F412755

General Info

Members Datasets Scaffolds Average Seq Length
336 203 672 214

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0816728|Ga0395900_0816728_49_831
Length 260
Sequence LTAKLETLSGVSGVELEEAQPQRQAVSTTSATPLRIGADATRRPVGKLAAMADRWATFDCYGTLIDWNGGIRGQLARVFGEERADALLVRYHVLEPMLEADGTRSYREVLTEAMRGLGAPPEEEDALAQSLPSWQPFPEVPAALMAARGRGWKLAILSNTDRDYIEASLAQLGVPFEVSIVASEIGSYKPALGHWRAFEERVGGPPDVHVAASLFHDVAPANELGLPSIWINRLGETSGPQPTRELPDLTRLADMLEEVA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.1
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0816728 3300037418 Bacteria 859
2 Ga0070683_100002072 3300005329 Bacteria 15836
3 Ga0070683_100103658 3300005329 Bacteria 2681
4 Ga0070683_100203059 3300005329 Bacteria 1882
5 Ga0070680_100014225 3300005336 Bacteria 6214
6 Ga0070680_100029577 3300005336 Bacteria 4400
7 Ga0070680_100094767 3300005336 Bacteria 2474
8 Ga0070682_100035364 3300005337 Bacteria 3050
9 Ga0068868_100050348 3300005338 Bacteria 3271
10 Ga0068868_100119735 3300005338 Bacteria 2146
11 Ga0070660_100298889 3300005339 Unclassified 1319
12 Ga0070691_10070929 3300005341 Bacteria 1691
13 Ga0070687_100229931 3300005343 Unclassified 1141
14 Ga0070673_100145241 3300005364 Bacteria 2005
15 Ga0070709_10154884 3300005434 Bacteria 1587
16 Ga0070714_100008154 3300005435 Bacteria 8164
17 Ga0070714_100039630 3300005435 Bacteria 3967
18 Ga0070714_100168727 3300005435 Bacteria 1985
19 Ga0070714_100254429 3300005435 Bacteria 1625
20 Ga0070713_100033639 3300005436 Bacteria 4109
21 Ga0070713_100091340 3300005436 Bacteria 2619
22 Ga0070713_100225369 3300005436 Bacteria 1702
23 Ga0070710_10091916 3300005437 Bacteria 1791
24 Ga0070701_10110761 3300005438 Unclassified 1533
25 Ga0070711_100039992 3300005439 Bacteria 3160
26 Ga0070711_100416572 3300005439 Unclassified 1094
27 Ga0070705_100062565 3300005440 Bacteria 2216
28 Ga0070700_100029373 3300005441 Bacteria 3277
29 Ga0070694_100059939 3300005444 Bacteria 2594
30 Ga0070708_100087852 3300005445 Bacteria 2826
31 Ga0070708_100118294 3300005445 Bacteria 2441
32 Ga0070663_100318629 3300005455 Bacteria 1250
33 Ga0070678_100194227 3300005456 Bacteria 1671
34 Ga0070662_100021251 3300005457 Bacteria 4430
35 Ga0070681_10017860 3300005458 Bacteria 7088
36 Ga0070681_10387226 3300005458 Bacteria 1309
37 Ga0070681_10391336 3300005458 Bacteria 1301
38 Ga0068867_100078229 3300005459 Bacteria 2487
39 Ga0070685_10074580 3300005466 Bacteria 2019
40 Ga0070706_100009928 3300005467 Bacteria 8840
41 Ga0070706_100103919 3300005467 Bacteria 2641
42 Ga0070707_100001488 3300005468 Bacteria 22852
43 Ga0070707_100176098 3300005468 Bacteria 2085
44 Ga0070699_100103511 3300005518 Bacteria 2496
45 Ga0070679_100154514 3300005530 Bacteria 2270
46 Ga0070679_100237291 3300005530 Bacteria 1782
47 Ga0070679_100667096 3300005530 Bacteria 983
48 Ga0070684_100139841 3300005535 Bacteria 2189
49 Ga0070684_100203198 3300005535 Bacteria 1805
50 Ga0070686_100278026 3300005544 Bacteria 1233
51 Ga0070686_100320994 3300005544 Bacteria 1154
52 Ga0070695_100277724 3300005545 Bacteria 1230
53 Ga0070696_100032197 3300005546 Bacteria 3597
54 Ga0070693_100016090 3300005547 Bacteria 3864
55 Ga0070693_100061804 3300005547 Unclassified 2179
