F412772

General Info

Members Datasets Scaffolds Average Seq Length
336 172 672 106

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0047753|Ga0466967_0047753_574_894
Length 98
Sequence MPHIPAGEVPNGNIKGIDYGATVSLILDHSQPGEGPRLHRHPYDETWVVLDGNLTFQSPGDIVVVPPDAPHKFTNDGPGRSNMVCIHANPTMVTEWLE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.87
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 18.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0047753 3300045976 Bacteria 3734
2 Ga0070683_100017199 3300005329 Bacteria 6387
3 Ga0070709_11750974 3300005434 Unclassified 508
4 Ga0070714_100053359 3300005435 Bacteria 3450
5 Ga0070714_100697795 3300005435 Unclassified 979
6 Ga0070714_100925752 3300005435 Bacteria 847
7 Ga0070713_100218237 3300005436 Bacteria 1729
8 Ga0070713_100289811 3300005436 Bacteria 1504
9 Ga0070713_100846983 3300005436 Bacteria 878
10 Ga0070713_102134961 3300005436 Unclassified 543
11 Ga0070710_10561507 3300005437 Bacteria 789
12 Ga0070711_100039606 3300005439 Bacteria 3175
13 Ga0070711_101729931 3300005439 Bacteria 548
14 Ga0070681_10847231 3300005458 Bacteria 832
15 Ga0070681_11257348 3300005458 Bacteria 663
16 Ga0070706_100000921 3300005467 Bacteria 32203
17 Ga0070706_101413696 3300005467 Unclassified 637
18 Ga0070679_101074791 3300005530 Bacteria 749
19 Ga0070684_100053877 3300005535 Bacteria 3503
20 Ga0068853_101040255 3300005539 Bacteria 789
21 Ga0070693_100014540 3300005547 Bacteria 4035
22 Ga0070665_101809710 3300005548 Bacteria 617
23 Ga0070664_100208451 3300005564 Bacteria 1746
24 Ga0068857_100305842 3300005577 Bacteria 1466
25 Ga0068856_100118646 3300005614 Bacteria 2646
26 Ga0068852_100549333 3300005616 Bacteria 1155
27 Ga0068852_100645579 3300005616 Bacteria 1065
28 Ga0068858_101162751 3300005842 Bacteria 758
29 Ga0070717_10205483 3300006028 Bacteria 1727
30 Ga0070717_10743784 3300006028 Unclassified 891
31 Ga0070717_10966051 3300006028 Bacteria 776
32 Ga0070715_10017681 3300006163 Bacteria 2703
33 Ga0070716_100040206 3300006173 Bacteria 2601
34 Ga0070716_101052995 3300006173 Unclassified 646
35 Ga0070712_100015610 3300006175 Bacteria 4897
36 Ga0070712_100139715 3300006175 Unclassified 1847
37 Ga0075434_100049733 3300006871 Bacteria 4163
38 Ga0075436_100025329 3300006914 Bacteria 4082
39 Ga0075435_100009680 3300007076 Bacteria 6999
40 Ga0075435_100349217 3300007076 Bacteria 1268
41 Ga0105240_11458157 3300009093 Bacteria 718
42 Ga0105245_11194489 3300009098 Bacteria 808
43 Ga0105247_11129615 3300009101 Bacteria 620
44 Ga0105237_11201574 3300009545 Unclassified 765
45 Ga0105238_10033598 3300009551 Bacteria 5220
46 Ga0105238_10219615 3300009551 Bacteria 1877
47 Ga0157369_10107986 3300013105 Bacteria 2960
48 Ga0157374_10146398 3300013296 Bacteria 2294
49 Ga0157379_10262511 3300014968 Bacteria 1569
50 Ga0206354_10895034 3300020081 Bacteria 833
51 Ga0206353_11781712 3300020082 Bacteria 2525
52 Ga0213873_10046069 3300021358 Bacteria 1140
53 Ga0213874_10007299 3300021377 Bacteria 2648
54 Ga0213874_10058611 3300021377 Bacteria 1201
55 Ga0213876_10183514 3300021384 Bacteria 1113
56 Ga0213876_10192290 3300021384 Unclassified 1085
57 Ga0213876_10250314 3300021384 Bacteria 941
