F412559

General Info

Members Datasets Scaffolds Average Seq Length
336 212 672 378

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100074617|Ga0070713_1000746172
Length 417
Sequence VAVEYESETAGLSPLGEAASRAQPSKNNEGDGDVDEPIQPGGTALMEATALDHLFASLHDAGFSVIGPTVRDGAIVLDELGAARDLPFGWGVQLEPGGYRLRRRADSAAFGHSAGPQSWKQYLHPPREKLWSVRLADGGFEAETDEDAGPPRLAFFGVRPCDLRAIEIQDQVLGSGRGNSRYAARREAVLIVAVNCTEPGETCFCASMGTGPGAGPGYDLALTELVAGDRHEFLVDVGTPAGASVLASVPHSAAGPTTVDGARAAVAEAAQHMGRSMPATGLRELMAGSHDAARWDDVASRCLTCGNCTLACPTCFCTSVEDVTDLSGDHAERWQHWASCFDLDFSYLHGGPVRVSAESRYRQWLTHKLGTWHDQFGSSGCVGCGRCIVWCPVGIDITEEVTALQAEAQQAASGDTQ

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
210 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
211 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
212 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 4.76
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100074617 3300005436 Bacteria 2874
2 JGI24751J29686_10007121 3300002459 Bacteria 2287
3 Ga0070683_100001960 3300005329 Bacteria 16133
4 Ga0068869_100008114 3300005334 Bacteria 6756
5 Ga0070680_100098856 3300005336 Bacteria 2421
6 Ga0070682_100051330 3300005337 Bacteria 2577
7 Ga0068868_100005221 3300005338 Bacteria 9117
8 Ga0068868_100021869 3300005338 Bacteria 4821
9 Ga0070692_10008521 3300005345 Bacteria 4578
10 Ga0070668_100061561 3300005347 Bacteria 2908
11 Ga0070668_100303371 3300005347 Bacteria 1340
12 Ga0070675_100003426 3300005354 Bacteria 12015
13 Ga0070675_100347467 3300005354 Bacteria 1315
14 Ga0070667_100004465 3300005367 Bacteria 11799
15 Ga0070709_10022842 3300005434 Bacteria 3665
16 Ga0070709_10045897 3300005434 Bacteria 2715
17 Ga0070714_100038699 3300005435 Bacteria 4011
18 Ga0070713_100043467 3300005436 Bacteria 3673
19 Ga0070713_100050347 3300005436 Bacteria 3441
20 Ga0070713_100182886 3300005436 Bacteria 1884
21 Ga0070713_100188927 3300005436 Bacteria 1855
22 Ga0070710_10000620 3300005437 Bacteria 16910
23 Ga0070711_100098634 3300005439 Bacteria 2121
24 Ga0070708_100034614 3300005445 Bacteria 4396
25 Ga0070708_100095699 3300005445 Bacteria 2711
26 Ga0070663_100002329 3300005455 Bacteria 10672
27 Ga0070663_100292352 3300005455 Bacteria 1302
28 Ga0070678_100063694 3300005456 Bacteria 2729
29 Ga0070706_100006984 3300005467 Bacteria 10651
30 Ga0070706_100164371 3300005467 Bacteria 2072
31 Ga0070698_100043244 3300005471 Bacteria 4619
32 Ga0070698_100089893 3300005471 Bacteria 3055
33 Ga0070698_100092145 3300005471 Bacteria 3011
34 Ga0070665_100001172 3300005548 Bacteria 32156
35 Ga0070665_100052037 3300005548 Bacteria 4108
36 Ga0070665_100135733 3300005548 Bacteria 2463
37 Ga0070704_100158922 3300005549 Bacteria 1785
38 Ga0068855_100073263 3300005563 Bacteria 3979
39 Ga0070664_100021713 3300005564 Bacteria 5295
40 Ga0068857_100008744 3300005577 Bacteria 8769
41 Ga0068857_100202921 3300005577 Bacteria 1808
42 Ga0068854_100008849 3300005578 Bacteria 6480
43 Ga0068856_100071708 3300005614 Bacteria 3430
44 Ga0068852_100078877 3300005616 Bacteria 2915
45 Ga0068852_100211727 3300005616 Bacteria 1839
46 Ga0068852_100224289 3300005616 Bacteria 1789