56 Ga0070693_100192825 3300005547 Bacteria 1319
57 Ga0068855_101171954 3300005563 Bacteria 800
58 Ga0068854_100012319 3300005578 Bacteria 5596
59 Ga0068856_100448054 3300005614 Bacteria 1311
60 Ga0070702_100040086 3300005615 Bacteria 2617
61 Ga0068864_100033506 3300005618 Bacteria 4367
62 Ga0068866_10114178 3300005718 Unclassified 1512
63 Ga0068861_100248409 3300005719 Unclassified 1517
64 Ga0068861_100661570 3300005719 Bacteria 966
65 Ga0068862_100511167 3300005844 Unclassified 1142
66 Ga0081455_10006302 3300005937 Bacteria 12750
67 Ga0081540_1004699 3300005983 Bacteria 10333
68 Ga0081540_1013531 3300005983 Bacteria 5298
69 Ga0070717_10304653 3300006028 Bacteria 1417
70 Ga0075432_10112414 3300006058 Bacteria 1016
71 Ga0097621_100009879 3300006237 Bacteria 6949
72 Ga0075431_100053795 3300006847 Bacteria 4151
73 Ga0075433_10004020 3300006852 Bacteria 11373
74 Ga0075434_100015066 3300006871 Bacteria 7402
75 Ga0068865_100047610 3300006881 Bacteria 2947
76 Ga0075436_100013133 3300006914 Bacteria 5678
77 Ga0075435_100005062 3300007076 Bacteria 9161
78 Ga0075435_100558277 3300007076 Bacteria 992
79 Ga0111539_10322763 3300009094 Bacteria 1797
80 Ga0105245_10055260 3300009098 Bacteria 3566
81 Ga0105245_10092668 3300009098 Bacteria 2783
82 Ga0105245_10233333 3300009098 Unclassified 1780
83 Ga0114129_10126459 3300009147 Bacteria 3514
84 Ga0114129_11175108 3300009147 Bacteria 957
85 Ga0105243_10919037 3300009148 Unclassified 872
86 Ga0105241_10121487 3300009174 Bacteria 2104
87 Ga0105241_10213361 3300009174 Bacteria 1618
88 Ga0105242_10018349 3300009176 Bacteria 5468
89 Ga0105248_10161282 3300009177 Bacteria 2529
90 Ga0105237_10145676 3300009545 Bacteria 2363
91 Ga0105238_10207381 3300009551 Bacteria 1936
92 Ga0105249_10162091 3300009553 Bacteria 2162
93 Ga0105239_10058220 3300010375 Bacteria 4240
94 Ga0105239_10505424 3300010375 Bacteria 1374
95 Ga0105246_10035548 3300011119 Bacteria 3330
96 Ga0105246_10250033 3300011119 Bacteria 1406
97 Ga0157341_1001206 3300012494 Bacteria 1518
98 Ga0157373_10337770 3300013100 Bacteria 1073
99 Ga0157370_10303426 3300013104 Unclassified 1474
100 Ga0157378_10323225 3300013297 Unclassified 1499
101 Ga0157372_10159906 3300013307 Bacteria 2603
102 Ga0157372_10169774 3300013307 Bacteria 2523
103 Ga0157372_10183841 3300013307 Bacteria 2420
104 Ga0157375_11187193 3300013308 Bacteria 895
105 Ga0157375_11562214 3300013308 Unclassified 780
106 Ga0157380_10075671 3300014326 Bacteria 2737
107 Ga0182008_10057963 3300014497 Bacteria 1912
108 Ga0157376_10061393 3300014969 Bacteria 3160
109 Ga0157376_10683110 3300014969 Bacteria 1030
110 Ga0207692_10119512 3300025898 Bacteria 1473
111 Ga0207642_10170435 3300025899 Unclassified 1177
112 Ga0207688_10271038 3300025901 Bacteria 1032
113 Ga0207699_10044818 3300025906 Bacteria 2577
114 Ga0207684_10126682 3300025910 Bacteria 2191
115 Ga0207707_10013404 3300025912 Bacteria 7147
116 Ga0207707_10016223 3300025912 Bacteria 6499
117 Ga0207695_10446878 3300025913 Bacteria 1176
118 Ga0207671_10068310 3300025914 Unclassified 2648
119 Ga0207693_10228956 3300025915 Bacteria 1460
120 Ga0207663_10004930 3300025916 Bacteria 6683
121 Ga0207652_10136004 3300025921 Bacteria 2195