58 Ga0213876_10353397 3300021384 Bacteria 782
59 Ga0213875_10167409 3300021388 Unclassified 1032
60 Ga0213875_10199390 3300021388 Bacteria 941
61 Ga0207692_10171991 3300025898 Bacteria 1256
62 Ga0207710_10339940 3300025900 Bacteria 763
63 Ga0207685_10065228 3300025905 Unclassified 1457
64 Ga0207699_10745644 3300025906 Unclassified 718
65 Ga0207684_10000428 3300025910 Bacteria 55836
66 Ga0207684_11564252 3300025910 Unclassified 535
67 Ga0207707_10099040 3300025912 Bacteria 2548
68 Ga0207671_10987190 3300025914 Bacteria 664
69 Ga0207693_10002717 3300025915 Bacteria 15333
70 Ga0207693_10043678 3300025915 Bacteria 3524
71 Ga0207663_10102516 3300025916 Bacteria 1925
72 Ga0207663_10133167 3300025916 Bacteria 1721
73 Ga0207652_10807713 3300025921 Bacteria 833
74 Ga0207694_10797841 3300025924 Bacteria 797
75 Ga0207700_10194483 3300025928 Bacteria 1706
76 Ga0207700_10232641 3300025928 Bacteria 1568
77 Ga0207700_10938979 3300025928 Bacteria 774
78 Ga0207700_11564080 3300025928 Bacteria 584
79 Ga0207664_10320171 3300025929 Bacteria 1368
80 Ga0207664_10828220 3300025929 Unclassified 832
81 Ga0207664_10937694 3300025929 Bacteria 777
82 Ga0207665_10140102 3300025939 Bacteria 1724
83 Ga0207679_10998099 3300025945 Bacteria 767
84 Ga0207703_11129767 3300026035 Bacteria 753
85 Ga0207639_11333064 3300026041 Bacteria 673
86 Ga0207702_10531758 3300026078 Bacteria 1148
87 Ga0207674_10233557 3300026116 Bacteria 1787
88 Ga0207698_10460636 3300026142 Bacteria 1230
89 Ga0265319_1023647 3300028563 Bacteria 2224
90 Ga0265334_10172145 3300028573 Bacteria 758
91 Ga0265318_10038540 3300028577 Bacteria 1826
92 Ga0265336_10166572 3300028666 Unclassified 655
93 Ga0265338_10038976 3300028800 Bacteria 4492
94 Ga0265338_10079841 3300028800 Bacteria 2751
95 Ga0265330_10003135 3300031235 Bacteria 8752
96 Ga0265332_10104056 3300031238 Bacteria 1197
97 Ga0265328_10072328 3300031239 Bacteria 1268
98 Ga0265320_10106048 3300031240 Bacteria 1291
99 Ga0265325_10011621 3300031241 Bacteria 5056
100 Ga0265329_10313838 3300031242 Bacteria 532
101 Ga0265340_10101749 3300031247 Bacteria 1335
102 Ga0265339_10228457 3300031249 Bacteria 907
103 Ga0265331_10052583 3300031250 Bacteria 1945
104 Ga0265316_10009484 3300031344 Bacteria 8966
105 Ga0265313_10006408 3300031595 Bacteria 8340
106 Ga0265314_10055484 3300031711 Bacteria 2734
107 Ga0265342_10096566 3300031712 Bacteria 1688
108 Ga0373926_0277535 3300035083 Bacteria 652
109 Ga0373944_0221961 3300035089 Bacteria 690
110 Ga0373923_0147747 3300035111 Bacteria 1066
111 Ga0373945_0033449 3300035116 Bacteria 1827
112 Ga0373953_0027865 3300035117 Bacteria 2174
113 Ga0373953_0031095 3300035117 Unclassified 2075
114 Ga0373954_0230670 3300035118 Bacteria 911
115 Ga0373956_0036357 3300035119 Bacteria 2174
116 Ga0373957_0051352 3300035120 Unclassified 1578
117 Ga0373957_0208311 3300035120 Unclassified 816
118 Ga0373957_0307663 3300035120 Bacteria 673
119 Ga0373943_0010264 3300035170 Bacteria 4201
120 Ga0373946_0004571 3300035171 Bacteria 4960
121 Ga0373946_0055378 3300035171 Bacteria 1672
122 Ga0373955_0056644 3300035172 Bacteria 2151
123 Ga0373955_0062517 3300035172 Bacteria 2059
124 Ga0373955_0584889 3300035172 Unclassified 683
