F412707

General Info

Members Datasets Scaffolds Average Seq Length
336 190 672 214

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10434537|Ga0207664_104345372
Length 259
Sequence VTKKIAARSALPRLERSEGSAFHIPYQSRIPYNNSPIPSLPPSALRFHMAKRTAAQPALDLFPQNATIEQLREEAARCKACDLWKNATQTVFGEGASAKPKVIFVGEQPGDQEDIEGKPFVGPAGKLLDSALIEAGIDRKKVYVTNAVKHFKWEPRGKRRIHKKPNAIEIAACRPWLDAEIAAIRPNVIVCLGATAAQSLLGRDFRVTLHRGEFLKSNLAPHVMATVHPSSILRAPDEATRHEEMKRFIADLKKVAHHV

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10434537 3300025929 Bacteria 1170
2 Ga0065704_10350193 3300005289 Bacteria 811
3 Ga0070683_100000004 3300005329 Bacteria 373231
4 Ga0070690_100023261 3300005330 Bacteria 3799
5 Ga0070690_100310711 3300005330 Bacteria 1133
6 Ga0068869_100067813 3300005334 Bacteria 2633
7 Ga0070666_10216216 3300005335 Bacteria 1351
8 Ga0070666_10263941 3300005335 Bacteria 1221
9 Ga0070680_100084201 3300005336 Bacteria 2626
10 Ga0070682_100125682 3300005337 Bacteria 1728
11 Ga0068868_100019431 3300005338 Bacteria 5091
12 Ga0068868_100100071 3300005338 Bacteria 2345
13 Ga0068868_100128619 3300005338 Bacteria 2071
14 Ga0070660_100000857 3300005339 Bacteria 20276
15 Ga0070689_100090263 3300005340 Unclassified 2414
16 Ga0070689_100103411 3300005340 Bacteria 2257
17 Ga0070687_100080875 3300005343 Bacteria 1773
18 Ga0070692_10067629 3300005345 Bacteria 1897
19 Ga0070668_100050630 3300005347 Bacteria 3198
20 Ga0070668_100172014 3300005347 Bacteria 1764
21 Ga0070669_100091868 3300005353 Bacteria 2277
22 Ga0070669_100141365 3300005353 Bacteria 1856
23 Ga0070669_100151452 3300005353 Bacteria 1796
24 Ga0070675_100160077 3300005354 Bacteria 1935
25 Ga0070675_100853183 3300005354 Bacteria 833
26 Ga0070671_100033218 3300005355 Bacteria 4265
27 Ga0070671_100058568 3300005355 Bacteria 3206
28 Ga0070674_100014793 3300005356 Bacteria 4855
29 Ga0070673_100068339 3300005364 Bacteria 2845
30 Ga0070688_100005994 3300005365 Bacteria 6444
31 Ga0070667_100011753 3300005367 Bacteria 7234
32 Ga0070709_10031393 3300005434 Bacteria 3194
33 Ga0070714_100048261 3300005435 Bacteria 3621
34 Ga0070713_100162003 3300005436 Bacteria 1997
35 Ga0070710_10127877 3300005437 Bacteria 1546
36 Ga0070710_10188679 3300005437 Bacteria 1295
37 Ga0070710_10192728 3300005437 Bacteria 1283
38 Ga0070701_10007564 3300005438 Bacteria 4650
39 Ga0070701_10060355 3300005438 Bacteria 1996
40 Ga0070711_100000096 3300005439 Bacteria 46808
41 Ga0070705_100043239 3300005440 Bacteria 2581
42 Ga0070705_100191291 3300005440 Bacteria 1395
43 Ga0070700_100008928 3300005441 Bacteria 5482
44 Ga0070694_100041070 3300005444 Bacteria 3084
45 Ga0070694_100206441 3300005444 Bacteria 1467
46 Ga0070694_100547307 3300005444 Bacteria 926
47 Ga0070662_100152475 3300005457 Bacteria 1800
48 Ga0068867_100042130 3300005459 Bacteria 3338
49 Ga0068867_100127660 3300005459 Bacteria 1972
50 Ga0070706_100918539 3300005467 Bacteria 808
51 Ga0070698_100000696 3300005471 Bacteria 35919
52 Ga0070699_100000098 3300005518 Bacteria 81947
53 Ga0070699_100013754 3300005518 Bacteria 6962
54 Ga0070699_100103146 3300005518 Bacteria 2501
55 Ga0070697_100044295 3300005536 Bacteria 3603
56 Ga0070672_100008787 3300005543 Bacteria 6935
57 Ga0070672_100422562 3300005543 Bacteria 1145
58 Ga0070686_100097287 3300005544 Bacteria 1981
