F412883

General Info

Members Datasets Scaffolds Average Seq Length
336 243 672 197

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2873151551|2873154925
Length 205
Sequence TGTGRQRRRGNTRERIQDVALELFAEQGYEKTSLREISERLEVTKAALYYHFKTKEDILNSLFEDRTRPIDELIEWGRRQPQPPSLETRKEVLSRYSEILVEASPLFRFMQENQATVRDLQIGESFKSRMIGLFEILKDPGAAMRDQVRCFSALFTMHGGMFALKDVEGDPEEKREAILKVAVDLITQAHTGAGPASEPGSGSGG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
31 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
65 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
66 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
177 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
178 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
181 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
184 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
185 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
186 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
187 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
191 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
192 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
193 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
194 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
195 2643221647 Streptomyces sp. Root369 Isolate Unclassified
196 2643221670 Streptomyces sp. Root431 Isolate Unclassified
197 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
198 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
199 2643221714 Streptomyces sp. Root264 Isolate Unclassified
200 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
201 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
202 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
203 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
204 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
205 2808606448 Streptomyces sp. 193411 Isolate Unclassified
206 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
207 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
208 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
209 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
210 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
211 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
212 2862574272 Streptomyces sp. AcE210 Isolate Nodule
213 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
214 2867428634 Streptomyces sp. RP5T Isolate Unclassified
215 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
216 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
217 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
218 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
219 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
220 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
221 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
222 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
223 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
224 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
225 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
226 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
227 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
228 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
229 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
230 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
231 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
232 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
233 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