122 Ga0207652_10200195 3300025921 Bacteria 1797
123 Ga0207652_10730124 3300025921 Bacteria 882
124 Ga0207646_10162919 3300025922 Bacteria 2013
125 Ga0207681_10052909 3300025923 Bacteria 2755
126 Ga0207687_10132294 3300025927 Unclassified 1882
127 Ga0207700_10186653 3300025928 Bacteria 1740
128 Ga0207700_10403631 3300025928 Bacteria 1198
129 Ga0207700_10592649 3300025928 Unclassified 986
130 Ga0207664_10007454 3300025929 Bacteria 7588
131 Ga0207664_10174673 3300025929 Bacteria 1841
132 Ga0207664_10556928 3300025929 Bacteria 1029
133 Ga0207706_10012366 3300025933 Bacteria 7775
134 Ga0207706_10091453 3300025933 Bacteria 2675
135 Ga0207686_10170191 3300025934 Unclassified 1535
136 Ga0207704_10070524 3300025938 Bacteria 2213
137 Ga0207711_10048557 3300025941 Bacteria 3630
138 Ga0207661_10012031 3300025944 Bacteria 6286
139 Ga0207661_10024506 3300025944 Bacteria 4574
140 Ga0207661_10207781 3300025944 Bacteria 1724
141 Ga0207651_10133496 3300025960 Bacteria 1905
142 Ga0207651_10264810 3300025960 Bacteria 1413
143 Ga0207651_10455952 3300025960 Bacteria 1098
144 Ga0207668_10352557 3300025972 Unclassified 1231
145 Ga0207678_10339721 3300026067 Bacteria 1294
146 Ga0207708_10034827 3300026075 Bacteria 3830
147 Ga0207708_10207721 3300026075 Bacteria 1564
148 Ga0207702_10171268 3300026078 Bacteria 1991
149 Ga0207648_10011306 3300026089 Bacteria 8414
150 Ga0207675_100390804 3300026118 Unclassified 1369
151 Ga0207683_10001939 3300026121 Bacteria 18313
152 Ga0207683_10025614 3300026121 Bacteria 5089
153 Ga0207698_10265888 3300026142 Unclassified 1578
154 Ga0307408_100213657 3300031548 Bacteria 1569
155 Ga0307406_10156035 3300031901 Bacteria 1635
156 Ga0307409_100018198 3300031995 Bacteria 4713
157 Ga0307414_10711548 3300032004 Bacteria 910
158 Ga0307415_100075344 3300032126 Bacteria 2388
159 Ga0307415_100251080 3300032126 Bacteria 1437
160 Ga0373944_0020499 3300035089 Bacteria 1905
161 Ga0373949_0069921 3300035090 Bacteria 918
162 Ga0373951_0039400 3300035091 Bacteria 1136
163 Ga0373939_0046797 3300035114 Bacteria 1326
164 Ga0373945_0043609 3300035116 Bacteria 1628
165 Ga0373945_0047597 3300035116 Bacteria 1569
166 Ga0373960_0177591 3300035121 Unclassified 742
167 Ga0373943_0000875 3300035170 Bacteria 13247
168 Ga0373946_0093480 3300035171 Bacteria 1336
169 Ga0373961_0009170 3300035241 Bacteria 2417
170 Ga0373947_0000664 3300035725 Bacteria 20398
171 Ga0373947_0013729 3300035725 Bacteria 4641
172 Ga0373947_0448939 3300035725 Unclassified 873
173 Ga0373925_0009754 3300037068 Bacteria 6974
174 Ga0373925_0214297 3300037068 Bacteria 1535
175 Ga0395899_0002472 3300037312 Bacteria 15001
176 Ga0395899_0008449 3300037312 Bacteria 7931
177 Ga0395899_0125747 3300037312 Bacteria 1834
178 Ga0395899_0387507 3300037312 Bacteria 927
179 Ga0395900_0001207 3300037418 Bacteria 31970
180 Ga0395900_0008323 3300037418 Bacteria 10679
181 Ga0395900_0083689 3300037418 Bacteria 3278
182 Ga0395898_0001088 3300037466 Bacteria 41937
183 Ga0395898_0002790 3300037466 Bacteria 20063
184 Ga0395898_0009980 3300037466 Bacteria 9946
185 Ga0395898_0084728 3300037466 Bacteria 3055
186 Ga0395898_0235714 3300037466 Bacteria 1745
187 Ga0395898_0325643 3300037466 Bacteria 1465