125 Ga0373924_0051671 3300035410 Bacteria 1705
126 Ga0373924_0295000 3300035410 Unclassified 720
127 Ga0373933_0043327 3300035724 Bacteria 2663
128 Ga0373933_0083466 3300035724 Bacteria 1962
129 Ga0373933_0143681 3300035724 Bacteria 1508
130 Ga0373937_0027404 3300036401 Bacteria 5153
131 Ga0373937_0188517 3300036401 Bacteria 1937
132 Ga0373937_0193944 3300036401 Unclassified 1909
133 Ga0373937_1715816 3300036401 Bacteria 575
134 Ga0373925_0046102 3300037068 Bacteria 3240
135 Ga0373925_0064538 3300037068 Bacteria 2756
136 Ga0436364_0237701 3300037853 Unclassified 525
137 Ga0436364_0255642 3300037853 Bacteria 1903
138 Ga0436364_0540370 3300037853 Bacteria 46403
139 Ga0436364_0934983 3300037853 Bacteria 3573
140 Ga0436365_0348289 3300039437 Bacteria 6539
141 Ga0436365_0377994 3300039437 Bacteria 2213
142 Ga0436365_0413410 3300039437 Bacteria 8316
143 Ga0436365_0531688 3300039437 Bacteria 2641
144 Ga0436365_0658318 3300039437 Bacteria 15458
145 Ga0436365_1016507 3300039437 Bacteria 1949
146 Ga0436365_1306251 3300039437 Bacteria 2070
147 Ga0436363_0225759 3300039450 Bacteria 6053
148 Ga0436363_0962058 3300039450 Bacteria 1030
149 Ga0436363_1265155 3300039450 Bacteria 80087
150 Ga0436362_0049198 3300039453 Bacteria 553
151 Ga0466972_0067587 3300044658 Bacteria 1707
152 Ga0466965_0230249 3300044683 Bacteria 990
153 Ga0466965_0401545 3300044683 Bacteria 757
154 Ga0466966_0236728 3300044684 Unclassified 1101
155 Ga0466966_0672406 3300044684 Bacteria 624
156 Ga0466966_0777606 3300044684 Unclassified 577
157 Ga0466966_0815135 3300044684 Bacteria 563
158 Ga0466961_0292037 3300044693 Unclassified 997
159 Ga0466961_0982669 3300044693 Unclassified 502
160 Ga0466963_0005743 3300044694 Bacteria 7293
161 Ga0466963_0014120 3300044694 Bacteria 4920
162 Ga0466963_0020423 3300044694 Bacteria 4164
163 Ga0466963_0043474 3300044694 Bacteria 2954
164 Ga0466963_0161154 3300044694 Bacteria 1561
165 Ga0466963_0463080 3300044694 Bacteria 895
166 Ga0466963_0478463 3300044694 Unclassified 879
167 Ga0466964_0096753 3300044706 Bacteria 1294
168 Ga0466964_0156278 3300044706 Unclassified 1062
169 Ga0466964_0295443 3300044706 Unclassified 815
170 Ga0466971_0018232 3300044719 Bacteria 3109
171 Ga0466971_0029882 3300044719 Unclassified 2438
172 Ga0466971_0082830 3300044719 Bacteria 1464
173 Ga0466971_0466761 3300044719 Unclassified 620
174 Ga0466968_0128101 3300044735 Bacteria 1153
175 Ga0466968_0540880 3300044735 Unclassified 584
176 Ga0466968_0723259 3300044735 Unclassified 509
177 Ga0466970_0258877 3300044765 Bacteria 976
178 Ga0466970_0766210 3300044765 Viruses 564
179 Ga0466957_0073271 3300044842 Bacteria 2122
180 Ga0466957_0104920 3300044842 Bacteria 1786
181 Ga0466957_0114383 3300044842 Bacteria 1714
182 Ga0466957_0380258 3300044842 Viruses 963
183 Ga0466957_0497927 3300044842 Bacteria 844
184 Ga0466960_0026760 3300044901 Bacteria 2623
185 Ga0466959_0018861 3300045049 Bacteria 5068
186 Ga0466959_0074953 3300045049 Bacteria 2446
187 Ga0466959_0574607 3300045049 Bacteria 759
188 Ga0466958_0003811 3300045836 Bacteria 7877
189 Ga0466958_0028005 3300045836 Bacteria 3338
190 Ga0466958_0048355 3300045836 Bacteria 2570
191 Ga0466958_0386457 3300045836 Bacteria 903