47 Ga0068864_100227895 3300005618 Bacteria 1722
48 Ga0068861_100014111 3300005719 Bacteria 5602
49 Ga0068863_100003889 3300005841 Bacteria 14761
50 Ga0068863_100142094 3300005841 Bacteria 2294
51 Ga0068858_100012495 3300005842 Bacteria 8009
52 Ga0068860_100013421 3300005843 Bacteria 8034
53 Ga0070717_10108203 3300006028 Bacteria 2368
54 Ga0070716_100068406 3300006173 Bacteria 2077
55 Ga0075369_10030036 3300006186 Bacteria 2287
56 Ga0068871_100168768 3300006358 Bacteria 1875
57 Ga0105240_10100871 3300009093 Bacteria 3512
58 Ga0111539_10002711 3300009094 Bacteria 23490
59 Ga0105245_10037683 3300009098 Bacteria 4299
60 Ga0105245_10086999 3300009098 Bacteria 2867
61 Ga0105247_10063965 3300009101 Bacteria 2285
62 Ga0114129_10025657 3300009147 Bacteria 8349
63 Ga0114129_10028365 3300009147 Bacteria 7932
64 Ga0105241_10027909 3300009174 Bacteria 4203
65 Ga0105248_10014432 3300009177 Bacteria 8695
66 Ga0105237_10193558 3300009545 Bacteria 2033
67 Ga0105238_10013955 3300009551 Bacteria 8123
68 Ga0105238_10035605 3300009551 Bacteria 5060
69 Ga0105249_10016974 3300009553 Bacteria 6459
70 Ga0105246_10075118 3300011119 Bacteria 2392
71 Ga0157370_10079433 3300013104 Bacteria 3089
72 Ga0157369_10174201 3300013105 Bacteria 2265
73 Ga0157369_10270144 3300013105 Bacteria 1772
74 Ga0157374_10013954 3300013296 Bacteria 7023
75 Ga0157378_10144280 3300013297 Bacteria 2213
76 Ga0157375_10183101 3300013308 Bacteria 2247
77 Ga0163163_10005276 3300014325 Bacteria 11151
78 Ga0163163_10020727 3300014325 Bacteria 6196
79 Ga0163163_10144475 3300014325 Bacteria 2422
80 Ga0163163_10275570 3300014325 Bacteria 1733
81 Ga0163163_10462330 3300014325 Bacteria 1329
82 Ga0182008_10001218 3300014497 Bacteria 17741
83 Ga0157377_10010362 3300014745 Bacteria 4609
84 Ga0157379_10028992 3300014968 Bacteria 4922
85 Ga0157379_10109910 3300014968 Bacteria 2476
86 Ga0157376_10174146 3300014969 Bacteria 1962
87 Ga0207692_10000439 3300025898 Bacteria 14668
88 Ga0207684_10015577 3300025910 Bacteria 6542
89 Ga0207684_10181604 3300025910 Bacteria 1814
90 Ga0207707_10176961 3300025912 Bacteria 1864
91 Ga0207671_10024542 3300025914 Bacteria 4531
92 Ga0207671_10195613 3300025914 Bacteria 1578
93 Ga0207663_10002987 3300025916 Bacteria 8183
94 Ga0207663_10022608 3300025916 Bacteria 3598
95 Ga0207646_10045759 3300025922 Bacteria 3927
96 Ga0207646_10098860 3300025922 Bacteria 2615
97 Ga0207694_10048667 3300025924 Bacteria 3280
98 Ga0207687_10024973 3300025927 Bacteria 3997
99 Ga0207687_10087024 3300025927 Bacteria 2270
100 Ga0207700_10008261 3300025928 Bacteria 6433
101 Ga0207700_10026781 3300025928 Bacteria 4026
102 Ga0207700_10051553 3300025928 Bacteria 3072
103 Ga0207700_10088574 3300025928 Bacteria 2437
104 Ga0207700_10105342 3300025928 Bacteria 2258
105 Ga0207700_10177651 3300025928 Bacteria 1780
106 Ga0207664_10006902 3300025929 Bacteria 7851
107 Ga0207664_10066348 3300025929 Bacteria 2893
108 Ga0207664_10212209 3300025929 Bacteria 1675
109 Ga0207644_10002087 3300025931 Bacteria 12938
110 Ga0207644_10066133 3300025931 Bacteria 2631
111 Ga0207706_10043352 3300025933 Bacteria 3987