188 Ga0395898_0382733 3300037466 Bacteria 1342
189 Ga0395898_0600470 3300037466 Bacteria 1043
190 Ga0395898_0607118 3300037466 Bacteria 1037
191 Ga0395905_0001822 3300037471 Bacteria 24643
192 Ga0395905_0024185 3300037471 Bacteria 5733
193 Ga0395905_0065664 3300037471 Bacteria 3397
194 Ga0395905_0068459 3300037471 Bacteria 3325
195 Ga0395905_0293393 3300037471 Bacteria 1513
196 Ga0395901_0002285 3300038443 Bacteria 19538
197 Ga0395901_0003479 3300038443 Bacteria 15862
198 Ga0395901_0014839 3300038443 Bacteria 7915
199 Ga0395901_0045602 3300038443 Bacteria 4550
200 Ga0395901_0089800 3300038443 Bacteria 3215
201 Ga0395901_0493385 3300038443 Bacteria 1247
202 Ga0451853_0527392 3300041512 Bacteria 3578
203 Ga0451853_1314847 3300041512 Bacteria 1213
204 Ga0466963_0001433 3300044694 Bacteria 12841
205 Ga0466963_0008941 3300044694 Bacteria 6012
206 Ga0466964_0022324 3300044706 Bacteria 2454
207 Ga0466968_0062236 3300044735 Bacteria 1611
208 Ga0466968_0141190 3300044735 Bacteria 1102
209 Ga0466968_0195185 3300044735 Bacteria 946
210 Ga0466957_0010909 3300044842 Bacteria 5226
211 Ga0466957_0223323 3300044842 Bacteria 1244
212 Ga0466960_0015633 3300044901 Bacteria 3276
213 Ga0466959_0052001 3300045049 Bacteria 3002
214 Ga0451576_0055117 3300045051 Bacteria 4160
215 Ga0466958_0110936 3300045836 Bacteria 1712
216 Ga0466967_0002114 3300045976 Bacteria 12193
217 Ga0466967_0002966 3300045976 Bacteria 10848
218 Ga0466967_0023755 3300045976 Bacteria 5029
219 Ga0466967_0024552 3300045976 Bacteria 4958
220 Ga0466967_0044167 3300045976 Bacteria 3863
221 Ga0466967_0154719 3300045976 Bacteria 2146
222 Ga0466967_0908921 3300045976 Bacteria 875
223 Ga0495603_0000219 3300046455 Bacteria 29709
224 Ga0495603_0160239 3300046455 Bacteria 1305
225 Ga0495629_0238329 3300046459 Bacteria 1253
226 Ga0495641_0000516 3300046461 Bacteria 32427
227 Ga0495641_0110203 3300046461 Bacteria 1228
228 Ga0495651_0458655 3300046462 Bacteria 822
229 Ga0495580_0022280 3300046472 Bacteria 4664
230 Ga0495582_0014298 3300046473 Bacteria 4365
231 Ga0495639_0026453 3300046475 Bacteria 2565
232 Ga0495584_0060327 3300046491 Bacteria 1907
233 Ga0495584_0263765 3300046491 Unclassified 876
234 Ga0495594_0003221 3300046499 Bacteria 8459
235 Ga0495596_0261893 3300046500 Bacteria 671
236 Ga0495630_0010104 3300046517 Bacteria 6802
237 Ga0495630_0474360 3300046517 Bacteria 959
238 Ga0495666_0019282 3300046526 Bacteria 3387
239 Ga0495665_0111873 3300046531 Bacteria 1432
240 Ga0495586_0168196 3300046535 Bacteria 1238
241 Ga0495609_0121256 3300046538 Bacteria 1124
242 Ga0495645_0422472 3300046543 Bacteria 846
243 Ga0495633_0144409 3300046558 Unclassified 1100
244 Ga0495656_0015991 3300046615 Bacteria 2842
245 Ga0495634_0044253 3300046642 Bacteria 3014
246 Ga0495659_0052723 3300046664 Unclassified 1485
247 Ga0495588_0000660 3300046674 Bacteria 15991
248 Ga0495647_0048548 3300046681 Bacteria 1642
249 Ga0495647_0088965 3300046681 Bacteria 1263
250 Ga0495658_0036515 3300046683 Bacteria 2711
251 Ga0495658_0124068 3300046683 Bacteria 1565
252 Ga0495669_0146413 3300046684 Bacteria 1117
253 Ga0495613_0036924 3300046689 Bacteria 3622
254 Ga0495671_0121926 3300046692 Unclassified 1272
255 Ga0495589_0204410 3300046794 Bacteria 931