192 Ga0466958_0588616 3300045836 Bacteria 723
193 Ga0466967_0000867 3300045976 Bacteria 16116
194 Ga0466967_0007568 3300045976 Bacteria 7850
195 Ga0466967_0016677 3300045976 Bacteria 5801
196 Ga0466967_0032027 3300045976 Bacteria 4435
197 Ga0466967_0038476 3300045976 Bacteria 4103
198 Ga0466967_0135251 3300045976 Bacteria 2292
199 Ga0466967_0156508 3300045976 Bacteria 2135
200 Ga0466967_0163730 3300045976 Bacteria 2089
201 Ga0466967_0458429 3300045976 Unclassified 1247
202 Ga0466967_0777586 3300045976 Bacteria 950
203 Ga0466967_1398760 3300045976 Bacteria 697
204 Ga0466967_2151906 3300045976 Unclassified 554
205 Ga0495592_0104265 3300046454 Bacteria 2016
206 Ga0495592_0278362 3300046454 Bacteria 1095
207 Ga0495603_0118889 3300046455 Bacteria 1540
208 Ga0495629_0268530 3300046459 Bacteria 1172
209 Ga0495651_0121871 3300046462 Bacteria 1914
210 Ga0495651_0156360 3300046462 Bacteria 1638
211 Ga0495651_0193899 3300046462 Unclassified 1427
212 Ga0495653_0254639 3300046463 Bacteria 1163
213 Ga0495653_0387353 3300046463 Unclassified 891
214 Ga0495582_0054500 3300046473 Bacteria 2204
215 Ga0495582_0074889 3300046473 Bacteria 1874
216 Ga0495639_0094857 3300046475 Bacteria 1403
217 Ga0495662_0010741 3300046476 Bacteria 4477
218 Ga0495662_0076772 3300046476 Bacteria 1622
219 Ga0495662_0202429 3300046476 Unclassified 979
220 Ga0495664_0016647 3300046477 Bacteria 4192
221 Ga0495664_0174049 3300046477 Unclassified 1306
222 Ga0495664_0934172 3300046477 Bacteria 506
223 Ga0495594_0096607 3300046499 Bacteria 1660
224 Ga0495608_0014793 3300046511 Bacteria 5413
225 Ga0495608_0055221 3300046511 Bacteria 2624
226 Ga0495608_0071099 3300046511 Bacteria 2271
227 Ga0495608_0606643 3300046511 Unclassified 656
228 Ga0495618_0168910 3300046514 Bacteria 1392
229 Ga0495618_0854462 3300046514 Bacteria 527
230 Ga0495628_0080157 3300046516 Unclassified 2538
231 Ga0495630_0014619 3300046517 Bacteria 5720
232 Ga0495630_0099908 3300046517 Bacteria 2195
233 Ga0495630_0242603 3300046517 Bacteria 1377
234 Ga0495630_0760721 3300046517 Bacteria 740
235 Ga0495630_1035392 3300046517 Unclassified 623
236 Ga0495666_0035105 3300046526 Bacteria 2445
237 Ga0495666_0137910 3300046526 Bacteria 1138
238 Ga0495652_0029613 3300046529 Bacteria 4809
239 Ga0495652_0634386 3300046529 Unclassified 725
240 Ga0495665_0012857 3300046531 Bacteria 4530
241 Ga0495640_0101166 3300046533 Bacteria 1891
242 Ga0495640_0629695 3300046533 Unclassified 646
243 Ga0495640_0702708 3300046533 Bacteria 606
244 Ga0495586_0443094 3300046535 Bacteria 748
245 Ga0495587_0285002 3300046536 Bacteria 925
246 Ga0495645_0271297 3300046543 Bacteria 1120
247 Ga0495667_0025657 3300046559 Bacteria 3970
248 Ga0495667_0026128 3300046559 Bacteria 3933
249 Ga0495667_0042933 3300046559 Bacteria 2997
250 Ga0495667_0055879 3300046559 Unclassified 2596
251 Ga0495634_0141719 3300046642 Unclassified 1526
252 Ga0495634_0228206 3300046642 Bacteria 1146
253 Ga0495634_0331039 3300046642 Bacteria 915
254 Ga0495634_0632794 3300046642 Bacteria 619
255 Ga0495635_0009114 3300046663 Bacteria 6929
256 Ga0495635_0135848 3300046663 Bacteria 1676
257 Ga0495635_0145063 3300046663 Unclassified 1616
258 Ga0495635_0443672 3300046663 Bacteria 859