59 Ga0070695_100124034 3300005545 Bacteria 1771
60 Ga0070695_100221986 3300005545 Bacteria 1362
61 Ga0070695_100500383 3300005545 Bacteria 940
62 Ga0070695_100653106 3300005545 Bacteria 831
63 Ga0070696_100002223 3300005546 Bacteria 12795
64 Ga0070696_100028616 3300005546 Bacteria 3803
65 Ga0070696_100058739 3300005546 Bacteria 2687
66 Ga0070693_100000884 3300005547 Bacteria 13323
67 Ga0070704_100002677 3300005549 Bacteria 10067
68 Ga0070704_100172804 3300005549 Bacteria 1720
69 Ga0070704_100434446 3300005549 Bacteria 1127
70 Ga0068855_100200919 3300005563 Bacteria 2244
71 Ga0070664_100176156 3300005564 Bacteria 1899
72 Ga0070664_100305552 3300005564 Viruses 1438
73 Ga0070702_100005485 3300005615 Bacteria 5916
74 Ga0070702_100018184 3300005615 Bacteria 3641
75 Ga0068852_100262300 3300005616 Bacteria 1659
76 Ga0068859_100023947 3300005617 Bacteria 6127
77 Ga0068859_100030924 3300005617 Bacteria 5372
78 Ga0068859_100173486 3300005617 Bacteria 2238
79 Ga0068859_100645665 3300005617 Bacteria 1150
80 Ga0068864_100007853 3300005618 Bacteria 8791
81 Ga0068864_100022962 3300005618 Bacteria 5234
82 Ga0068866_10312081 3300005718 Bacteria 986
83 Ga0068861_100035972 3300005719 Bacteria 3671
84 Ga0068863_100118757 3300005841 Unclassified 2521
85 Ga0068858_100029895 3300005842 Bacteria 5061
86 Ga0068858_100071341 3300005842 Bacteria 3222
87 Ga0068858_100252144 3300005842 Bacteria 1676
88 Ga0068860_100075901 3300005843 Bacteria 3196
89 Ga0068860_100635118 3300005843 Bacteria 1075
90 Ga0068862_100000995 3300005844 Bacteria 27113
91 Ga0068862_100017817 3300005844 Bacteria 5912
92 Ga0081455_10040451 3300005937 Bacteria 4110
93 Ga0070717_10036805 3300006028 Bacteria 3972
94 Ga0075365_10159921 3300006038 Bacteria 1569
95 Ga0075368_10027885 3300006042 Bacteria 2180
96 Ga0075368_10104896 3300006042 Bacteria 1163
97 Ga0070716_100016869 3300006173 Bacteria 3777
98 Ga0070712_100112584 3300006175 Bacteria 2033
99 Ga0075362_10022594 3300006177 Bacteria 2652
100 Ga0075367_10007653 3300006178 Bacteria 5549
101 Ga0075366_10004789 3300006195 Bacteria 7298
102 Ga0097621_100053752 3300006237 Bacteria 3283
103 Ga0097621_100420468 3300006237 Bacteria 1199
104 Ga0068871_100100267 3300006358 Bacteria 2425
105 Ga0068871_100282111 3300006358 Bacteria 1453
106 Ga0075428_100041227 3300006844 Bacteria 5078
107 Ga0075428_100073238 3300006844 Bacteria 3741
108 Ga0075428_100084195 3300006844 Bacteria 3470
109 Ga0075431_100003499 3300006847 Bacteria 15227
110 Ga0075431_100604945 3300006847 Bacteria 1080
111 Ga0075433_10110698 3300006852 Bacteria 2437
112 Ga0075434_100013520 3300006871 Bacteria 7774
113 Ga0075429_100002862 3300006880 Bacteria 14604
114 Ga0075429_100049334 3300006880 Bacteria 3660
115 Ga0068865_100572160 3300006881 Bacteria 951
116 Ga0075436_100043327 3300006914 Bacteria 3103
117 Ga0097620_100023949 3300006931 Bacteria 6127
118 Ga0097620_100030925 3300006931 Bacteria 5372
119 Ga0097620_100173476 3300006931 Bacteria 2238
120 Ga0097620_100645685 3300006931 Bacteria 1150
121 Ga0075435_100008293 3300007076 Bacteria 7447
122 Ga0075435_100069184 3300007076 Bacteria 2877
123 Ga0075435_100369530 3300007076 Bacteria 1231
124 Ga0111539_10000360 3300009094 Bacteria 56004
125 Ga0111539_10009889 3300009094 Bacteria 12036
126 Ga0111539_10058400 3300009094 Bacteria 4577