234 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
235 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
236 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
237 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
238 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
239 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
240 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
241 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
242 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
243 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 0.3
Isolates 16.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 0.6
Rhizoplane 1.49
Rhizosphere 75.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10076060 3300001979 Bacteria 888
2 JGI24739J22299_10013707 3300001989 Bacteria 2955
3 JGI24737J22298_10010474 3300001990 Bacteria 3059
4 JGI24735J21928_10014748 3300002067 Bacteria 2445
5 JGI24738J21930_10018768 3300002075 Bacteria 1445
6 rootH2_10078889 3300003320 Bacteria 3721
7 rootL2_10005012 3300003322 Bacteria 1131
8 rootH1_10024186 3300003323 Bacteria 6479
9 Ga0070670_100619609 3300005331 Bacteria 969
10 Ga0068853_100229519 3300005539 Bacteria 1698
11 Ga0070672_100235206 3300005543 Bacteria 1540
12 Ga0070665_100228469 3300005548 Bacteria 1861
13 Ga0068856_100040670 3300005614 Bacteria 4567
14 Ga0075365_10089320 3300006038 Bacteria 2098
15 Ga0075368_10010579 3300006042 Bacteria 3339
16 Ga0075363_100022187 3300006048 Bacteria 3207
17 Ga0099826_10130832 3300006948 Bacteria 1463
18 Ga0105251_10003027 3300009011 Bacteria 12531
19 Ga0105250_10029918 3300009092 Bacteria 2190
20 Ga0105245_10304895 3300009098 Bacteria 1564
21 Ga0105245_10365669 3300009098 Bacteria 1433
22 Ga0105248_10143063 3300009177 Bacteria 2698
23 Ga0105238_10178408 3300009551 Bacteria 2101
24 Ga0105238_10257158 3300009551 Bacteria 1725
25 Ga0105249_10223410 3300009553 Bacteria 1854
26 Ga0105246_10000994 3300011119 Bacteria 16279
27 Ga0105246_10160163 3300011119 Bacteria 1714
28 Ga0157372_10063953 3300013307 Bacteria 4127
29 Ga0182008_10002128 3300014497 Bacteria 12618
30 Ga0157376_10240971 3300014969 Bacteria 1685
31 Ga0182007_10000634 3300015262 Bacteria 20427
32 Ga0182005_1071625 3300015265 Bacteria 952
33 Ga0183367_1015 3300015688 Bacteria 298435
34 Ga0209758_1063631 3300025297 Bacteria 1200
35 Ga0207426_1002127 3300025302 Bacteria 13553
36 Ga0207696_1021091 3300025711 Bacteria 2090
37 Ga0207713_1012833 3300025735 Bacteria 4451
38 Ga0207647_10015287 3300025904 Bacteria 5268
39 Ga0207694_10240155 3300025924 Bacteria 1480
40 Ga0207694_10318973 3300025924 Bacteria 1282
41 Ga0207709_10158085 3300025935 Bacteria 1578
42 Ga0207691_10439106 3300025940 Bacteria 1111
43 Ga0207639_10065790 3300026041 Bacteria 2815
44 Ga0207702_10015760 3300026078 Bacteria 6257
45 Ga0207683_11107213 3300026121 Bacteria 735
46 Ga0209371_1009357 3300027312 Bacteria 3124
47 Ga0209813_10055520 3300027866 Bacteria 1251
48 Ga0268266_10354004 3300028379 Bacteria 1380
49 Ga0307517_10003577 3300028786 Bacteria 24129
50 Ga0307515_10017095 3300028794 Bacteria 13243
51 Ga0268256_1009904 3300030500 Bacteria 3124
52 Ga0307511_10012518 3300030521 Bacteria 8321
53 Ga0307511_10029473 3300030521 Bacteria 4955
54 Ga0307511_10118043 3300030521 Bacteria 1654
55 Ga0307512_10004127 3300030522 Bacteria 16131
56 Ga0307512_10023170 3300030522 Bacteria 5553
57 Ga0307513_10059945 3300031456 Bacteria 4037
58 Ga0307509_10097059 3300031507 Bacteria 2996
59 Ga0307509_10230898 3300031507 Bacteria 1653
60 Ga0307509_10233777 3300031507 Bacteria 1638