256 Ga0495676_0000977 3300047321 Bacteria 23953
257 Ga0495676_0060202 3300047321 Bacteria 2978
258 Ga0495676_0074297 3300047321 Bacteria 2604
259 Ga0495676_0080460 3300047321 Bacteria 2474
260 Ga0495677_0054665 3300047445 Bacteria 1473
261 Ga0496100_0148990 3300048903 Bacteria 1666
262 Ga0496100_0195754 3300048903 Bacteria 1470
263 Ga0496101_0034797 3300048904 Bacteria 3561
264 Ga0496101_0415935 3300048904 Bacteria 1059
265 Ga0496102_0033595 3300048905 Bacteria 4610
266 Ga0496102_0038591 3300048905 Bacteria 4311
267 Ga0496102_0158344 3300048905 Bacteria 2129
268 Ga0496102_0232062 3300048905 Bacteria 1740
269 Ga0496103_0046852 3300048906 Bacteria 2669
270 Ga0496104_0002376 3300048907 Bacteria 16220
271 Ga0496104_0007994 3300048907 Bacteria 9378
272 Ga0496104_0043769 3300048907 Bacteria 4205
273 Ga0496105_0000921 3300048908 Bacteria 20079
274 Ga0496105_0066965 3300048908 Bacteria 2965
275 Ga0496105_0132897 3300048908 Bacteria 2050
276 Ga0496106_0057681 3300048909 Bacteria 2937
277 Ga0496106_0124716 3300048909 Bacteria 2015
278 Ga0496108_0000993 3300048911 Bacteria 22105
279 Ga0496108_0002438 3300048911 Bacteria 14862
280 Ga0496109_0016594 3300048912 Bacteria 6439
281 Ga0496109_0019751 3300048912 Bacteria 5944
282 Ga0496109_0083054 3300048912 Bacteria 2954
283 Ga0496109_0165208 3300048912 Bacteria 2075
284 Ga0496110_0004767 3300048913 Bacteria 10565
285 Ga0496110_0004851 3300048913 Bacteria 10487
286 Ga0496110_0012638 3300048913 Bacteria 6946
287 Ga0496110_0047670 3300048913 Bacteria 3753
288 Ga0496110_0138790 3300048913 Bacteria 2198
289 Ga0496111_0003363 3300048914 Bacteria 9885
290 Ga0496111_0009594 3300048914 Bacteria 6466
291 Ga0496111_0016018 3300048914 Bacteria 5160
292 Ga0496112_0008471 3300048915 Bacteria 9215
293 Ga0496112_0221524 3300048915 Bacteria 1848
294 Ga0496112_0291617 3300048915 Bacteria 1577
295 Ga0496112_0444092 3300048915 Bacteria 1235
296 Ga0496113_0009464 3300048916 Bacteria 6391
297 Ga0496113_0057347 3300048916 Bacteria 2927
298 Ga0496113_0277388 3300048916 Bacteria 1340
299 Ga0496113_0469242 3300048916 Bacteria 1011
300 Ga0496113_0715362 3300048916 Bacteria 798
301 Ga0496114_0058795 3300048917 Bacteria 3210
302 Ga0496114_0215409 3300048917 Unclassified 1685
303 Ga0496115_0023307 3300048918 Bacteria 4803
304 Ga0496115_0029633 3300048918 Bacteria 4299
305 Ga0501034_0007715 3300049571 Bacteria 11447
306 Ga0501036_0143806 3300049572 Bacteria 2012
307 Ga0501043_0579668 3300049579 Bacteria 831
308 Ga0501047_0306943 3300049581 Bacteria 1428
309 Ga0501048_0652799 3300049582 Bacteria 755
310 Ga0501067_0014155 3300049583 Bacteria 4418
311 Ga0501067_0024456 3300049583 Bacteria 3350
312 Ga0501070_0022780 3300049586 Bacteria 5243
313 Ga0501070_0208940 3300049586 Bacteria 1603
314 Ga0501072_0010373 3300049588 Bacteria 7098
315 Ga0501073_0020119 3300049589 Bacteria 4813
316 Ga0501073_0022513 3300049589 Bacteria 4537
317 Ga0501074_0010448 3300049590 Bacteria 6737
318 Ga0501074_0057924 3300049590 Bacteria 2791
319 Ga0501075_0280349 3300049591 Bacteria 1270
320 Ga0501076_0175043 3300049592 Bacteria 1749
321 Ga0501080_0002078 3300049742 Bacteria 17369
322 Ga0501080_0119992 3300049742 Bacteria 2437