127 Ga0111539_10174709 3300009094 Bacteria 2509
128 Ga0105245_10163394 3300009098 Bacteria 2114
129 Ga0105245_10269787 3300009098 Bacteria 1659
130 Ga0105247_10001119 3300009101 Bacteria 19989
131 Ga0114129_10000075 3300009147 Bacteria 91461
132 Ga0114129_10052086 3300009147 Bacteria 5745
133 Ga0114129_10692007 3300009147 Bacteria 1311
134 Ga0105243_10000664 3300009148 Bacteria 33853
135 Ga0105243_10014642 3300009148 Bacteria 5934
136 Ga0105242_10000237 3300009176 Bacteria 43474
137 Ga0105242_10068942 3300009176 Bacteria 2928
138 Ga0105242_10148888 3300009176 Bacteria 2039
139 Ga0105242_10249153 3300009176 Bacteria 1600
140 Ga0105248_10002081 3300009177 Bacteria 22128
141 Ga0105248_10021454 3300009177 Bacteria 7154
142 Ga0105248_10360998 3300009177 Bacteria 1635
143 Ga0105248_10490720 3300009177 Bacteria 1384
144 Ga0105249_10278391 3300009553 Bacteria 1670
145 Ga0157371_10533395 3300013102 Unclassified 869
146 Ga0157369_10004985 3300013105 Bacteria 15541
147 Ga0157374_10070028 3300013296 Unclassified 3304
148 Ga0157378_10000028 3300013297 Bacteria 128346
149 Ga0157378_10033357 3300013297 Bacteria 4550
150 Ga0157378_10337138 3300013297 Bacteria 1469
151 Ga0157378_10487135 3300013297 Unclassified 1230
152 Ga0157378_11154484 3300013297 Bacteria 813
153 Ga0163162_10322939 3300013306 Bacteria 1676
154 Ga0163162_10457652 3300013306 Bacteria 1408
155 Ga0157372_11096374 3300013307 Bacteria 921
156 Ga0157372_11123226 3300013307 Bacteria 909
157 Ga0157375_10015289 3300013308 Bacteria 6869
158 Ga0157375_10032507 3300013308 Bacteria 4950
159 Ga0157375_10209819 3300013308 Bacteria 2105
160 Ga0157375_10935448 3300013308 Bacteria 1009
161 Ga0157375_10994764 3300013308 Bacteria 979
162 Ga0163163_10001048 3300014325 Bacteria 23404
163 Ga0163163_10294116 3300014325 Bacteria 1676
164 Ga0157380_10018368 3300014326 Bacteria 5189
165 Ga0157380_10244704 3300014326 Bacteria 1619
166 Ga0157380_10585547 3300014326 Bacteria 1101
167 Ga0157379_10054067 3300014968 Bacteria 3587
168 Ga0157376_10221240 3300014969 Bacteria 1753
169 Ga0157376_10357705 3300014969 Bacteria 1399
170 Ga0163161_10038193 3300017792 Bacteria 3444
171 Ga0163161_10084238 3300017792 Unclassified 2344
172 Ga0207682_10064307 3300025893 Bacteria 1541
173 Ga0207692_10142689 3300025898 Bacteria 1364
174 Ga0207692_10173949 3300025898 Bacteria 1250
175 Ga0207710_10003291 3300025900 Bacteria 7223
176 Ga0207710_10103420 3300025900 Viruses 1346
177 Ga0207680_10011157 3300025903 Bacteria 4528
178 Ga0207680_10065344 3300025903 Bacteria 2233
179 Ga0207680_10162083 3300025903 Bacteria 1500
180 Ga0207645_10005644 3300025907 Bacteria 9041
181 Ga0207645_10058530 3300025907 Bacteria 2460
182 Ga0207643_10004903 3300025908 Bacteria 7162
183 Ga0207693_10054738 3300025915 Bacteria 3129
184 Ga0207693_10059047 3300025915 Bacteria 3005
185 Ga0207662_10040493 3300025918 Bacteria 2739
186 Ga0207662_10057042 3300025918 Bacteria 2333
187 Ga0207662_10106376 3300025918 Bacteria 1745
188 Ga0207657_10272321 3300025919 Bacteria 1346
189 Ga0207681_10083319 3300025923 Bacteria 2263
190 Ga0207681_10140806 3300025923 Bacteria 1796
191 Ga0207681_10198205 3300025923 Bacteria 1540
192 Ga0207694_10019420 3300025924 Bacteria 5135
193 Ga0207694_10789579 3300025924 Bacteria 802
194 Ga0207650_10000007 3300025925 Bacteria 530810