61 Ga0307408_100785614 3300031548 Bacteria 863
62 Ga0307508_10007643 3300031616 Bacteria 10050
63 Ga0307508_10042948 3300031616 Bacteria 4052
64 Ga0307514_10002213 3300031649 Bacteria 20767
65 Ga0307516_10016559 3300031730 Bacteria 7708
66 Ga0307516_10035796 3300031730 Bacteria 4976
67 Ga0307518_10207663 3300031838 Bacteria 1293
68 Ga0307507_10027109 3300033179 Bacteria 6151
69 Ga0307510_10022016 3300033180 Bacteria 7410
70 Ga0307510_10096273 3300033180 Bacteria 2776
71 Ga0307510_10129786 3300033180 Bacteria 2197
72 Ga0395898_0042518 3300037466 Bacteria 4482
73 Ga0439436_0014535 3300041404 Bacteria 2373
74 Ga0439439_0006215 3300041406 Bacteria 2757
75 Ga0451787_244246 3300041441 Bacteria 817
76 Ga0451791_0591454 3300041451 Bacteria 972
77 Ga0451837_0315258 3300041494 Bacteria 2602
78 Ga0451841_0902181 3300041498 Bacteria 2636
79 Ga0451849_0210259 3300041505 Bacteria 1239
80 Ga0451853_0720735 3300041512 Bacteria 2420
81 Ga0451853_1267955 3300041512 Bacteria 1954
82 Ga0439433_0000302 3300041999 Bacteria 8497
83 Ga0439448_0054089 3300042005 Bacteria 1319
84 Ga0439432_050436 3300042006 Bacteria 1299
85 Ga0439449_0005564 3300042007 Bacteria 4822
86 Ga0439449_0024875 3300042007 Bacteria 2238
87 Ga0439455_0004523 3300042012 Bacteria 2761
88 Ga0439457_002861 3300042014 Bacteria 4814
89 Ga0439462_0062829 3300042015 Bacteria 1005
90 Ga0439463_129329 3300042016 Bacteria 653
91 Ga0450903_000006 3300042138 Bacteria 38832
92 Ga0439458_0010662 3300042157 Bacteria 2050
93 Ga0466969_0010971 3300044656 Bacteria 4799
94 Ga0466972_0002224 3300044658 Bacteria 9527
95 Ga0466972_0004832 3300044658 Bacteria 6758
96 Ga0466972_0040105 3300044658 Bacteria 2282
97 Ga0466972_0049015 3300044658 Bacteria 2040
98 Ga0466965_0001216 3300044683 Bacteria 10177
99 Ga0466966_0030961 3300044684 Bacteria 3470
100 Ga0466966_0046772 3300044684 Bacteria 2761
101 Ga0466961_0046525 3300044693 Bacteria 2774
102 Ga0466961_0141446 3300044693 Bacteria 1506
103 Ga0466963_0432207 3300044694 Bacteria 929
104 Ga0466964_0004063 3300044706 Bacteria 5383
105 Ga0466971_0001022 3300044719 Bacteria 11559
106 Ga0466971_0007621 3300044719 Bacteria 4719
107 Ga0466970_0000786 3300044765 Bacteria 15341
108 Ga0466970_0002066 3300044765 Bacteria 9710
109 Ga0466957_0007791 3300044842 Bacteria 6064
110 Ga0466957_0906212 3300044842 Bacteria 630
111 Ga0466960_0013666 3300044901 Bacteria 3456
112 Ga0466960_0188189 3300044901 Bacteria 1122
113 Ga0466959_0001420 3300045049 Bacteria 14664
114 Ga0466967_0023828 3300045976 Bacteria 5022
115 Ga0466967_0129021 3300045976 Bacteria 2345
116 Ga0466967_1216527 3300045976 Bacteria 750
117 Ga0495592_0020548 3300046454 Bacteria 5024
118 Ga0495603_0006393 3300046455 Bacteria 7049
119 Ga0495603_0013427 3300046455 Bacteria 4954
120 Ga0495603_0023241 3300046455 Bacteria 3753
121 Ga0495629_0006224 3300046459 Bacteria 8857
122 Ga0495629_0025716 3300046459 Bacteria 4183
123 Ga0495629_0084724 3300046459 Bacteria 2211
124 Ga0495629_0087052 3300046459 Bacteria 2179
125 Ga0495638_0107968 3300046460 Bacteria 1656
126 Ga0495638_0128357 3300046460 Bacteria 1492
127 Ga0495638_0146819 3300046460 Bacteria 1371
128 Ga0495651_0015649 3300046462 Bacteria 5872
129 Ga0495653_0045794 3300046463 Bacteria 3390
130 Ga0495582_0048618 3300046473 Bacteria 2336
131 Ga0495582_0157469 3300046473 Bacteria 1291
132 Ga0495582_0167502 3300046473 Bacteria 1250
133 Ga0495605_0162689 3300046474 Bacteria 990
134 Ga0495662_0000688 3300046476 Bacteria 15993
135 Ga0495662_0020977 3300046476 Bacteria 3159
136 Ga0495664_0005748 3300046477 Bacteria 6829
137 Ga0495585_0163590 3300046492 Bacteria 1153