112 Ga0207665_10071898 3300025939 Bacteria 2362
113 Ga0207689_10008051 3300025942 Bacteria 9200
114 Ga0207689_10026830 3300025942 Bacteria 4822
115 Ga0207661_10118686 3300025944 Bacteria 2249
116 Ga0207679_10031939 3300025945 Bacteria 3690
117 Ga0207667_10192233 3300025949 Bacteria 2094
118 Ga0207668_10093387 3300025972 Bacteria 2217
119 Ga0207658_10004370 3300025986 Bacteria 9825
120 Ga0207677_10021476 3300026023 Bacteria 3945
121 Ga0207703_10046281 3300026035 Bacteria 3504
122 Ga0207678_10002988 3300026067 Bacteria 15299
123 Ga0207678_10098814 3300026067 Bacteria 2493
124 Ga0207641_10010418 3300026088 Bacteria 7639
125 Ga0207676_10015136 3300026095 Bacteria 5563
126 Ga0207674_10014837 3300026116 Bacteria 8593
127 Ga0207674_10168295 3300026116 Bacteria 2145
128 Ga0207675_100027987 3300026118 Bacteria 5248
129 Ga0207683_10020380 3300026121 Bacteria 5671
130 Ga0268266_10039614 3300028379 Bacteria 4014
131 Ga0268265_10174227 3300028380 Bacteria 1842
132 Ga0268264_10185315 3300028381 Bacteria 1893
133 Ga0268264_10315632 3300028381 Bacteria 1476
134 Ga0265336_10025878 3300028666 Bacteria 1846
135 Ga0307515_10002223 3300028794 Bacteria 42576
136 Ga0307515_10024245 3300028794 Bacteria 10581
137 Ga0265338_10003014 3300028800 Bacteria 24307
138 Ga0307512_10002915 3300030522 Bacteria 20712
139 Ga0307512_10009466 3300030522 Bacteria 9377
140 Ga0307512_10011401 3300030522 Bacteria 8426
141 Ga0316176_1179732 3300030732 Bacteria 2078
142 Ga0307509_10006603 3300031507 Bacteria 15516
143 Ga0307508_10033747 3300031616 Bacteria 4618
144 Ga0307514_10037023 3300031649 Bacteria 3873
145 Ga0316578_10021288 3300031728 Bacteria 3598
146 Ga0307516_10021124 3300031730 Bacteria 6709
147 Ga0307409_100054471 3300031995 Bacteria 3081
148 Ga0307415_100007578 3300032126 Bacteria 5947
149 Ga0307507_10003725 3300033179 Bacteria 28711
150 Ga0373926_0000808 3300035083 Bacteria 8848
151 Ga0373934_0023546 3300035086 Bacteria 2379
152 Ga0373944_0006639 3300035089 Bacteria 3074
153 Ga0373923_0009339 3300035111 Bacteria 3537
154 Ga0373923_0026455 3300035111 Bacteria 2308
155 Ga0373923_0030012 3300035111 Bacteria 2184
156 Ga0373936_0003944 3300035113 Bacteria 5592
157 Ga0373936_0011679 3300035113 Bacteria 3330
158 Ga0373945_0002780 3300035116 Bacteria 5494
159 Ga0373945_0024774 3300035116 Bacteria 2081
160 Ga0373953_0007933 3300035117 Bacteria 3581
161 Ga0373953_0045746 3300035117 Bacteria 1755
162 Ga0373957_0022155 3300035120 Bacteria 2261
163 Ga0373957_0045614 3300035120 Bacteria 1661
164 Ga0373943_0001327 3300035170 Bacteria 11137
165 Ga0373943_0048244 3300035170 Bacteria 2086
166 Ga0373943_0055752 3300035170 Bacteria 1959
167 Ga0373946_0003244 3300035171 Bacteria 5777
168 Ga0373946_0022497 3300035171 Bacteria 2454
169 Ga0373955_0038088 3300035172 Bacteria 2560
170 Ga0316574_0030303 3300035398 Bacteria 3275
171 Ga0373924_0014392 3300035410 Bacteria 2989
172 Ga0373924_0028747 3300035410 Bacteria 2217
173 Ga0373935_0003053 3300035692 Bacteria 9651
174 Ga0373935_0056449 3300035692 Bacteria 2503
175 Ga0373927_0003686 3300035695 Bacteria 10896
176 Ga0373933_0003694 3300035724 Bacteria 8463