195 Ga0207650_10640377 3300025925 Bacteria 896
196 Ga0207700_10393565 3300025928 Bacteria 1213
197 Ga0207644_10148197 3300025931 Unclassified 1814
198 Ga0207644_10243559 3300025931 Bacteria 1432
199 Ga0207706_10185512 3300025933 Bacteria 1827
200 Ga0207706_10280290 3300025933 Bacteria 1454
201 Ga0207686_10002432 3300025934 Bacteria 10146
202 Ga0207686_10036593 3300025934 Bacteria 2956
203 Ga0207686_10272753 3300025934 Bacteria 1245
204 Ga0207709_10000900 3300025935 Bacteria 22431
205 Ga0207709_10297032 3300025935 Bacteria 1200
206 Ga0207709_10478388 3300025935 Bacteria 968
207 Ga0207670_10068958 3300025936 Bacteria 2438
208 Ga0207704_10008688 3300025938 Bacteria 4871
209 Ga0207704_10021165 3300025938 Bacteria 3457
210 Ga0207691_10010530 3300025940 Bacteria 8874
211 Ga0207691_10345115 3300025940 Bacteria 1274
212 Ga0207691_10608397 3300025940 Unclassified 925
213 Ga0207711_10010613 3300025941 Bacteria 7660
214 Ga0207711_10021610 3300025941 Bacteria 5376
215 Ga0207711_10022746 3300025941 Bacteria 5244
216 Ga0207711_10268003 3300025941 Bacteria 1571
217 Ga0207689_10050674 3300025942 Bacteria 3422
218 Ga0207679_10159344 3300025945 Bacteria 1846
219 Ga0207667_10070229 3300025949 Bacteria 3646
220 Ga0207667_10141233 3300025949 Bacteria 2479
221 Ga0207651_10030432 3300025960 Bacteria 3437
222 Ga0207712_10048220 3300025961 Bacteria 2962
223 Ga0207668_10043315 3300025972 Unclassified 3054
224 Ga0207668_10197404 3300025972 Bacteria 1600
225 Ga0207640_10083478 3300025981 Bacteria 2191
226 Ga0207677_10038953 3300026023 Bacteria 3121
227 Ga0207677_10123316 3300026023 Bacteria 1953
228 Ga0207703_10021805 3300026035 Bacteria 5015
229 Ga0207703_10053709 3300026035 Bacteria 3275
230 Ga0207708_10001151 3300026075 Bacteria 19899
231 Ga0207708_10007725 3300026075 Bacteria 7964
232 Ga0207708_10177692 3300026075 Bacteria 1689
233 Ga0207702_10177289 3300026078 Bacteria 1959
234 Ga0207641_10136442 3300026088 Bacteria 2208
235 Ga0207641_10644432 3300026088 Bacteria 1040
236 Ga0207648_10003444 3300026089 Bacteria 16593
237 Ga0207648_10072009 3300026089 Bacteria 3012
238 Ga0207648_10119011 3300026089 Bacteria 2321
239 Ga0207676_10074806 3300026095 Bacteria 2730
240 Ga0207676_10278153 3300026095 Bacteria 1518
241 Ga0207674_10175303 3300026116 Unclassified 2097
242 Ga0207675_100011062 3300026118 Bacteria 8452
243 Ga0207675_100119618 3300026118 Bacteria 2491
244 Ga0207675_100309529 3300026118 Bacteria 1540
245 Ga0207683_10258851 3300026121 Bacteria 1589
246 Ga0207683_10710791 3300026121 Bacteria 932
247 Ga0209813_10036238 3300027866 Bacteria 1481
248 Ga0209974_10008882 3300027876 Bacteria 3425
249 Ga0207428_10000220 3300027907 Bacteria 79712
250 Ga0207428_10051039 3300027907 Bacteria 3307
251 Ga0207428_10073696 3300027907 Bacteria 2678
252 Ga0207428_10473231 3300027907 Bacteria 912
253 Ga0268266_10756075 3300028379 Bacteria 938
254 Ga0268265_10000662 3300028380 Bacteria 34143
255 Ga0268265_10027395 3300028380 Bacteria 4067
256 Ga0268265_10052297 3300028380 Bacteria 3088
257 Ga0268264_10047921 3300028381 Bacteria 3553
258 Ga0268264_10205962 3300028381 Bacteria 1803
259 Ga0265338_10231301 3300028800 Bacteria 1375
260 Ga0307408_100190089 3300031548 Bacteria 1653
261 Ga0307410_10689642 3300031852 Unclassified 860
262 Ga0307409_100122023 3300031995 Bacteria 2209
