacteria 1715
325 Ga0501080_0003456 3300049742 Bacteria 13941
326 Ga0501083_0010755 3300049744 Bacteria 6434
327 Ga0501266_015130 3300049763 Bacteria 1016
328 Ga0501268_003956 3300049765 Bacteria 2063
329 Ga0501270_009099 3300049767 Bacteria 1274
330 Ga0501272_003375 3300049769 Unclassified 1622
331 Ga0501212_021666 3300049851 Unclassified 998
332 nmdc:mga05p37_1764642_c1 3300050507 Unclassified 599
333 nmdc:mga08y16_563233_c1 3300050511 Bacteria 1152
334 nmdc:mga0n895_765325_c1 3300050512 Bacteria 958
335 nmdc:mga0rr50_15009_c1 3300050513 Bacteria 5102
336 nmdc:mga08x19_24714_c1 3300050514 Bacteria 3738
337 Ga0501082_0001070 3300060353 Bacteria 24247
338 Ga0070671_100151572
339 LJQas_1000240
340 JGI24743J22301_10048560
341 rootH1_10058368
342 Ga0065704_10008748
343 Ga0070658_10002789
344 Ga0070683_100295360
345 Ga0070683_101086582
346 Ga0070690_100008403
347 Ga0070670_100056754
348 Ga0070670_100316865
349 Ga0070670_100874136
350 Ga0070670_100935259
351 Ga0070666_10010023
352 Ga0070666_10014883
353 Ga0070680_100690040
354 Ga0070682_100286295
355 Ga0068868_100005388
356 Ga0068868_100201773
357 Ga0070660_100591516
358 Ga0070691_10285317
359 Ga0070661_100817810
360 Ga0070669_100000003
361 Ga0070669_100293284
362 Ga0070675_100035267
363 Ga0070675_100750147
364 Ga0070675_100775699
365 Ga0070671_100040341
366 Ga0070671_100082762
367 Ga0070671_100656524
368 Ga0070674_100498315
369 Ga0070673_100027888
370 Ga0070673_100579889
371 Ga0070659_100154594
372 Ga0070667_100334651
373 Ga0070711_100245194
374 Ga0070694_100371756
375 Ga0070678_100086386
376 Ga0070662_100063426
377 Ga0070681_10246553
378 Ga0068867_100019654
379 Ga0068867_100294561
380 Ga0068867_100612150
381 Ga0070685_10023386
382 Ga0070684_100043559
383 Ga0068853_100003730
384 Ga0068853_100017877
385 Ga0068853_100025284
386 Ga0068853_100028045
387 Ga0070672_100172570
388 Ga0070672_100257335
389 Ga0070672_100593200
390 Ga0070686_100337263
391 Ga0070695_100052782
392 Ga0070704_100010377
393 Ga0070664_100032377
394 Ga0070664_100078399
395 Ga0068857_100007123
396 Ga0068857_100038887
397 Ga0068857_100052424
398 Ga0068854_100077574
399 Ga0068854_100355427
400 Ga0068854_100871454
401 Ga0068852_100121212
402 Ga0068852_100245385
403 Ga0068852_100515806
404 Ga0068852_100780929
405 Ga0068852_100835493
406 Ga0068859_100036512
407 Ga0068859_100058560
408 Ga0068859_100072458
409 Ga0068859_100113093
410 Ga0068864_100017595
411 Ga0068864_100024758
412 Ga0068870_10139938
413 Ga0068863_100036235
414 Ga0068863_100057227
415 Ga0068863_100083901
416 Ga0068863_100606878
417 Ga0068858_100183129
418 Ga0068860_100007593
419 Ga0068860_100012704
420 Ga0068860_100083212
421 Ga0068860_100409111
422 Ga0068862_100040006
423 Ga0068862_100113881
424 Ga0068862_100239118
425 Ga0068862_100339539
426 Ga0070717_10017180
427 Ga0070716_100898943
428 Ga0070712_100020965
429 Ga0097621_100039289
430 Ga0097621_100788171
431 Ga0097621_100889116
432 Ga0068871_100212588
433 Ga0075434_101231592
434 Ga0075436_100017845
435 Ga0097620_100036511
436 Ga0097620_100058560
437 Ga0097620_100072456
438 Ga0097620_100113094
439 Ga0075435_100047268
440 Ga0105240_10156257
441 Ga0111539_10259338
442 Ga0105245_10205835
443 Ga0105247_10003566
444 Ga0114129_10925537
445 Ga0105241_10002677
446 Ga0105241_11078604
447 Ga0105242_10047765
448 Ga0105248_10073872
449 Ga0105248_10101964