259 Ga0495588_0070747 3300046674 Bacteria 1813
260 Ga0495657_0047108 3300046675 Bacteria 2916
261 Ga0495657_0084566 3300046675 Unclassified 2046
262 Ga0495657_0084836 3300046675 Bacteria 2042
263 Ga0495657_0355848 3300046675 Bacteria 866
264 Ga0495623_0134285 3300046679 Unclassified 1478
265 Ga0495646_0188379 3300046680 Bacteria 1129
266 Ga0495646_0454268 3300046680 Bacteria 661
267 Ga0495647_0001068 3300046681 Bacteria 8346
268 Ga0495647_0166635 3300046681 Bacteria 952
269 Ga0495658_0087854 3300046683 Bacteria 1836
270 Ga0495658_0513880 3300046683 Bacteria 767
271 Ga0495613_0108441 3300046689 Bacteria 2002
272 Ga0495613_0132215 3300046689 Archaea 1787
273 Ga0495613_1125202 3300046689 Unclassified 500
274 Ga0495624_0025657 3300046690 Bacteria 3868
275 Ga0495624_0095685 3300046690 Bacteria 1830
276 Ga0495600_0059770 3300046809 Bacteria 2489
277 Ga0495600_0124566 3300046809 Unclassified 1676
278 Ga0495600_0182291 3300046809 Bacteria 1353
279 Ga0495581_0003939 3300047315 Bacteria 8546
280 Ga0495581_0038641 3300047315 Bacteria 2762
281 Ga0495674_0015651 3300047319 Bacteria 7082
282 Ga0495674_0017144 3300047319 Bacteria 6746
283 Ga0495674_0891763 3300047319 Bacteria 687
284 Ga0495674_1406977 3300047319 Bacteria 519
285 Ga0495676_0007498 3300047321 Bacteria 10006
286 Ga0495676_0018309 3300047321 Bacteria 6176
287 Ga0495680_0015848 3300047322 Bacteria 6488
288 Ga0495680_0120696 3300047322 Bacteria 1935
289 Ga0495680_1103233 3300047322 Unclassified 501
290 Ga0495675_0248413 3300047444 Bacteria 1069
291 Ga0495684_0010687 3300047471 Bacteria 7096
292 Ga0495684_0267322 3300047471 Bacteria 1238
293 Ga0495593_0009977 3300047673 Bacteria 5503
294 Ga0495593_0099753 3300047673 Bacteria 1490
295 Ga0495593_0185757 3300047673 Archaea 1047
296 Ga0495602_0141311 3300048088 Unclassified 1905
297 Ga0495602_0314971 3300048088 Bacteria 1140
298 Ga0495602_0786592 3300048088 Bacteria 640
299 Ga0495614_0007678 3300048089 Bacteria 4791
300 Ga0496102_0808521 3300048905 Bacteria 860
301 Ga0496103_0313033 3300048906 Bacteria 1010
302 Ga0496104_0033547 3300048907 Bacteria 4784
303 Ga0496104_1160109 3300048907 Bacteria 676
304 Ga0496105_0335506 3300048908 Unclassified 1210
305 Ga0496105_1071007 3300048908 Unclassified 600
306 Ga0496109_0230338 3300048912 Unclassified 1743
307 Ga0496109_0995033 3300048912 Bacteria 776
308 Ga0496112_0005480 3300048915 Bacteria 10984
309 Ga0496112_0726710 3300048915 Bacteria 920
310 Ga0496113_0879509 3300048916 Unclassified 709
311 Ga0496114_0316064 3300048917 Unclassified 1380
312 Ga0496115_0464534 3300048918 Bacteria 1021
313 Ga0501067_0009658 3300049583 Bacteria 5341
314 Ga0501069_0052871 3300049585 Bacteria 2262
315 Ga0501081_0163266 3300049743 Bacteria 1606
316 nmdc:mga0n895_30252_c1 3300050512 Bacteria 5173
317 nmdc:mga0rr50_14801_c1 3300050513 Bacteria 5131
318 nmdc:mga08x19_33739_c1 3300050514 Bacteria 3231
319 Ga0495601_0015977 3300053077 Bacteria 4542
320 Ga0495601_0060585 3300053077 Bacteria 2401
321 Ga0495601_0244077 3300053077 Unclassified 1173
322 Ga0495601_0268184 3300053077 Bacteria 1114
323 Ga0495612_0009041 3300053078 Bacteria 4040
324 Ga0495612_0318175 3300053078 Unclassified 700
325 Ga0495595_0084593 3300053084 Bacteria 1516