263 Ga0307409_100402918 3300031995 Bacteria 1307
264 Ga0307411_10375491 3300032005 Bacteria 1168
265 Ga0373940_0022056 3300035088 Unclassified 1634
266 Ga0373952_0009200 3300035092 Bacteria 1887
267 Ga0373952_0087688 3300035092 Bacteria 804
268 Ga0373936_0149562 3300035113 Bacteria 1012
269 Ga0373946_0090380 3300035171 Bacteria 1356
270 Ga0373962_0085028 3300035242 Bacteria 966
271 Ga0373931_0350376 3300035691 Bacteria 924
272 Ga0373933_0597978 3300035724 Bacteria 724
273 Ga0373937_0045368 3300036401 Bacteria 4016
274 Ga0373937_0850609 3300036401 Bacteria 861
275 Ga0395900_0426182 3300037418 Bacteria 1287
276 Ga0436365_0202471 3300039437 Bacteria 5843
277 Ga0451576_0062626 3300045051 Bacteria 3877
278 Ga0466967_0026246 3300045976 Bacteria 4821
279 Ga0466967_0265129 3300045976 Bacteria 1644
280 Ga0495608_0246194 3300046511 Bacteria 1115
281 Ga0495642_0300176 3300046528 Unclassified 704
282 Ga0495646_0279101 3300046680 Bacteria 888
283 Ga0495670_0155298 3300046691 Bacteria 1201
284 Ga0495581_0062129 3300047315 Bacteria 2158
285 Ga0496102_0183621 3300048905 Bacteria 1971
286 Ga0496104_0015171 3300048907 Bacteria 6974
287 Ga0496104_0035499 3300048907 Bacteria 4655
288 Ga0496105_0650030 3300048908 Bacteria 814
289 Ga0496106_0029156 3300048909 Bacteria 4111
290 Ga0496108_0010585 3300048911 Bacteria 7486
291 Ga0496111_0807540 3300048914 Viruses 679
292 Ga0496112_0001479 3300048915 Bacteria 18055
293 Ga0496112_0014042 3300048915 Bacteria 7414
294 Ga0496112_0099476 3300048915 Bacteria 2878
295 Ga0501040_0389236 3300049576 Bacteria 1001
296 Ga0501040_0703656 3300049576 Bacteria 731
297 Ga0501042_0429298 3300049578 Bacteria 958
298 Ga0501069_0033474 3300049585 Bacteria 2831
299 Ga0501075_0207664 3300049591 Bacteria 1494
300 Ga0501081_0037972 3300049743 Bacteria 3288
301 Ga0501035_0185652 3300049822 Bacteria 1790
302 Ga0501045_0061626 3300049824 Bacteria 2752
303 nmdc:mga03683_251525_c1 3300050489 Bacteria 821
304 nmdc:mga06z11_8116_c1 3300050494 Bacteria 4359
305 nmdc:mga04h51_43263_c1 3300050495 Bacteria 1481
306 nmdc:mga05p37_1298709_c1 3300050507 Bacteria 742
307 nmdc:mga05p37_229259_c1 3300050507 Bacteria 2239
308 nmdc:mga05p37_263044_c1 3300050507 Bacteria 2064
309 nmdc:mga05p37_550078_c1 3300050507 Bacteria 1314
310 nmdc:mga05p37_74807_c1 3300050507 Bacteria 4169
311 nmdc:mga09592_1179_c2 3300050508 Bacteria 14626
312 nmdc:mga09592_75339_c1 3300050508 Bacteria 2869
313 nmdc:mga06r32_632589_c1 3300050510 Bacteria 1039
314 nmdc:mga08y16_1032192_c1 3300050511 Bacteria 801
315 nmdc:mga08y16_65721_c1 3300050511 Bacteria 3786
316 nmdc:mga08y16_750_c1 3300050511 Bacteria 30903
317 nmdc:mga08y16_8199_c1 3300050511 Bacteria 10931
318 nmdc:mga0n895_129033_c1 3300050512 Bacteria 2553
319 nmdc:mga0n895_283799_c1 3300050512 Bacteria 1679
320 nmdc:mga0n895_30785_c1 3300050512 Bacteria 2472
321 nmdc:mga0rr50_1001_c2 3300050513 Bacteria 7502
322 nmdc:mga0rr50_596387_c1 3300050513 Bacteria 942
323 nmdc:mga0rr50_710436_c1 3300050513 Unclassified 858
324 nmdc:mga0rr50_810981_c1 3300050513 Bacteria 798
325 nmdc:mga0rr50_90099_c1 3300050513 Bacteria 2386
326 nmdc:mga0rr50_98967_c1 3300050513 Bacteria 2287
327 nmdc:mga08x19_23271_c1 3300050514 Bacteria 3843
328 nmdc:mga08x19_36944_c1 3300050514 Bacteria 3097
329 nmdc:mga0a205_132448_c2 3300050515 Bacteria 1584