450 Ga0105248_10311000
451 Ga0105248_11856033
452 Ga0105237_10039740
453 Ga0105237_10385136
454 Ga0105238_10591989
455 Ga0105249_10020595
456 Ga0105249_10084541
457 Ga0105249_10239227
458 Ga0105249_10636968
459 Ga0105239_10005767
460 Ga0157373_10029183
461 Ga0157373_10128154
462 Ga0157370_10180654
463 Ga0157369_10006994
464 Ga0157369_10288874
465 Ga0157378_10385190
466 Ga0157378_10483212
467 Ga0163162_10054398
468 Ga0163162_10097540
469 Ga0163162_10099033
470 Ga0163162_10311007
471 Ga0163162_10443684
472 Ga0163162_10671975
473 Ga0163162_11532690
474 Ga0157372_10017870
475 Ga0157372_10178348
476 Ga0157372_10188333
477 Ga0157372_10557013
478 Ga0157372_10627687
479 Ga0157375_10027862
480 Ga0157375_10680390
481 Ga0157375_10727166
482 Ga0157375_10979285
483 Ga0163163_10058751
484 Ga0163163_10139697
485 Ga0163163_10157753
486 Ga0157380_10026250
487 Ga0157380_10032503
488 Ga0157380_10393730
489 Ga0157380_10553421
490 Ga0157380_10891838
491 Ga0182008_10196483
492 Ga0157377_10480072
493 Ga0157379_10104750
494 Ga0163161_10105243
495 Ga0207710_10002322
496 Ga0207680_10010293
497 Ga0207680_10596216
498 Ga0207705_10018957
499 Ga0207654_10107703
500 Ga0207707_10001681
501 Ga0207695_10591257
502 Ga0207671_10014508
503 Ga0207693_10000812
504 Ga0207657_10303420
505 Ga0207649_10034456
506 Ga0207649_10087482
507 Ga0207652_10275967
508 Ga0207681_10000007
509 Ga0207681_10264508
510 Ga0207694_10313432
511 Ga0207650_10227564
512 Ga0207650_10234179
513 Ga0207650_10314715
514 Ga0207650_10631171
515 Ga0207659_10033066
516 Ga0207687_10165615
517 Ga0207644_10025251
518 Ga0207644_10207490
519 Ga0207644_10368864
520 Ga0207644_10396594
521 Ga0207706_10273451
522 Ga0207670_10479386
523 Ga0207669_10662965
524 Ga0207704_10361539
525 Ga0207691_10006835
526 Ga0207691_10419829
527 Ga0207711_10022391
528 Ga0207711_10316490
529 Ga0207689_10192131
530 Ga0207661_10226331
531 Ga0207661_10369766
532 Ga0207661_10469928
533 Ga0207679_10079893
534 Ga0207712_10005519
535 Ga0207668_11213446
536 Ga0207640_10044278
537 Ga0207640_10228993
538 Ga0207640_10312891
539 Ga0207658_10132252
540 Ga0207658_10200601
541 Ga0207703_10376868
542 Ga0207703_10596886
543 Ga0207639_10002464
544 Ga0207639_10054680
545 Ga0207639_10742143
546 Ga0207678_10081787
547 Ga0207708_10813912
548 Ga0207641_10016782
549 Ga0207641_10968791
550 Ga0207648_10349086
551 Ga0207648_10579491
552 Ga0207676_10015628
553 Ga0207676_10046782
554 Ga0207676_10171456
555 Ga0207676_10321536
556 Ga0207676_10617082
557 Ga0207674_10102049
558 Ga0207675_100636390
559 Ga0207675_100646661
560 Ga0207683_10087843
561 Ga0207698_10021726
562 Ga0207698_10069611
563 Ga0207698_10108822
564 Ga0207698_10698439
565 Ga0209974_10255719
566 Ga0268266_10402776
567 Ga0268265_10005407
568 Ga0268265_10070777
569 Ga0268265_10110966
570 Ga0268264_10001997
571 Ga0268264_10021710
572 Ga0307408_100006931
573 Ga0307408_100069840
574 Ga0307408_100151351
575 Ga0307405_10000941
576 Ga0307405_10031149
577 Ga0307405_10600720
578 Ga0307405_11191369
579 Ga0307413_10000922
580 Ga0307413_10004290
581 Ga0307413_10004413
582 Ga0307413_10065795
583 Ga0307413_10347073
584 Ga0307413_10632367
585 Ga0307410_10001197
586 Ga0307410_10016739
587 Ga0307410_10033101
588 Ga0307410_10048464
589 Ga0307410_10140621
590 Ga0307406_10007677
591 Ga0307406_10132450
592 Ga0307406_10310490
593 Ga0307406_10380737
594 Ga0307406_10566981