326 Ga0495595_0120574 3300053084 Bacteria 1277
327 Ga0495595_0128873 3300053084 Bacteria 1235
328 Ga0495595_0365430 3300053084 Unclassified 729
329 Ga0495619_0037151 3300053085 Bacteria 3172
330 Ga0495619_0050600 3300053085 Bacteria 2743
331 Ga0495619_0052080 3300053085 Bacteria 2706
332 Ga0495619_0070713 3300053085 Unclassified 2334
333 Ga0495619_0175754 3300053085 Bacteria 1481
334 Ga0466962_0065177 3300061719 Unclassified 1739
335 Ga0466962_0095490 3300061719 Bacteria 1425
336 Ga0466962_0200924 3300061719 Bacteria 974
337 Ga0466967_0047753
338 Ga0070683_100017199
339 Ga0070709_11750974
340 Ga0070714_100053359
341 Ga0070714_100697795
342 Ga0070714_100925752
343 Ga0070713_100218237
344 Ga0070713_100289811
345 Ga0070713_100846983
346 Ga0070713_102134961
347 Ga0070710_10561507
348 Ga0070711_100039606
349 Ga0070711_101729931
350 Ga0070681_10847231
351 Ga0070681_11257348
352 Ga0070706_100000921
353 Ga0070706_101413696
354 Ga0070679_101074791
355 Ga0070684_100053877
356 Ga0068853_101040255
357 Ga0070693_100014540
358 Ga0070665_101809710
359 Ga0070664_100208451
360 Ga0068857_100305842
361 Ga0068856_100118646
362 Ga0068852_100549333
363 Ga0068852_100645579
364 Ga0068858_101162751
365 Ga0070717_10205483
366 Ga0070717_10743784
367 Ga0070717_10966051
368 Ga0070715_10017681
369 Ga0070716_100040206
370 Ga0070716_101052995
371 Ga0070712_100015610
372 Ga0070712_100139715
373 Ga0075434_100049733
374 Ga0075436_100025329
375 Ga0075435_100009680
376 Ga0075435_100349217
377 Ga0105240_11458157
378 Ga0105245_11194489
379 Ga0105247_11129615
380 Ga0105237_11201574
381 Ga0105238_10033598
382 Ga0105238_10219615
383 Ga0157369_10107986
384 Ga0157374_10146398
385 Ga0157379_10262511
386 Ga0206354_10895034
387 Ga0206353_11781712
388 Ga0213873_10046069
389 Ga0213874_10007299
390 Ga0213874_10058611
391 Ga0213876_10183514
392 Ga0213876_10192290
393 Ga0213876_10250314
394 Ga0213876_10353397
395 Ga0213875_10167409
396 Ga0213875_10199390
397 Ga0207692_10171991
398 Ga0207710_10339940
399 Ga0207685_10065228
400 Ga0207699_10745644
401 Ga0207684_10000428
402 Ga0207684_11564252
403 Ga0207707_10099040
404 Ga0207671_10987190
405 Ga0207693_10002717
406 Ga0207693_10043678
407 Ga0207663_10102516
408 Ga0207663_10133167
409 Ga0207652_10807713
410 Ga0207694_10797841
411 Ga0207700_10194483
412 Ga0207700_10232641
413 Ga0207700_10938979
414 Ga0207700_11564080
415 Ga0207664_10320171
416 Ga0207664_10828220
417 Ga0207664_10937694
418 Ga0207665_10140102
419 Ga0207679_10998099
420 Ga0207703_11129767
421 Ga0207639_11333064
422 Ga0207702_10531758
423 Ga0207674_10233557
424 Ga0207698_10460636
425 Ga0265319_1023647
426 Ga0265334_10172145
427 Ga0265318_10038540
428 Ga0265336_10166572
429 Ga0265338_10038976
430 Ga0265338_10079841
431 Ga0265330_10003135
432 Ga0265332_10104056
433 Ga0265328_10072328
434 Ga0265320_10106048
435 Ga0265325_10011621
436 Ga0265329_10313838
437 Ga0265340_10101749
438 Ga0265339_10228457
439 Ga0265331_10052583
440 Ga0265316_10009484
441 Ga0265313_10006408
442 Ga0265314_10055484
443 Ga0265342_10096566
444 Ga0373926_0277535
445 Ga0373944_0221961
446 Ga0373923_0147747
447 Ga0373945_0033449
448 Ga0373953_0027865
449 Ga0373953_0031095