330 nmdc:mga0a205_151705_c1 3300050515 Bacteria 2216
331 nmdc:mga0a205_5985_c1 3300050515 Bacteria 10962
332 Ga0587077_011169 3300059493 Bacteria 1407
333 Ga0587109_016519 3300059624 Bacteria 1265
334 Ga0587068_025333 3300059641 Bacteria 998
335 Ga0587075_018123 3300059644 Bacteria 1019
336 Ga0587076_003231 3300059645 Bacteria 1919
337 Ga0207664_10434537
338 Ga0065704_10350193
339 Ga0070683_100000004
340 Ga0070690_100023261
341 Ga0070690_100310711
342 Ga0068869_100067813
343 Ga0070666_10216216
344 Ga0070666_10263941
345 Ga0070680_100084201
346 Ga0070682_100125682
347 Ga0068868_100019431
348 Ga0068868_100100071
349 Ga0068868_100128619
350 Ga0070660_100000857
351 Ga0070689_100090263
352 Ga0070689_100103411
353 Ga0070687_100080875
354 Ga0070692_10067629
355 Ga0070668_100050630
356 Ga0070668_100172014
357 Ga0070669_100091868
358 Ga0070669_100141365
359 Ga0070669_100151452
360 Ga0070675_100160077
361 Ga0070675_100853183
362 Ga0070671_100033218
363 Ga0070671_100058568
364 Ga0070674_100014793
365 Ga0070673_100068339
366 Ga0070688_100005994
367 Ga0070667_100011753
368 Ga0070709_10031393
369 Ga0070714_100048261
370 Ga0070713_100162003
371 Ga0070710_10127877
372 Ga0070710_10188679
373 Ga0070710_10192728
374 Ga0070701_10007564
375 Ga0070701_10060355
376 Ga0070711_100000096
377 Ga0070705_100043239
378 Ga0070705_100191291
379 Ga0070700_100008928
380 Ga0070694_100041070
381 Ga0070694_100206441
382 Ga0070694_100547307
383 Ga0070662_100152475
384 Ga0068867_100042130
385 Ga0068867_100127660
386 Ga0070706_100918539
387 Ga0070698_100000696
388 Ga0070699_100000098
389 Ga0070699_100013754
390 Ga0070699_100103146
391 Ga0070697_100044295
392 Ga0070672_100008787
393 Ga0070672_100422562
394 Ga0070686_100097287
395 Ga0070695_100124034
396 Ga0070695_100221986
397 Ga0070695_100500383
398 Ga0070695_100653106
399 Ga0070696_100002223
400 Ga0070696_100028616
401 Ga0070696_100058739
402 Ga0070693_100000884
403 Ga0070704_100002677
404 Ga0070704_100172804
405 Ga0070704_100434446
406 Ga0068855_100200919
407 Ga0070664_100176156
408 Ga0070664_100305552
409 Ga0070702_100005485
410 Ga0070702_100018184
411 Ga0068852_100262300
412 Ga0068859_100023947
413 Ga0068859_100030924
414 Ga0068859_100173486
415 Ga0068859_100645665
416 Ga0068864_100007853
417 Ga0068864_100022962
418 Ga0068866_10312081
419 Ga0068861_100035972
420 Ga0068863_100118757
421 Ga0068858_100029895
422 Ga0068858_100071341
423 Ga0068858_100252144
424 Ga0068860_100075901
425 Ga0068860_100635118
426 Ga0068862_100000995
427 Ga0068862_100017817
428 Ga0081455_10040451
429 Ga0070717_10036805
430 Ga0075365_10159921
431 Ga0075368_10027885
432 Ga0075368_10104896
433 Ga0070716_100016869
434 Ga0070712_100112584
435 Ga0075362_10022594
436 Ga0075367_10007653
437 Ga0075366_10004789
438 Ga0097621_100053752
439 Ga0097621_100420468
440 Ga0068871_100100267
441 Ga0068871_100282111
442 Ga0075428_100041227
443 Ga0075428_100073238
444 Ga0075428_100084195
445 Ga0075431_100003499
446 Ga0075431_100604945
447 Ga0075433_10110698
448 Ga0075434_100013520
449 Ga0075429_100002862
450 Ga0075429_100049334
451 Ga0068865_100572160
452 Ga0075436_100043327
453 Ga0097620_100023949
454 Ga0097620_100030925
455 Ga0097620_100173476
456 Ga0097620_100645685
457 Ga0075435_100008293
458 Ga0075435_100069184
459 Ga0075435_100369530