177 Ga0373933_0073066 3300035724 Bacteria 2089
178 Ga0373933_0126914 3300035724 Bacteria 1601
179 Ga0373947_0009528 3300035725 Bacteria 5574
180 Ga0373937_0062682 3300036401 Bacteria 3418
181 Ga0373937_0342174 3300036401 Bacteria 1416
182 Ga0373925_0000373 3300037068 Bacteria 46652
183 Ga0373925_0004651 3300037068 Bacteria 10361
184 Ga0373925_0019775 3300037068 Bacteria 4902
185 Ga0436365_1362981 3300039437 Bacteria 11994
186 Ga0436363_0279604 3300039450 Bacteria 1941
187 Ga0466967_0029115 3300045976 Bacteria 4619
188 Ga0495629_0035153 3300046459 Bacteria 3542
189 Ga0495629_0041456 3300046459 Bacteria 3239
190 Ga0495641_0016455 3300046461 Bacteria 3897
191 Ga0495653_0012576 3300046463 Bacteria 6912
192 Ga0495653_0015384 3300046463 Bacteria 6235
193 Ga0495653_0017859 3300046463 Bacteria 5767
194 Ga0495580_0010875 3300046472 Bacteria 7064
195 Ga0495582_0001010 3300046473 Bacteria 15775
196 Ga0495582_0024961 3300046473 Bacteria 3273
197 Ga0495639_0041304 3300046475 Bacteria 2077
198 Ga0495662_0059442 3300046476 Bacteria 1846
199 Ga0495664_0004904 3300046477 Bacteria 7319
200 Ga0495584_0015673 3300046491 Bacteria 3865
201 Ga0495608_0034253 3300046511 Bacteria 3429
202 Ga0495608_0038365 3300046511 Bacteria 3217
203 Ga0495608_0069503 3300046511 Bacteria 2300
204 Ga0495618_0010457 3300046514 Bacteria 5613
205 Ga0495628_0033245 3300046516 Bacteria 4158
206 Ga0495630_0031540 3300046517 Bacteria 3946
207 Ga0495630_0077004 3300046517 Bacteria 2514
208 Ga0495630_0107351 3300046517 Bacteria 2115
209 Ga0495630_0251782 3300046517 Bacteria 1349
210 Ga0495652_0018787 3300046529 Bacteria 6160
211 Ga0495652_0077522 3300046529 Bacteria 2754
212 Ga0495665_0025995 3300046531 Bacteria 3144
213 Ga0495665_0095555 3300046531 Bacteria 1560
214 Ga0495665_0107745 3300046531 Bacteria 1462
215 Ga0495640_0077291 3300046533 Bacteria 2219
216 Ga0495587_0009534 3300046536 Bacteria 6218
217 Ga0495645_0007976 3300046543 Bacteria 7371
218 Ga0495645_0084186 3300046543 Bacteria 2277
219 Ga0495667_0012534 3300046559 Bacteria 5748
220 Ga0495667_0012671 3300046559 Bacteria 5714
221 Ga0495667_0058180 3300046559 Bacteria 2539
222 Ga0495667_0059709 3300046559 Bacteria 2502
223 Ga0495667_0110083 3300046559 Bacteria 1779
224 Ga0495634_0011536 3300046642 Bacteria 6429
225 Ga0495634_0027294 3300046642 Bacteria 3973
226 Ga0495634_0043019 3300046642 Bacteria 3062
227 Ga0495635_0006351 3300046663 Bacteria 8239
228 Ga0495635_0025274 3300046663 Bacteria 4136
229 Ga0495635_0039900 3300046663 Bacteria 3246
230 Ga0495657_0026751 3300046675 Bacteria 4082
231 Ga0495657_0058230 3300046675 Bacteria 2566
232 Ga0495599_0026822 3300046678 Bacteria 3611
233 Ga0495623_0050295 3300046679 Bacteria 2640
234 Ga0495646_0027462 3300046680 Bacteria 3571
235 Ga0495646_0050185 3300046680 Bacteria 2530
236 Ga0495658_0010854 3300046683 Bacteria 4563
237 Ga0495624_0021091 3300046690 Bacteria 4325
238 Ga0495600_0032453 3300046809 Bacteria 3388
239 Ga0495600_0041645 3300046809 Bacteria 2993
240 Ga0495581_0004889 3300047315 Bacteria 7750
241 Ga0495581_0022360 3300047315 Bacteria 3665
242 Ga0495604_0046884 3300047317 Bacteria 3368