450 Ga0373954_0230670
451 Ga0373956_0036357
452 Ga0373957_0051352
453 Ga0373957_0208311
454 Ga0373957_0307663
455 Ga0373943_0010264
456 Ga0373946_0004571
457 Ga0373946_0055378
458 Ga0373955_0056644
459 Ga0373955_0062517
460 Ga0373955_0584889
461 Ga0373924_0051671
462 Ga0373924_0295000
463 Ga0373933_0043327
464 Ga0373933_0083466
465 Ga0373933_0143681
466 Ga0373937_0027404
467 Ga0373937_0188517
468 Ga0373937_0193944
469 Ga0373937_1715816
470 Ga0373925_0046102
471 Ga0373925_0064538
472 Ga0436364_0237701
473 Ga0436364_0255642
474 Ga0436364_0540370
475 Ga0436364_0934983
476 Ga0436365_0348289
477 Ga0436365_0377994
478 Ga0436365_0413410
479 Ga0436365_0531688
480 Ga0436365_0658318
481 Ga0436365_1016507
482 Ga0436365_1306251
483 Ga0436363_0225759
484 Ga0436363_0962058
485 Ga0436363_1265155
486 Ga0436362_0049198
487 Ga0466972_0067587
488 Ga0466965_0230249
489 Ga0466965_0401545
490 Ga0466966_0236728
491 Ga0466966_0672406
492 Ga0466966_0777606
493 Ga0466966_0815135
494 Ga0466961_0292037
495 Ga0466961_0982669
496 Ga0466963_0005743
497 Ga0466963_0014120
498 Ga0466963_0020423
499 Ga0466963_0043474
500 Ga0466963_0161154
501 Ga0466963_0463080
502 Ga0466963_0478463
503 Ga0466964_0096753
504 Ga0466964_0156278
505 Ga0466964_0295443
506 Ga0466971_0018232
507 Ga0466971_0029882
508 Ga0466971_0082830
509 Ga0466971_0466761
510 Ga0466968_0128101
511 Ga0466968_0540880
512 Ga0466968_0723259
513 Ga0466970_0258877
514 Ga0466970_0766210
515 Ga0466957_0073271
516 Ga0466957_0104920
517 Ga0466957_0114383
518 Ga0466957_0380258
519 Ga0466957_0497927
520 Ga0466960_0026760
521 Ga0466959_0018861
522 Ga0466959_0074953
523 Ga0466959_0574607
524 Ga0466958_0003811
525 Ga0466958_0028005
526 Ga0466958_0048355
527 Ga0466958_0386457
528 Ga0466958_0588616
529 Ga0466967_0000867
530 Ga0466967_0007568
531 Ga0466967_0016677
532 Ga0466967_0032027
533 Ga0466967_0038476
534 Ga0466967_0135251
535 Ga0466967_0156508
536 Ga0466967_0163730
537 Ga0466967_0458429
538 Ga0466967_0777586
539 Ga0466967_1398760
540 Ga0466967_2151906
541 Ga0495592_0104265
542 Ga0495592_0278362
543 Ga0495603_0118889
544 Ga0495629_0268530
545 Ga0495651_0121871
546 Ga0495651_0156360
547 Ga0495651_0193899
548 Ga0495653_0254639
549 Ga0495653_0387353
550 Ga0495582_0054500
551 Ga0495582_0074889
552 Ga0495639_0094857
553 Ga0495662_0010741
554 Ga0495662_0076772
555 Ga0495662_0202429
556 Ga0495664_0016647
557 Ga0495664_0174049
558 Ga0495664_0934172
559 Ga0495594_0096607
560 Ga0495608_0014793
561 Ga0495608_0055221
562 Ga0495608_0071099
563 Ga0495608_0606643
564 Ga0495618_0168910
565 Ga0495618_0854462
566 Ga0495628_0080157
567 Ga0495630_0014619
568 Ga0495630_0099908
569 Ga0495630_0242603
570 Ga0495630_0760721
571 Ga0495630_1035392
572 Ga0495666_0035105
573 Ga0495666_0137910
574 Ga0495652_0029613
575 Ga0495652_0634386
576 Ga0495665_0012857
577 Ga0495640_0101166
578 Ga0495640_0629695
579 Ga0495640_0702708
580 Ga0495586_0443094
581 Ga0495587_0285002
582 Ga0495645_0271297
583 Ga0495667_0025657
584 Ga0495667_0026128
585 Ga0495667_0042933
586 Ga0495667_0055879
587 Ga0495634_0141719
588 Ga0495634_0228206
589 Ga0495634_0331039
590 Ga0495634_0632794
591 Ga0495635_0009114
592 Ga0495635_0135848
593 Ga0495635_0145063
594 Ga0495635_0443672