460 Ga0111539_10000360
461 Ga0111539_10009889
462 Ga0111539_10058400
463 Ga0111539_10174709
464 Ga0105245_10163394
465 Ga0105245_10269787
466 Ga0105247_10001119
467 Ga0114129_10000075
468 Ga0114129_10052086
469 Ga0114129_10692007
470 Ga0105243_10000664
471 Ga0105243_10014642
472 Ga0105242_10000237
473 Ga0105242_10068942
474 Ga0105242_10148888
475 Ga0105242_10249153
476 Ga0105248_10002081
477 Ga0105248_10021454
478 Ga0105248_10360998
479 Ga0105248_10490720
480 Ga0105249_10278391
481 Ga0157371_10533395
482 Ga0157369_10004985
483 Ga0157374_10070028
484 Ga0157378_10000028
485 Ga0157378_10033357
486 Ga0157378_10337138
487 Ga0157378_10487135
488 Ga0157378_11154484
489 Ga0163162_10322939
490 Ga0163162_10457652
491 Ga0157372_11096374
492 Ga0157372_11123226
493 Ga0157375_10015289
494 Ga0157375_10032507
495 Ga0157375_10209819
496 Ga0157375_10935448
497 Ga0157375_10994764
498 Ga0163163_10001048
499 Ga0163163_10294116
500 Ga0157380_10018368
501 Ga0157380_10244704
502 Ga0157380_10585547
503 Ga0157379_10054067
504 Ga0157376_10221240
505 Ga0157376_10357705
506 Ga0163161_10038193
507 Ga0163161_10084238
508 Ga0207682_10064307
509 Ga0207692_10142689
510 Ga0207692_10173949
511 Ga0207710_10003291
512 Ga0207710_10103420
513 Ga0207680_10011157
514 Ga0207680_10065344
515 Ga0207680_10162083
516 Ga0207645_10005644
517 Ga0207645_10058530
518 Ga0207643_10004903
519 Ga0207693_10054738
520 Ga0207693_10059047
521 Ga0207662_10040493
522 Ga0207662_10057042
523 Ga0207662_10106376
524 Ga0207657_10272321
525 Ga0207681_10083319
526 Ga0207681_10140806
527 Ga0207681_10198205
528 Ga0207694_10019420
529 Ga0207694_10789579
530 Ga0207650_10000007
531 Ga0207650_10640377
532 Ga0207700_10393565
533 Ga0207644_10148197
534 Ga0207644_10243559
535 Ga0207706_10185512
536 Ga0207706_10280290
537 Ga0207686_10002432
538 Ga0207686_10036593
539 Ga0207686_10272753
540 Ga0207709_10000900
541 Ga0207709_10297032
542 Ga0207709_10478388
543 Ga0207670_10068958
544 Ga0207704_10008688
545 Ga0207704_10021165
546 Ga0207691_10010530
547 Ga0207691_10345115
548 Ga0207691_10608397
549 Ga0207711_10010613
550 Ga0207711_10021610
551 Ga0207711_10022746
552 Ga0207711_10268003
553 Ga0207689_10050674
554 Ga0207679_10159344
555 Ga0207667_10070229
556 Ga0207667_10141233
557 Ga0207651_10030432
558 Ga0207712_10048220
559 Ga0207668_10043315
560 Ga0207668_10197404
561 Ga0207640_10083478
562 Ga0207677_10038953
563 Ga0207677_10123316
564 Ga0207703_10021805
565 Ga0207703_10053709
566 Ga0207708_10001151
567 Ga0207708_10007725
568 Ga0207708_10177692
569 Ga0207702_10177289
570 Ga0207641_10136442
571 Ga0207641_10644432
572 Ga0207648_10003444
573 Ga0207648_10072009
574 Ga0207648_10119011
575 Ga0207676_10074806
576 Ga0207676_10278153
577 Ga0207674_10175303
578 Ga0207675_100011062
579 Ga0207675_100119618
580 Ga0207675_100309529
581 Ga0207683_10258851
582 Ga0207683_10710791
583 Ga0209813_10036238
584 Ga0209974_10008882
585 Ga0207428_10000220
586 Ga0207428_10051039
587 Ga0207428_10073696
588 Ga0207428_10473231
589 Ga0268266_10756075
590 Ga0268265_10000662
591 Ga0268265_10027395
592 Ga0268265_10052297
593 Ga0268264_10047921
594 Ga0268264_10205962
595 Ga0265338_10231301
596 Ga0307408_100190089
597 Ga0307410_10689642
598 Ga0307409_100122023
599 Ga0307409_100402918
600 Ga0307411_10375491
601 Ga0373940_0022056