138 Ga0495594_0010090 3300046499 Bacteria 4892
139 Ga0495594_0029231 3300046499 Bacteria 2977
140 Ga0495594_0034986 3300046499 Bacteria 2735
141 Ga0495594_0089865 3300046499 Bacteria 1721
142 Ga0495583_0066939 3300046506 Bacteria 1588
143 Ga0495583_0091153 3300046506 Bacteria 1312
144 Ga0495618_0039232 3300046514 Bacteria 2977
145 Ga0495620_0106564 3300046515 Bacteria 1113
146 Ga0495628_0059527 3300046516 Bacteria 2998
147 Ga0495630_0036234 3300046517 Bacteria 3688
148 Ga0495630_0082097 3300046517 Bacteria 2433
149 Ga0495631_0114654 3300046518 Bacteria 1158
150 Ga0495637_0226853 3300046520 Bacteria 678
151 Ga0495643_0159443 3300046522 Bacteria 1111
152 Ga0495666_0213198 3300046526 Bacteria 885
153 Ga0495652_0031010 3300046529 Bacteria 4684
154 Ga0495640_0106012 3300046533 Bacteria 1841
155 Ga0495586_0005875 3300046535 Bacteria 6561
156 Ga0495587_0015210 3300046536 Bacteria 4808
157 Ga0495609_0167527 3300046538 Bacteria 929
158 Ga0495645_0082932 3300046543 Bacteria 2298
159 Ga0495645_0099315 3300046543 Bacteria 2071
160 Ga0495622_0056355 3300046557 Bacteria 1822
161 Ga0495634_0012194 3300046642 Bacteria 6231
162 Ga0495611_0178666 3300046648 Bacteria 992
163 Ga0495611_0189519 3300046648 Bacteria 960
164 Ga0495625_0014474 3300046660 Bacteria 6293
165 Ga0495625_0070662 3300046660 Bacteria 2451
166 Ga0495635_0011532 3300046663 Bacteria 6194
167 Ga0495659_0048655 3300046664 Bacteria 1537
168 Ga0495588_0012882 3300046674 Bacteria 3966
169 Ga0495588_0020782 3300046674 Bacteria 3230
170 Ga0495588_0026748 3300046674 Bacteria 2881
171 Ga0495588_0219676 3300046674 Bacteria 1003
172 Ga0495657_0005180 3300046675 Bacteria 10324
173 Ga0495657_0007044 3300046675 Bacteria 8722
174 Ga0495646_0005163 3300046680 Bacteria 8237
175 Ga0495658_0077214 3300046683 Bacteria 1947
176 Ga0495613_0003400 3300046689 Bacteria 11890
177 Ga0495613_0008230 3300046689 Bacteria 7743
178 Ga0495613_0207226 3300046689 Bacteria 1380
179 Ga0495670_0074301 3300046691 Bacteria 1724
180 Ga0495671_0356477 3300046692 Bacteria 701
181 Ga0495649_0066440 3300046694 Bacteria 1935
182 Ga0495649_0104151 3300046694 Bacteria 1507
183 Ga0495589_0010757 3300046794 Bacteria 4755
184 Ga0495589_0016749 3300046794 Bacteria 3764
185 Ga0495589_0101224 3300046794 Bacteria 1394
186 Ga0495600_0016334 3300046809 Bacteria 4708
187 Ga0495581_0018530 3300047315 Bacteria 4043
188 Ga0495581_0023303 3300047315 Bacteria 3587
189 Ga0495604_0003625 3300047317 Bacteria 12313
190 Ga0495636_0002801 3300047318 Bacteria 6728
191 Ga0495636_0005662 3300047318 Bacteria 4898
192 Ga0495636_0038350 3300047318 Bacteria 1982
193 Ga0495636_0042526 3300047318 Bacteria 1888
194 Ga0495636_0067028 3300047318 Bacteria 1527
195 Ga0495636_0110867 3300047318 Bacteria 1207
196 Ga0495636_0166657 3300047318 Bacteria 995
197 Ga0495674_0034861 3300047319 Bacteria 4546
198 Ga0495676_0005729 3300047321 Bacteria 11391
199 Ga0495676_0108774 3300047321 Bacteria 2038
200 Ga0495676_0167190 3300047321 Bacteria 1550
201 Ga0495676_0453623 3300047321 Bacteria 845
202 Ga0495683_0008560 3300047323 Bacteria 5469
203 Ga0495687_002141 3300047443 Bacteria 16490
204 Ga0495687_002262 3300047443 Bacteria 15788
205 Ga0495675_0023021 3300047444 Bacteria 3970
206 Ga0495675_0183386 3300047444 Bacteria 1280
207 Ga0495675_0468622 3300047444 Bacteria 727
208 Ga0495685_013465 3300047447 Bacteria 2777
209 Ga0495685_015678 3300047447 Bacteria 2587
210 Ga0495685_065956 3300047447 Bacteria 1216
211 Ga0495681_0002932 3300047470 Bacteria 12054
212 Ga0495684_0071008 3300047471 Bacteria 2646