243 Ga0495604_0136011 3300047317 Bacteria 1761
244 Ga0495674_0003487 3300047319 Bacteria 15295
245 Ga0495674_0004147 3300047319 Bacteria 13995
246 Ga0495674_0041767 3300047319 Bacteria 4094
247 Ga0495674_0189253 3300047319 Bacteria 1711
248 Ga0495676_0025931 3300047321 Bacteria 5052
249 Ga0495676_0154799 3300047321 Bacteria 1627
250 Ga0495680_0019081 3300047322 Bacteria 5803
251 Ga0495680_0037881 3300047322 Bacteria 3859
252 Ga0495680_0058769 3300047322 Bacteria 2970
253 Ga0495680_0097423 3300047322 Bacteria 2195
254 Ga0495675_0026001 3300047444 Bacteria 3730
255 Ga0495675_0115512 3300047444 Bacteria 1674
256 Ga0495684_0005152 3300047471 Bacteria 10189
257 Ga0495684_0025577 3300047471 Bacteria 4535
258 Ga0495602_0081019 3300048088 Bacteria 2731
259 Ga0495602_0152991 3300048088 Bacteria 1810
260 Ga0496102_0004996 3300048905 Bacteria 11235
261 Ga0496102_0031082 3300048905 Bacteria 4786
262 Ga0496102_0090213 3300048905 Bacteria 2836
263 Ga0496104_0047211 3300048907 Bacteria 4058
264 Ga0496105_0024543 3300048908 Bacteria 4899
265 Ga0496106_0036138 3300048909 Bacteria 3695
266 Ga0496107_0167111 3300048910 Bacteria 1631
267 Ga0496108_0385145 3300048911 Bacteria 1224
268 Ga0496109_0019204 3300048912 Bacteria 6021
269 Ga0496110_0018324 3300048913 Bacteria 5871
270 Ga0496111_0009722 3300048914 Bacteria 6429
271 Ga0496111_0081343 3300048914 Bacteria 2364
272 Ga0496111_0126337 3300048914 Bacteria 1891
273 Ga0496112_0036246 3300048915 Bacteria 4811
274 Ga0496113_0015723 3300048916 Bacteria 5211
275 Ga0496113_0145684 3300048916 Bacteria 1866
276 Ga0496118_0000505 3300048921 Bacteria 64638
277 Ga0496119_0000745 3300048922 Bacteria 43756
278 Ga0496120_0000833 3300048923 Bacteria 43993
279 Ga0496126_0279784 3300048929 Bacteria 1382
280 Ga0501031_0007306 3300049568 Bacteria 7207
281 Ga0501033_0000596 3300049570 Bacteria 33450
282 Ga0501033_0008901 3300049570 Bacteria 7754
283 Ga0501033_0057731 3300049570 Bacteria 2868
284 Ga0501034_0000819 3300049571 Bacteria 46254
285 Ga0501034_0080824 3300049571 Bacteria 3254
286 Ga0501036_0011507 3300049572 Bacteria 7328
287 Ga0501036_0072400 3300049572 Bacteria 2913
288 Ga0501036_0075439 3300049572 Bacteria 2852
289 Ga0501037_0016532 3300049573 Bacteria 5430
290 Ga0501038_0020220 3300049574 Bacteria 5989
291 Ga0501039_0006771 3300049575 Bacteria 8720
292 Ga0501040_0017691 3300049576 Bacteria 4731
293 Ga0501041_0003220 3300049577 Bacteria 9382
294 Ga0501041_0050022 3300049577 Bacteria 2547
295 Ga0501042_0001151 3300049578 Bacteria 15287
296 Ga0501042_0030686 3300049578 Bacteria 3799
297 Ga0501046_0001146 3300049580 Bacteria 25795
298 Ga0501047_0001633 3300049581 Bacteria 21884
299 Ga0501047_0002132 3300049581 Bacteria 18937
300 Ga0501048_0003582 3300049582 Bacteria 11821
301 Ga0501048_0154881 3300049582 Bacteria 1621
302 Ga0501069_0035652 3300049585 Bacteria 2742
303 Ga0501070_0000188 3300049586 Bacteria 58075
304 Ga0501071_0000900 3300049587 Bacteria 16075
305 Ga0501072_0005477 3300049588 Bacteria 9662
306 Ga0501072_0019581 3300049588 Bacteria 5234
307 Ga0501074_0137860 3300049590 Bacteria 1745