595 Ga0495588_0070747
596 Ga0495657_0047108
597 Ga0495657_0084566
598 Ga0495657_0084836
599 Ga0495657_0355848
600 Ga0495623_0134285
601 Ga0495646_0188379
602 Ga0495646_0454268
603 Ga0495647_0001068
604 Ga0495647_0166635
605 Ga0495658_0087854
606 Ga0495658_0513880
607 Ga0495613_0108441
608 Ga0495613_0132215
609 Ga0495613_1125202
610 Ga0495624_0025657
611 Ga0495624_0095685
612 Ga0495600_0059770
613 Ga0495600_0124566
614 Ga0495600_0182291
615 Ga0495581_0003939
616 Ga0495581_0038641
617 Ga0495674_0015651
618 Ga0495674_0017144
619 Ga0495674_0891763
620 Ga0495674_1406977
621 Ga0495676_0007498
622 Ga0495676_0018309
623 Ga0495680_0015848
624 Ga0495680_0120696
625 Ga0495680_1103233
626 Ga0495675_0248413
627 Ga0495684_0010687
628 Ga0495684_0267322
629 Ga0495593_0009977
630 Ga0495593_0099753
631 Ga0495593_0185757
632 Ga0495602_0141311
633 Ga0495602_0314971
634 Ga0495602_0786592
635 Ga0495614_0007678
636 Ga0496102_0808521
637 Ga0496103_0313033
638 Ga0496104_0033547
639 Ga0496104_1160109
640 Ga0496105_0335506
641 Ga0496105_1071007
642 Ga0496109_0230338
643 Ga0496109_0995033
644 Ga0496112_0005480
645 Ga0496112_0726710
646 Ga0496113_0879509
647 Ga0496114_0316064
648 Ga0496115_0464534
649 Ga0501067_0009658
650 Ga0501069_0052871
651 Ga0501081_0163266
652 nmdc:mga0n895_30252_c1
653 nmdc:mga0rr50_14801_c1
654 nmdc:mga08x19_33739_c1
655 Ga0495601_0015977
656 Ga0495601_0060585
657 Ga0495601_0244077
658 Ga0495601_0268184
659 Ga0495612_0009041
660 Ga0495612_0318175
661 Ga0495595_0084593
662 Ga0495595_0120574
663 Ga0495595_0128873
664 Ga0495595_0365430
665 Ga0495619_0037151
666 Ga0495619_0050600
667 Ga0495619_0052080
668 Ga0495619_0070713
669 Ga0495619_0175754
670 Ga0466962_0065177
671 Ga0466962_0095490
672 Ga0466962_0200924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

27

87

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.954 22 97
4met-assembly1.cif.gz_A assigning the epr fine structure parameters of the mn(ii) centers in bacillus subtilis oxalate decarboxylase by site-directed mutagenesis and dft/mm calculations 0.9532 22 105
5hi0-assembly1.cif.gz_A the substrate binding mode and chemical basis of a reaction specificity switch in oxalate decarboxylase 0.9469 22 105
2uya-assembly1.cif.gz_A del162-163 mutant of bacillus subtilis oxalate decarboxylase oxdc 0.9464 22 105
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.9459 22 97
ID Description Score Start End Superfamily
af_A0A1D6KN97_1_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9556 22 104 2.60.120.10
af_A0A1D6KN98_1_91_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9541 39 103 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9533 21 95 2.60.120.10
af_P33487_36_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 22 107 2.60.120.10
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9493 22 105 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A511ABG7-F1-model_v4 Cupin type-2 domain-containing protein 0.9925 13 106
AF-A0A7T9TP79-F1-model_v4 deleted 0.9917 26 105
AF-A0A2V6D631-F1-model_v4 Cupin domain-containing protein 0.9912 25 105
AF-A0A0T6ZN11-F1-model_v4 Cupin 0.9906 13 105 GO:0046872
AF-A0A5E8ABR3-F1-model_v4 deleted 0.9895 13 106

Map