213 Ga0495593_0003993 3300047673 Bacteria 8797
214 Ga0495593_0079556 3300047673 Bacteria 1697
215 Ga0495602_0020199 3300048088 Bacteria 6587
216 Ga0495614_0031404 3300048089 Bacteria 2285
217 Ga0495614_0051597 3300048089 Bacteria 1762
218 Ga0496106_0745363 3300048909 Bacteria 779
219 Ga0496108_0109368 3300048911 Bacteria 2362
220 Ga0496110_0720986 3300048913 Bacteria 899
221 Ga0501320_002973 3300049536 Bacteria 1400
222 Ga0501031_0058675 3300049568 Bacteria 2508
223 Ga0501032_0014868 3300049569 Bacteria 5507
224 Ga0501033_0011482 3300049570 Bacteria 6779
225 Ga0501033_0016519 3300049570 Bacteria 5588
226 Ga0501033_0150446 3300049570 Bacteria 1679
227 Ga0501033_0174504 3300049570 Bacteria 1543
228 Ga0501034_0002096 3300049571 Bacteria 24900
229 Ga0501034_0008815 3300049571 Bacteria 10613
230 Ga0501034_0021363 3300049571 Bacteria 6599
231 Ga0501034_0027771 3300049571 Bacteria 5754
232 Ga0501034_0048618 3300049571 Bacteria 4281
233 Ga0501034_0694474 3300049571 Bacteria 916
234 Ga0501034_1133357 3300049571 Bacteria 662
235 Ga0501036_0000716 3300049572 Bacteria 24540
236 Ga0501036_0007463 3300049572 Bacteria 8913
237 Ga0501036_0042796 3300049572 Bacteria 3834
238 Ga0501037_0089883 3300049573 Bacteria 2222
239 Ga0501038_0003704 3300049574 Bacteria 14243
240 Ga0501039_0021048 3300049575 Bacteria 5002
241 Ga0501039_0562631 3300049575 Bacteria 894
242 Ga0501043_0003205 3300049579 Bacteria 13534
243 Ga0501043_0012628 3300049579 Bacteria 6604
244 Ga0501047_0077587 3300049581 Bacteria 3195
245 Ga0501047_0096295 3300049581 Bacteria 2838
246 Ga0501047_0109997 3300049581 Bacteria 2638
247 Ga0501069_0455503 3300049585 Bacteria 761
248 Ga0501070_0004126 3300049586 Bacteria 12501
249 Ga0501070_0050587 3300049586 Bacteria 3449
250 Ga0501072_0263726 3300049588 Bacteria 1371
251 Ga0501073_0233259 3300049589 Bacteria 1271
252 Ga0501074_0008807 3300049590 Bacteria 7315
253 Ga0501217_007244 3300049661 Bacteria 2373
254 Ga0501080_0207136 3300049742 Bacteria 1798
255 Ga0501035_0001231 3300049822 Bacteria 26652
256 Ga0501035_0089520 3300049822 Bacteria 2711
257 Ga0501035_0204993 3300049822 Bacteria 1689
258 Ga0501044_0005521 3300049823 Bacteria 14033
259 Ga0501044_0018991 3300049823 Bacteria 7360
260 Ga0501044_0104550 3300049823 Bacteria 2845
261 Ga0501044_0175737 3300049823 Bacteria 2110
262 nmdc:mga03n38_45231_c1 3300050490 Bacteria 1938
263 nmdc:mga0yw44_306316_c1 3300050492 Bacteria 1065
264 nmdc:mga06z11_5315_c1 3300050494 Bacteria 5158
265 nmdc:mga07m45_41467_c2 3300050496 Bacteria 2097
266 Ga0495612_0048439 3300053078 Bacteria 1742
267 Ga0500640_016394 3300053095 Bacteria 3124
268 Ga0500553_180690 3300053101 Bacteria 757
269 Ga0500558_156068 3300053106 Bacteria 842
270 Ga0500572_002307 3300053111 Bacteria 4615
271 Ga0500614_034566 3300053123 Bacteria 1255
272 Ga0500628_139478 3300053129 Bacteria 671
273 Ga0500573_0049887 3300053140 Bacteria 2408
274 Ga0500586_022059 3300053145 Bacteria 2017
275 Ga0500600_0090323 3300053149 Bacteria 1637
276 Ga0500624_011315 3300053157 Bacteria 1300
277 Ga0500634_0116055 3300053161 Bacteria 1312
278 Ga0500565_026657 3300053734 Bacteria 734
279 Ga0501082_0007053 3300060353 Bacteria 9699
280 Ga0466962_0005543 3300061719 Bacteria 6059
281 Ga0466962_0117173 3300061719 Bacteria 1284
282 2873154925 2873151551 Bacteria 8625867
283 2585305112 2582581313 Bacteria 10042643
284 2585318285 2582581314 Bacteria 11452267
285 2616903591 2616644941 Bacteria 8510691
286 2643947671 2643221587 Bacteria 7586415
287 2644266199 2643221647 Bacteria 10741251
288 2644390147 2643221670 Bacteria 6497041