323 Ga0501081_0091728 3300049743 Bacteria 2137
324 Ga0501083_0007689 3300049744 Bacteria 7644
325 nmdc:mga05p37_214749_c1 3300050507 Bacteria 2324
326 nmdc:mga06r32_98868_c1 3300050510 Unclassified 2861
327 nmdc:mga08y16_63335_c1 3300050511 Bacteria 3862
328 nmdc:mga0n895_170743_c1 3300050512 Bacteria 2207
329 nmdc:mga0n895_240181_c1 3300050512 Bacteria 1838
330 nmdc:mga0rr50_9664_c1 3300050513 Bacteria 6080
331 nmdc:mga08x19_15495_c1 3300050514 Bacteria 4639
332 nmdc:mga0a205_21978_c1 3300050515 Bacteria 6036
333 nmdc:mga0a205_686036_c1 3300050515 Unclassified 874
334 Ga0495619_0400552 3300053085 Bacteria 948
335 Ga0501084_0042126 3300054114 Bacteria 3819
336 Ga0466962_0130320 3300061719 Bacteria 1215
337 Ga0395900_0816728
338 Ga0070683_100002072
339 Ga0070683_100103658
340 Ga0070683_100203059
341 Ga0070680_100014225
342 Ga0070680_100029577
343 Ga0070680_100094767
344 Ga0070682_100035364
345 Ga0068868_100050348
346 Ga0068868_100119735
347 Ga0070660_100298889
348 Ga0070691_10070929
349 Ga0070687_100229931
350 Ga0070673_100145241
351 Ga0070709_10154884
352 Ga0070714_100008154
353 Ga0070714_100039630
354 Ga0070714_100168727
355 Ga0070714_100254429
356 Ga0070713_100033639
357 Ga0070713_100091340
358 Ga0070713_100225369
359 Ga0070710_10091916
360 Ga0070701_10110761
361 Ga0070711_100039992
362 Ga0070711_100416572
363 Ga0070705_100062565
364 Ga0070700_100029373
365 Ga0070694_100059939
366 Ga0070708_100087852
367 Ga0070708_100118294
368 Ga0070663_100318629
369 Ga0070678_100194227
370 Ga0070662_100021251
371 Ga0070681_10017860
372 Ga0070681_10387226
373 Ga0070681_10391336
374 Ga0068867_100078229
375 Ga0070685_10074580
376 Ga0070706_100009928
377 Ga0070706_100103919
378 Ga0070707_100001488
379 Ga0070707_100176098
380 Ga0070699_100103511
381 Ga0070679_100154514
382 Ga0070679_100237291
383 Ga0070679_100667096
384 Ga0070684_100139841
385 Ga0070684_100203198
386 Ga0070686_100278026
387 Ga0070686_100320994
388 Ga0070695_100277724
389 Ga0070696_100032197
390 Ga0070693_100016090
391 Ga0070693_100061804
392 Ga0070693_100192825
393 Ga0068855_101171954
394 Ga0068854_100012319
395 Ga0068856_100448054
396 Ga0070702_100040086
397 Ga0068864_100033506
398 Ga0068866_10114178
399 Ga0068861_100248409
400 Ga0068861_100661570
401 Ga0068862_100511167
402 Ga0081455_10006302
403 Ga0081540_1004699
404 Ga0081540_1013531
405 Ga0070717_10304653
406 Ga0075432_10112414
407 Ga0097621_100009879
408 Ga0075431_100053795
409 Ga0075433_10004020
410 Ga0075434_100015066
411 Ga0068865_100047610
412 Ga0075436_100013133
413 Ga0075435_100005062
414 Ga0075435_100558277
415 Ga0111539_10322763
416 Ga0105245_10055260
417 Ga0105245_10092668
418 Ga0105245_10233333
419 Ga0114129_10126459
420 Ga0114129_11175108
421 Ga0105243_10919037
422 Ga0105241_10121487
423 Ga0105241_10213361
424 Ga0105242_10018349
425 Ga0105248_10161282
426 Ga0105237_10145676
427 Ga0105238_10207381
428 Ga0105249_10162091
429 Ga0105239_10058220
430 Ga0105239_10505424
431 Ga0105246_10035548
432 Ga0105246_10250033
433 Ga0157341_1001206
434 Ga0157373_10337770
435 Ga0157370_10303426
436 Ga0157378_10323225
437 Ga0157372_10159906
438 Ga0157372_10169774
439 Ga0157372_10183841
440 Ga0157375_11187193
441 Ga0157375_11562214
442 Ga0157380_10075671