308 Ga0501075_0067459 3300049591 Bacteria 2701
309 Ga0501075_0167512 3300049591 Bacteria 1676
310 Ga0501076_0003137 3300049592 Bacteria 11520
311 Ga0501076_0087405 3300049592 Bacteria 2506
312 Ga0501077_0017695 3300049593 Bacteria 4502
313 Ga0501079_0015496 3300049741 Bacteria 5818
314 Ga0501079_0017980 3300049741 Bacteria 5397
315 Ga0501080_0017821 3300049742 Bacteria 6573
316 Ga0501080_0024370 3300049742 Bacteria 5609
317 Ga0501081_0012889 3300049743 Bacteria 5498
318 Ga0501081_0129234 3300049743 Bacteria 1804
319 Ga0501035_0000466 3300049822 Bacteria 45324
320 Ga0501035_0043789 3300049822 Bacteria 4033
321 Ga0501044_0000865 3300049823 Bacteria 36445
322 Ga0501045_0013537 3300049824 Bacteria 5762
323 nmdc:mga05p37_28179_c1 3300050507 Bacteria 6847
324 nmdc:mga05p37_5556_c1 3300050507 Bacteria 14821
325 Ga0495619_0009084 3300053085 Bacteria 6272
326 Ga0500644_0035154 3300053088 Bacteria 1622
327 Ga0500652_056358 3300053131 Bacteria 1612
328 Ga0501084_0049975 3300054114 Bacteria 3500
329 Ga0501084_0061228 3300054114 Bacteria 3151
330 Ga0501082_0008351 3300060353 Bacteria 8930
331 Ga0530510_0013396 3300061734 Bacteria 5765
332 Ga0530510_0068827 3300061734 Bacteria 2568
333 2753269426 2751185782 Bacteria 11227053
334 2811842491 2808606982 Bacteria 7791042
335 3006488817 3006486233 Bacteria 8157040
336 8025480222 8025478263 Bacteria 8209203
337 Ga0070713_100074617
338 JGI24751J29686_10007121
339 Ga0070683_100001960
340 Ga0068869_100008114
341 Ga0070680_100098856
342 Ga0070682_100051330
343 Ga0068868_100005221
344 Ga0068868_100021869
345 Ga0070692_10008521
346 Ga0070668_100061561
347 Ga0070668_100303371
348 Ga0070675_100003426
349 Ga0070675_100347467
350 Ga0070667_100004465
351 Ga0070709_10022842
352 Ga0070709_10045897
353 Ga0070714_100038699
354 Ga0070713_100043467
355 Ga0070713_100050347
356 Ga0070713_100182886
357 Ga0070713_100188927
358 Ga0070710_10000620
359 Ga0070711_100098634
360 Ga0070708_100034614
361 Ga0070708_100095699
362 Ga0070663_100002329
363 Ga0070663_100292352
364 Ga0070678_100063694
365 Ga0070706_100006984
366 Ga0070706_100164371
367 Ga0070698_100043244
368 Ga0070698_100089893
369 Ga0070698_100092145
370 Ga0070665_100001172
371 Ga0070665_100052037
372 Ga0070665_100135733
373 Ga0070704_100158922
374 Ga0068855_100073263
375 Ga0070664_100021713
376 Ga0068857_100008744
377 Ga0068857_100202921
378 Ga0068854_100008849
379 Ga0068856_100071708
380 Ga0068852_100078877
381 Ga0068852_100211727
382 Ga0068852_100224289
383 Ga0068864_100227895
384 Ga0068861_100014111
385 Ga0068863_100003889
386 Ga0068863_100142094
387 Ga0068858_100012495
388 Ga0068860_100013421
389 Ga0070717_10108203
390 Ga0070716_100068406
391 Ga0075369_10030036
392 Ga0068871_100168768
393 Ga0105240_10100871
394 Ga0111539_10002711
395 Ga0105245_10037683
396 Ga0105245_10086999
397 Ga0105247_10063965
398 Ga0114129_10025657
399 Ga0114129_10028365
400 Ga0105241_10027909
401 Ga0105248_10014432
402 Ga0105237_10193558
403 Ga0105238_10013955
404 Ga0105238_10035605
405 Ga0105249_10016974
406 Ga0105246_10075118
407 Ga0157370_10079433
408 Ga0157369_10174201
409 Ga0157369_10270144