289 2644435363 2643221677 Bacteria 7584031
290 2644437619 2643221678 Bacteria 9540101
291 2644627923 2643221714 Bacteria 9015452
292 2784589438 2784132148 Bacteria 8627943
293 2785370513 2784746768 Bacteria 10036182
294 2785372993 2784746768 Bacteria 10036182
295 2786671671 2786546132 Bacteria 10419719
296 2808843074 2808606359 Bacteria 9866990
297 2808921417 2808606375 Bacteria 9466072
298 2809233101 2808606448 Bacteria 8656184
299 2811845328 2808606982 Bacteria 7791042
300 2812357048 2811994879 Bacteria 9313447
301 2812479710 2811994917 Bacteria 7761064
302 2852640089 2852635781 Bacteria 8251373
303 2862286702 2862281513 Bacteria 9621493
304 2862296773 2862290372 Bacteria 7471434
305 2862578411 2862574272 Bacteria 10567477
306 2867348981 2867346516 Bacteria 7608576
307 2867436285 2867428634 Bacteria 9590268
308 2877680107 2877676314 Bacteria 9512378
309 2912731021 2912723979 Bacteria 8557534
310 2912761891 2912757875 Bacteria 7940295
311 2918504581 2918501144 Bacteria 8668083
312 2919471490 2919468124 Bacteria 9133025
313 2946068829 2946064051 Bacteria 8957905
314 2946076875 2946072368 Bacteria 8999607
315 2947228081 2947224130 Bacteria 9938529
316 2954005907 2954002825 Bacteria 9173742
317 2954385040 2954380949 Bacteria 10050426
318 2954677957 2954673503 Bacteria 9685905
319 2954686200 2954682443 Bacteria 9862841
320 2954695857 2954691527 Bacteria 10720516
321 2954711049 2954701450 Bacteria 10834262
322 2954715262 2954711539 Bacteria 10867210
323 2954725203 2954721474 Bacteria 10456478
324 2954736614 2954731030 Bacteria 10243860
325 2954744136 2954740390 Bacteria 10229294
326 2954755462 2954749733 Bacteria 10366972
327 2954763077 2954759201 Bacteria 9358192
328 2990088337 2990088156 Bacteria 6657676
329 2997604975 2997600082 Bacteria 9896405
330 3006399891 3006393351 Bacteria 6615579
331 3006428439 3006425503 Bacteria 6491253
332 3006498257 3006493962 Bacteria 8825450
333 8008578035 8008574985 Bacteria 7815457
334 8023630091 8023623736 Bacteria 8593882
335 8025538115 8025530807 Bacteria 8495698
336 8056833255 8056829672 Bacteria 9045328
337 JGI24740J21852_10076060
338 JGI24739J22299_10013707
339 JGI24737J22298_10010474
340 JGI24735J21928_10014748
341 JGI24738J21930_10018768
342 rootH2_10078889
343 rootL2_10005012
344 rootH1_10024186
345 Ga0070670_100619609
346 Ga0068853_100229519
347 Ga0070672_100235206
348 Ga0070665_100228469
349 Ga0068856_100040670
350 Ga0075365_10089320
351 Ga0075368_10010579
352 Ga0075363_100022187
353 Ga0099826_10130832
354 Ga0105251_10003027
355 Ga0105250_10029918
356 Ga0105245_10304895
357 Ga0105245_10365669
358 Ga0105248_10143063
359 Ga0105238_10178408
360 Ga0105238_10257158
361 Ga0105249_10223410
362 Ga0105246_10000994
363 Ga0105246_10160163
364 Ga0157372_10063953
365 Ga0182008_10002128
366 Ga0157376_10240971
367 Ga0182007_10000634
368 Ga0182005_1071625
369 Ga0183367_1015
370 Ga0209758_1063631
371 Ga0207426_1002127
372 Ga0207696_1021091
373 Ga0207713_1012833
374 Ga0207647_10015287
375 Ga0207694_10240155
376 Ga0207694_10318973
377 Ga0207709_10158085
378 Ga0207691_10439106
379 Ga0207639_10065790
380 Ga0207702_10015760
381 Ga0207683_11107213
382 Ga0209371_1009357
383 Ga0209813_10055520
384 Ga0268266_10354004
385 Ga0307517_10003577
386 Ga0307515_10017095
387 Ga0268256_1009904
388 Ga0307511_10012518
389 Ga0307511_10029473
390 Ga0307511_10118043
391 Ga0307512_10004127
392 Ga0307512_10023170
393 Ga0307513_10059945
394 Ga0307509_10097059
395 Ga0307509_10230898
396 Ga0307509_10233777
397 Ga0307408_100785614
398 Ga0307508_10007643
399 Ga0307508_10042948