443 Ga0182008_10057963
444 Ga0157376_10061393
445 Ga0157376_10683110
446 Ga0207692_10119512
447 Ga0207642_10170435
448 Ga0207688_10271038
449 Ga0207699_10044818
450 Ga0207684_10126682
451 Ga0207707_10013404
452 Ga0207707_10016223
453 Ga0207695_10446878
454 Ga0207671_10068310
455 Ga0207693_10228956
456 Ga0207663_10004930
457 Ga0207652_10136004
458 Ga0207652_10200195
459 Ga0207652_10730124
460 Ga0207646_10162919
461 Ga0207681_10052909
462 Ga0207687_10132294
463 Ga0207700_10186653
464 Ga0207700_10403631
465 Ga0207700_10592649
466 Ga0207664_10007454
467 Ga0207664_10174673
468 Ga0207664_10556928
469 Ga0207706_10012366
470 Ga0207706_10091453
471 Ga0207686_10170191
472 Ga0207704_10070524
473 Ga0207711_10048557
474 Ga0207661_10012031
475 Ga0207661_10024506
476 Ga0207661_10207781
477 Ga0207651_10133496
478 Ga0207651_10264810
479 Ga0207651_10455952
480 Ga0207668_10352557
481 Ga0207678_10339721
482 Ga0207708_10034827
483 Ga0207708_10207721
484 Ga0207702_10171268
485 Ga0207648_10011306
486 Ga0207675_100390804
487 Ga0207683_10001939
488 Ga0207683_10025614
489 Ga0207698_10265888
490 Ga0307408_100213657
491 Ga0307406_10156035
492 Ga0307409_100018198
493 Ga0307414_10711548
494 Ga0307415_100075344
495 Ga0307415_100251080
496 Ga0373944_0020499
497 Ga0373949_0069921
498 Ga0373951_0039400
499 Ga0373939_0046797
500 Ga0373945_0043609
501 Ga0373945_0047597
502 Ga0373960_0177591
503 Ga0373943_0000875
504 Ga0373946_0093480
505 Ga0373961_0009170
506 Ga0373947_0000664
507 Ga0373947_0013729
508 Ga0373947_0448939
509 Ga0373925_0009754
510 Ga0373925_0214297
511 Ga0395899_0002472
512 Ga0395899_0008449
513 Ga0395899_0125747
514 Ga0395899_0387507
515 Ga0395900_0001207
516 Ga0395900_0008323
517 Ga0395900_0083689
518 Ga0395898_0001088
519 Ga0395898_0002790
520 Ga0395898_0009980
521 Ga0395898_0084728
522 Ga0395898_0235714
523 Ga0395898_0325643
524 Ga0395898_0382733
525 Ga0395898_0600470
526 Ga0395898_0607118
527 Ga0395905_0001822
528 Ga0395905_0024185
529 Ga0395905_0065664
530 Ga0395905_0068459
531 Ga0395905_0293393
532 Ga0395901_0002285
533 Ga0395901_0003479
534 Ga0395901_0014839
535 Ga0395901_0045602
536 Ga0395901_0089800
537 Ga0395901_0493385
538 Ga0451853_0527392
539 Ga0451853_1314847
540 Ga0466963_0001433
541 Ga0466963_0008941
542 Ga0466964_0022324
543 Ga0466968_0062236
544 Ga0466968_0141190
545 Ga0466968_0195185
546 Ga0466957_0010909
547 Ga0466957_0223323
548 Ga0466960_0015633
549 Ga0466959_0052001
550 Ga0451576_0055117
551 Ga0466958_0110936
552 Ga0466967_0002114
553 Ga0466967_0002966
554 Ga0466967_0023755
555 Ga0466967_0024552
556 Ga0466967_0044167
557 Ga0466967_0154719
558 Ga0466967_0908921
559 Ga0495603_0000219
560 Ga0495603_0160239
561 Ga0495629_0238329
562 Ga0495641_0000516
563 Ga0495641_0110203
564 Ga0495651_0458655
565 Ga0495580_0022280
566 Ga0495582_0014298
567 Ga0495639_0026453
568 Ga0495584_0060327
569 Ga0495584_0263765
570 Ga0495594_0003221
571 Ga0495596_0261893
572 Ga0495630_0010104
573 Ga0495630_0474360
574 Ga0495666_0019282
575 Ga0495665_0111873
576 Ga0495586_0168196
577 Ga0495609_0121256
578 Ga0495645_0422472
579 Ga0495633_0144409
580 Ga0495656_0015991
581 Ga0495634_0044253
582 Ga0495659_0052723
583 Ga0495588_0000660
584 Ga0495647_0048548