410 Ga0157374_10013954
411 Ga0157378_10144280
412 Ga0157375_10183101
413 Ga0163163_10005276
414 Ga0163163_10020727
415 Ga0163163_10144475
416 Ga0163163_10275570
417 Ga0163163_10462330
418 Ga0182008_10001218
419 Ga0157377_10010362
420 Ga0157379_10028992
421 Ga0157379_10109910
422 Ga0157376_10174146
423 Ga0207692_10000439
424 Ga0207684_10015577
425 Ga0207684_10181604
426 Ga0207707_10176961
427 Ga0207671_10024542
428 Ga0207671_10195613
429 Ga0207663_10002987
430 Ga0207663_10022608
431 Ga0207646_10045759
432 Ga0207646_10098860
433 Ga0207694_10048667
434 Ga0207687_10024973
435 Ga0207687_10087024
436 Ga0207700_10008261
437 Ga0207700_10026781
438 Ga0207700_10051553
439 Ga0207700_10088574
440 Ga0207700_10105342
441 Ga0207700_10177651
442 Ga0207664_10006902
443 Ga0207664_10066348
444 Ga0207664_10212209
445 Ga0207644_10002087
446 Ga0207644_10066133
447 Ga0207706_10043352
448 Ga0207665_10071898
449 Ga0207689_10008051
450 Ga0207689_10026830
451 Ga0207661_10118686
452 Ga0207679_10031939
453 Ga0207667_10192233
454 Ga0207668_10093387
455 Ga0207658_10004370
456 Ga0207677_10021476
457 Ga0207703_10046281
458 Ga0207678_10002988
459 Ga0207678_10098814
460 Ga0207641_10010418
461 Ga0207676_10015136
462 Ga0207674_10014837
463 Ga0207674_10168295
464 Ga0207675_100027987
465 Ga0207683_10020380
466 Ga0268266_10039614
467 Ga0268265_10174227
468 Ga0268264_10185315
469 Ga0268264_10315632
470 Ga0265336_10025878
471 Ga0307515_10002223
472 Ga0307515_10024245
473 Ga0265338_10003014
474 Ga0307512_10002915
475 Ga0307512_10009466
476 Ga0307512_10011401
477 Ga0316176_1179732
478 Ga0307509_10006603
479 Ga0307508_10033747
480 Ga0307514_10037023
481 Ga0316578_10021288
482 Ga0307516_10021124
483 Ga0307409_100054471
484 Ga0307415_100007578
485 Ga0307507_10003725
486 Ga0373926_0000808
487 Ga0373934_0023546
488 Ga0373944_0006639
489 Ga0373923_0009339
490 Ga0373923_0026455
491 Ga0373923_0030012
492 Ga0373936_0003944
493 Ga0373936_0011679
494 Ga0373945_0002780
495 Ga0373945_0024774
496 Ga0373953_0007933
497 Ga0373953_0045746
498 Ga0373957_0022155
499 Ga0373957_0045614
500 Ga0373943_0001327
501 Ga0373943_0048244
502 Ga0373943_0055752
503 Ga0373946_0003244
504 Ga0373946_0022497
505 Ga0373955_0038088
506 Ga0316574_0030303
507 Ga0373924_0014392
508 Ga0373924_0028747
509 Ga0373935_0003053
510 Ga0373935_0056449
511 Ga0373927_0003686
512 Ga0373933_0003694
513 Ga0373933_0073066
514 Ga0373933_0126914
515 Ga0373947_0009528
516 Ga0373937_0062682
517 Ga0373937_0342174
518 Ga0373925_0000373
519 Ga0373925_0004651
520 Ga0373925_0019775
521 Ga0436365_1362981
522 Ga0436363_0279604
523 Ga0466967_0029115
524 Ga0495629_0035153
525 Ga0495629_0041456
526 Ga0495641_0016455
527 Ga0495653_0012576
528 Ga0495653_0015384
529 Ga0495653_0017859
530 Ga0495580_0010875
531 Ga0495582_0001010
532 Ga0495582_0024961
533 Ga0495639_0041304
534 Ga0495662_0059442
535 Ga0495664_0004904
536 Ga0495584_0015673
537 Ga0495608_0034253
538 Ga0495608_0038365
539 Ga0495608_0069503
540 Ga0495618_0010457
541 Ga0495628_0033245
542 Ga0495630_0031540
543 Ga0495630_0077004
544 Ga0495630_0107351
545 Ga0495630_0251782
546 Ga0495652_0018787