400 Ga0307514_10002213
401 Ga0307516_10016559
402 Ga0307516_10035796
403 Ga0307518_10207663
404 Ga0307507_10027109
405 Ga0307510_10022016
406 Ga0307510_10096273
407 Ga0307510_10129786
408 Ga0395898_0042518
409 Ga0439436_0014535
410 Ga0439439_0006215
411 Ga0451787_244246
412 Ga0451791_0591454
413 Ga0451837_0315258
414 Ga0451841_0902181
415 Ga0451849_0210259
416 Ga0451853_0720735
417 Ga0451853_1267955
418 Ga0439433_0000302
419 Ga0439448_0054089
420 Ga0439432_050436
421 Ga0439449_0005564
422 Ga0439449_0024875
423 Ga0439455_0004523
424 Ga0439457_002861
425 Ga0439462_0062829
426 Ga0439463_129329
427 Ga0450903_000006
428 Ga0439458_0010662
429 Ga0466969_0010971
430 Ga0466972_0002224
431 Ga0466972_0004832
432 Ga0466972_0040105
433 Ga0466972_0049015
434 Ga0466965_0001216
435 Ga0466966_0030961
436 Ga0466966_0046772
437 Ga0466961_0046525
438 Ga0466961_0141446
439 Ga0466963_0432207
440 Ga0466964_0004063
441 Ga0466971_0001022
442 Ga0466971_0007621
443 Ga0466970_0000786
444 Ga0466970_0002066
445 Ga0466957_0007791
446 Ga0466957_0906212
447 Ga0466960_0013666
448 Ga0466960_0188189
449 Ga0466959_0001420
450 Ga0466967_0023828
451 Ga0466967_0129021
452 Ga0466967_1216527
453 Ga0495592_0020548
454 Ga0495603_0006393
455 Ga0495603_0013427
456 Ga0495603_0023241
457 Ga0495629_0006224
458 Ga0495629_0025716
459 Ga0495629_0084724
460 Ga0495629_0087052
461 Ga0495638_0107968
462 Ga0495638_0128357
463 Ga0495638_0146819
464 Ga0495651_0015649
465 Ga0495653_0045794
466 Ga0495582_0048618
467 Ga0495582_0157469
468 Ga0495582_0167502
469 Ga0495605_0162689
470 Ga0495662_0000688
471 Ga0495662_0020977
472 Ga0495664_0005748
473 Ga0495585_0163590
474 Ga0495594_0010090
475 Ga0495594_0029231
476 Ga0495594_0034986
477 Ga0495594_0089865
478 Ga0495583_0066939
479 Ga0495583_0091153
480 Ga0495618_0039232
481 Ga0495620_0106564
482 Ga0495628_0059527
483 Ga0495630_0036234
484 Ga0495630_0082097
485 Ga0495631_0114654
486 Ga0495637_0226853
487 Ga0495643_0159443
488 Ga0495666_0213198
489 Ga0495652_0031010
490 Ga0495640_0106012
491 Ga0495586_0005875
492 Ga0495587_0015210
493 Ga0495609_0167527
494 Ga0495645_0082932
495 Ga0495645_0099315
496 Ga0495622_0056355
497 Ga0495634_0012194
498 Ga0495611_0178666
499 Ga0495611_0189519
500 Ga0495625_0014474
501 Ga0495625_0070662
502 Ga0495635_0011532
503 Ga0495659_0048655
504 Ga0495588_0012882
505 Ga0495588_0020782
506 Ga0495588_0026748
507 Ga0495588_0219676
508 Ga0495657_0005180
509 Ga0495657_0007044
510 Ga0495646_0005163
511 Ga0495658_0077214
512 Ga0495613_0003400
513 Ga0495613_0008230
514 Ga0495613_0207226
515 Ga0495670_0074301
516 Ga0495671_0356477
517 Ga0495649_0066440
518 Ga0495649_0104151
519 Ga0495589_0010757
520 Ga0495589_0016749
521 Ga0495589_0101224
522 Ga0495600_0016334
523 Ga0495581_0018530
524 Ga0495581_0023303
525 Ga0495604_0003625
526 Ga0495636_0002801
527 Ga0495636_0005662
528 Ga0495636_0038350
529 Ga0495636_0042526
530 Ga0495636_0067028
531 Ga0495636_0110867
532 Ga0495636_0166657
533 Ga0495674_0034861
534 Ga0495676_0005729
535 Ga0495676_0108774
536 Ga0495676_0167190
537 Ga0495676_0453623
538 Ga0495683_0008560
539 Ga0495687_002141
540 Ga0495687_002262
541 Ga0495675_0023021
542 Ga0495675_0183386
543 Ga0495675_0468622
544 Ga0495685_013465
545 Ga0495685_015678
546 Ga0495685_065956
547 Ga0495681_0002932
548 Ga0495684_0071008
549 Ga0495593_0003993
550 Ga0495593_0079556
551 Ga0495602_0020199
552 Ga0495614_0031404
553 Ga0495614_0051597
554 Ga0496106_0745363
555 Ga0496108_0109368
556 Ga0496110_0720986
557 Ga0501320_002973
558 Ga0501031_0058675
559 Ga0501032_0014868
560 Ga0501033_0011482