585 Ga0495647_0088965
586 Ga0495658_0036515
587 Ga0495658_0124068
588 Ga0495669_0146413
589 Ga0495613_0036924
590 Ga0495671_0121926
591 Ga0495589_0204410
592 Ga0495676_0000977
593 Ga0495676_0060202
594 Ga0495676_0074297
595 Ga0495676_0080460
596 Ga0495677_0054665
597 Ga0496100_0148990
598 Ga0496100_0195754
599 Ga0496101_0034797
600 Ga0496101_0415935
601 Ga0496102_0033595
602 Ga0496102_0038591
603 Ga0496102_0158344
604 Ga0496102_0232062
605 Ga0496103_0046852
606 Ga0496104_0002376
607 Ga0496104_0007994
608 Ga0496104_0043769
609 Ga0496105_0000921
610 Ga0496105_0066965
611 Ga0496105_0132897
612 Ga0496106_0057681
613 Ga0496106_0124716
614 Ga0496108_0000993
615 Ga0496108_0002438
616 Ga0496109_0016594
617 Ga0496109_0019751
618 Ga0496109_0083054
619 Ga0496109_0165208
620 Ga0496110_0004767
621 Ga0496110_0004851
622 Ga0496110_0012638
623 Ga0496110_0047670
624 Ga0496110_0138790
625 Ga0496111_0003363
626 Ga0496111_0009594
627 Ga0496111_0016018
628 Ga0496112_0008471
629 Ga0496112_0221524
630 Ga0496112_0291617
631 Ga0496112_0444092
632 Ga0496113_0009464
633 Ga0496113_0057347
634 Ga0496113_0277388
635 Ga0496113_0469242
636 Ga0496113_0715362
637 Ga0496114_0058795
638 Ga0496114_0215409
639 Ga0496115_0023307
640 Ga0496115_0029633
641 Ga0501034_0007715
642 Ga0501036_0143806
643 Ga0501043_0579668
644 Ga0501047_0306943
645 Ga0501048_0652799
646 Ga0501067_0014155
647 Ga0501067_0024456
648 Ga0501070_0022780
649 Ga0501070_0208940
650 Ga0501072_0010373
651 Ga0501073_0020119
652 Ga0501073_0022513
653 Ga0501074_0010448
654 Ga0501074_0057924
655 Ga0501075_0280349
656 Ga0501076_0175043
657 Ga0501080_0002078
658 Ga0501080_0119992
659 Ga0501081_0091728
660 Ga0501083_0007689
661 nmdc:mga05p37_214749_c1
662 nmdc:mga06r32_98868_c1
663 nmdc:mga08y16_63335_c1
664 nmdc:mga0n895_170743_c1
665 nmdc:mga0n895_240181_c1
666 nmdc:mga0rr50_9664_c1
667 nmdc:mga08x19_15495_c1
668 nmdc:mga0a205_21978_c1
669 nmdc:mga0a205_686036_c1
670 Ga0495619_0400552
671 Ga0501084_0042126
672 Ga0466962_0130320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

54

213

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.875 2 206
8hp6-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase d12a mutant 0.8742 2 209
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.8734 1 206
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.8731 1 206
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.873 2 208
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9119 84 203 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8804 84 205 3.40.50.1000
af_A4I3L5_9_277_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8774 88 136 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8767 85 182 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8667 88 179 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7V9DGQ6-F1-model_v4 GNAT family N-acetyltransferase 0.9775 1 211 GO:0016747
AF-A0A7V9DGQ6-F1-model_v4 GNAT family N-acetyltransferase 0.973 1 211 GO:0016747
AF-A0A7W1N5E1-F1-model_v4 HAD-IA family hydrolase 0.9702 1 211 GO:0016787
AF-A0A7X0CB03-F1-model_v4 FMN phosphatase YigB (HAD superfamily) 0.9662 92 207
AF-A0A7W1N5E1-F1-model_v4 HAD-IA family hydrolase 0.9657 1 211 GO:0016787

Map