595 Ga0307406_10625607
596 Ga0307407_10002228
597 Ga0307407_10002731
598 Ga0307407_10012787
599 Ga0307407_10049139
600 Ga0307407_10120929
601 Ga0307407_10356778
602 Ga0307412_10009348
603 Ga0307412_10072167
604 Ga0307412_10428515
605 Ga0307412_10594111
606 Ga0307409_100003885
607 Ga0307409_100021763
608 Ga0307409_100075018
609 Ga0307409_100081759
610 Ga0307409_100217499
611 Ga0307409_100298366
612 Ga0307409_100497902
613 Ga0307409_101318175
614 Ga0307416_100056891
615 Ga0307416_100081937
616 Ga0307416_100136105
617 Ga0307416_100171073
618 Ga0307414_10007588
619 Ga0307414_10048260
620 Ga0307414_10084074
621 Ga0307411_10014753
622 Ga0307411_10015833
623 Ga0307411_10021984
624 Ga0307411_10057442
625 Ga0307411_10619542
626 Ga0307411_10634573
627 Ga0307415_100014057
628 Ga0307415_100020955
629 Ga0373961_0000696
630 Ga0395900_0333690
631 Ga0395905_0271616
632 Ga0436362_0423764
633 Ga0451807_0300393
634 Ga0451807_1304981
635 Ga0451837_0450418
636 Ga0439432_173583
637 Ga0439449_0233188
638 Ga0451577_0271360
639 Ga0453684_0585361
640 Ga0495598_0017709
641 Ga0495645_0187116
642 Ga0495668_0000430
643 Ga0496108_0732705
644 Ga0496114_0419604
645 Ga0501068_0005333
646 Ga0501074_0151440
647 Ga0501075_0000241
648 Ga0501077_0000207
649 Ga0501209_003307
650 Ga0501217_081782
651 Ga0501224_043601
652 Ga0501233_041175
653 Ga0501233_050384
654 Ga0501239_018853
655 Ga0501249_005893
656 Ga0501249_028524
657 Ga0501256_012204
658 Ga0501257_024149
659 Ga0501258_014238
660 Ga0501221_062663
661 Ga0501225_0023104
662 Ga0501080_0003456
663 Ga0501083_0010755
664 Ga0501266_015130
665 Ga0501268_003956
666 Ga0501270_009099
667 Ga0501272_003375
668 Ga0501212_021666
669 nmdc:mga05p37_1764642_c1
670 nmdc:mga08y16_563233_c1
671 nmdc:mga0n895_765325_c1
672 nmdc:mga0rr50_15009_c1
673 nmdc:mga08x19_24714_c1
674 Ga0501082_0001070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

15

189

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.8196 6 176
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7581 6 176
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6992 9 187
5d91-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6979 9 187
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.696 9 186
ID Description Score Start End Superfamily
af_O13899_376_527_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9217 4 111 1.20.120.1760
af_Q07560_63_278_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8935 1 175 1.20.120.1760
af_Q80ZM8_99_300_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8855 4 180 1.20.120.1760
af_Q8MZC4_124_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8757 4 176 1.20.120.1760
af_A0A0R0J975_105_305_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8554 9 183 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7V4Y6P8-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9583 4 177 GO:0005886
GO:0008444
GO:0046474
AF-A0A5D0MK05-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9529 6 182 GO:0005886
GO:0008444
GO:0046474
AF-A0A7V0Y1A9-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9495 2 182 GO:0016020
GO:0016780
GO:0046474
AF-A0A7C5MGC1-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9406 2 176 GO:0005886
GO:0008444
GO:0046474
AF-A0A2V8P461-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9401 2 185 GO:0005886
GO:0008444
GO:0046474

Map