561 Ga0501033_0016519
562 Ga0501033_0150446
563 Ga0501033_0174504
564 Ga0501034_0002096
565 Ga0501034_0008815
566 Ga0501034_0021363
567 Ga0501034_0027771
568 Ga0501034_0048618
569 Ga0501034_0694474
570 Ga0501034_1133357
571 Ga0501036_0000716
572 Ga0501036_0007463
573 Ga0501036_0042796
574 Ga0501037_0089883
575 Ga0501038_0003704
576 Ga0501039_0021048
577 Ga0501039_0562631
578 Ga0501043_0003205
579 Ga0501043_0012628
580 Ga0501047_0077587
581 Ga0501047_0096295
582 Ga0501047_0109997
583 Ga0501069_0455503
584 Ga0501070_0004126
585 Ga0501070_0050587
586 Ga0501072_0263726
587 Ga0501073_0233259
588 Ga0501074_0008807
589 Ga0501217_007244
590 Ga0501080_0207136
591 Ga0501035_0001231
592 Ga0501035_0089520
593 Ga0501035_0204993
594 Ga0501044_0005521
595 Ga0501044_0018991
596 Ga0501044_0104550
597 Ga0501044_0175737
598 nmdc:mga03n38_45231_c1
599 nmdc:mga0yw44_306316_c1
600 nmdc:mga06z11_5315_c1
601 nmdc:mga07m45_41467_c2
602 Ga0495612_0048439
603 Ga0500640_016394
604 Ga0500553_180690
605 Ga0500558_156068
606 Ga0500572_002307
607 Ga0500614_034566
608 Ga0500628_139478
609 Ga0500573_0049887
610 Ga0500586_022059
611 Ga0500600_0090323
612 Ga0500624_011315
613 Ga0500634_0116055
614 Ga0500565_026657
615 Ga0501082_0007053
616 Ga0466962_0005543
617 Ga0466962_0117173
618 2873154925
619 2585305112
620 2585318285
621 2616903591
622 2643947671
623 2644266199
624 2644390147
625 2644435363
626 2644437619
627 2644627923
628 2784589438
629 2785370513
630 2785372993
631 2786671671
632 2808843074
633 2808921417
634 2809233101
635 2811845328
636 2812357048
637 2812479710
638 2852640089
639 2862286702
640 2862296773
641 2862578411
642 2867348981
643 2867436285
644 2877680107
645 2912731021
646 2912761891
647 2918504581
648 2919471490
649 2946068829
650 2946076875
651 2947228081
652 2954005907
653 2954385040
654 2954677957
655 2954686200
656 2954695857
657 2954711049
658 2954715262
659 2954725203
660 2954736614
661 2954744136
662 2954755462
663 2954763077
664 2990088337
665 2997604975
666 3006399891
667 3006428439
668 3006498257
669 8008578035
670 8023630091
671 8025538115
672 8056833255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

16

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eqf-assembly2.cif.gz_D crystal structure of a transcription factor in complex with ligand 0.8972 16 191
7eqf-assembly2.cif.gz_C crystal structure of a transcription factor in complex with ligand 0.8877 16 191
7eqe-assembly2.cif.gz_C crystal structure of a transcription factor 0.8804 15 191
7eqe-assembly1.cif.gz_B crystal structure of a transcription factor 0.8779 15 191
7eqf-assembly2.cif.gz_D crystal structure of a transcription factor in complex with ligand 0.8777 16 191
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9639 16 62 1.10.10.60
1jtyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9296 17 62 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9236 17 65 1.10.10.60
1qvuE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9235 17 62 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9162 18 65 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7K2W3J9-F1-model_v4 TetR family transcriptional regulator 0.9527 6 198 GO:0000976
GO:0003700
AF-A0A429R282-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9479 11 194 GO:0003677
GO:0006355
AF-A0A0N1K8R5-F1-model_v4 HTH tetR-type domain-containing protein 0.9445 13 198 GO:0000976
GO:0003700
AF-C4NYL4-F1-model_v4 SaqK 0.9431 12 190 GO:0000976
GO:0003700
AF-A0A387HKL9-F1-model_v4 HTH-type transcriptional regulator AcrR 0.9418 13 195 GO:0003677
GO:0006355

Map