602 Ga0373952_0009200
603 Ga0373952_0087688
604 Ga0373936_0149562
605 Ga0373946_0090380
606 Ga0373962_0085028
607 Ga0373931_0350376
608 Ga0373933_0597978
609 Ga0373937_0045368
610 Ga0373937_0850609
611 Ga0395900_0426182
612 Ga0436365_0202471
613 Ga0451576_0062626
614 Ga0466967_0026246
615 Ga0466967_0265129
616 Ga0495608_0246194
617 Ga0495642_0300176
618 Ga0495646_0279101
619 Ga0495670_0155298
620 Ga0495581_0062129
621 Ga0496102_0183621
622 Ga0496104_0015171
623 Ga0496104_0035499
624 Ga0496105_0650030
625 Ga0496106_0029156
626 Ga0496108_0010585
627 Ga0496111_0807540
628 Ga0496112_0001479
629 Ga0496112_0014042
630 Ga0496112_0099476
631 Ga0501040_0389236
632 Ga0501040_0703656
633 Ga0501042_0429298
634 Ga0501069_0033474
635 Ga0501075_0207664
636 Ga0501081_0037972
637 Ga0501035_0185652
638 Ga0501045_0061626
639 nmdc:mga03683_251525_c1
640 nmdc:mga06z11_8116_c1
641 nmdc:mga04h51_43263_c1
642 nmdc:mga05p37_1298709_c1
643 nmdc:mga05p37_229259_c1
644 nmdc:mga05p37_263044_c1
645 nmdc:mga05p37_550078_c1
646 nmdc:mga05p37_74807_c1
647 nmdc:mga09592_1179_c2
648 nmdc:mga09592_75339_c1
649 nmdc:mga06r32_632589_c1
650 nmdc:mga08y16_1032192_c1
651 nmdc:mga08y16_65721_c1
652 nmdc:mga08y16_750_c1
653 nmdc:mga08y16_8199_c1
654 nmdc:mga0n895_129033_c1
655 nmdc:mga0n895_283799_c1
656 nmdc:mga0n895_30785_c1
657 nmdc:mga0rr50_1001_c2
658 nmdc:mga0rr50_596387_c1
659 nmdc:mga0rr50_710436_c1
660 nmdc:mga0rr50_810981_c1
661 nmdc:mga0rr50_90099_c1
662 nmdc:mga0rr50_98967_c1
663 nmdc:mga08x19_23271_c1
664 nmdc:mga08x19_36944_c1
665 nmdc:mga0a205_132448_c2
666 nmdc:mga0a205_151705_c1
667 nmdc:mga0a205_5985_c1
668 Ga0587077_011169
669 Ga0587109_016519
670 Ga0587068_025333
671 Ga0587075_018123
672 Ga0587076_003231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

92

253

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.973 13 208
6l6s-assembly1.cif.gz_A the structure of the udgx mutant h109e crosslinked to single-stranded dna 0.9712 11 208
6ajq-assembly1.cif.gz_A e52q mutant form of uracil dna glycosylase x from mycobacterium smegmatis. 0.964 10 208
6ail-assembly1.cif.gz_A crystal structure at 1.3 angstroms resolution of a novel udg, udgx, from mycobacterium smegmatis 0.963 10 208
6ajr-assembly1.cif.gz_A complex form of uracil dna glycosylase x and uracil 0.963 10 208
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9005 20 212 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8642 20 212 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8576 18 213 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8492 18 213 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7507 44 210 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7Y5XYP5-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9927 9 200 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W1KT55-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9926 15 209 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V9KZQ3-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9926 21 158 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2S9G1C1-F1-model_v4 Uracil-DNA glycosylase 0.9924 38 118 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V3XLK2-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9923 10 210 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map