547 Ga0495652_0077522
548 Ga0495665_0025995
549 Ga0495665_0095555
550 Ga0495665_0107745
551 Ga0495640_0077291
552 Ga0495587_0009534
553 Ga0495645_0007976
554 Ga0495645_0084186
555 Ga0495667_0012534
556 Ga0495667_0012671
557 Ga0495667_0058180
558 Ga0495667_0059709
559 Ga0495667_0110083
560 Ga0495634_0011536
561 Ga0495634_0027294
562 Ga0495634_0043019
563 Ga0495635_0006351
564 Ga0495635_0025274
565 Ga0495635_0039900
566 Ga0495657_0026751
567 Ga0495657_0058230
568 Ga0495599_0026822
569 Ga0495623_0050295
570 Ga0495646_0027462
571 Ga0495646_0050185
572 Ga0495658_0010854
573 Ga0495624_0021091
574 Ga0495600_0032453
575 Ga0495600_0041645
576 Ga0495581_0004889
577 Ga0495581_0022360
578 Ga0495604_0046884
579 Ga0495604_0136011
580 Ga0495674_0003487
581 Ga0495674_0004147
582 Ga0495674_0041767
583 Ga0495674_0189253
584 Ga0495676_0025931
585 Ga0495676_0154799
586 Ga0495680_0019081
587 Ga0495680_0037881
588 Ga0495680_0058769
589 Ga0495680_0097423
590 Ga0495675_0026001
591 Ga0495675_0115512
592 Ga0495684_0005152
593 Ga0495684_0025577
594 Ga0495602_0081019
595 Ga0495602_0152991
596 Ga0496102_0004996
597 Ga0496102_0031082
598 Ga0496102_0090213
599 Ga0496104_0047211
600 Ga0496105_0024543
601 Ga0496106_0036138
602 Ga0496107_0167111
603 Ga0496108_0385145
604 Ga0496109_0019204
605 Ga0496110_0018324
606 Ga0496111_0009722
607 Ga0496111_0081343
608 Ga0496111_0126337
609 Ga0496112_0036246
610 Ga0496113_0015723
611 Ga0496113_0145684
612 Ga0496118_0000505
613 Ga0496119_0000745
614 Ga0496120_0000833
615 Ga0496126_0279784
616 Ga0501031_0007306
617 Ga0501033_0000596
618 Ga0501033_0008901
619 Ga0501033_0057731
620 Ga0501034_0000819
621 Ga0501034_0080824
622 Ga0501036_0011507
623 Ga0501036_0072400
624 Ga0501036_0075439
625 Ga0501037_0016532
626 Ga0501038_0020220
627 Ga0501039_0006771
628 Ga0501040_0017691
629 Ga0501041_0003220
630 Ga0501041_0050022
631 Ga0501042_0001151
632 Ga0501042_0030686
633 Ga0501046_0001146
634 Ga0501047_0001633
635 Ga0501047_0002132
636 Ga0501048_0003582
637 Ga0501048_0154881
638 Ga0501069_0035652
639 Ga0501070_0000188
640 Ga0501071_0000900
641 Ga0501072_0005477
642 Ga0501072_0019581
643 Ga0501074_0137860
644 Ga0501075_0067459
645 Ga0501075_0167512
646 Ga0501076_0003137
647 Ga0501076_0087405
648 Ga0501077_0017695
649 Ga0501079_0015496
650 Ga0501079_0017980
651 Ga0501080_0017821
652 Ga0501080_0024370
653 Ga0501081_0012889
654 Ga0501081_0129234
655 Ga0501035_0000466
656 Ga0501035_0043789
657 Ga0501044_0000865
658 Ga0501045_0013537
659 nmdc:mga05p37_28179_c1
660 nmdc:mga05p37_5556_c1
661 Ga0495619_0009084
662 Ga0500644_0035154
663 Ga0500652_056358
664 Ga0501084_0049975
665 Ga0501084_0061228
666 Ga0501082_0008351
667 Ga0530510_0013396
668 Ga0530510_0068827
669 2753269426
670 2811842491
671 3006488817
672 8025480222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17179

Fer4_22

4Fe-4S dicluster domain

301

395

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fl9-assembly3.cif.gz_C the yjee protein 0.6752 161 200
4woi-assembly2.cif.gz_CO 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.5716 8 40
2yhg-assembly1.cif.gz_A ab initio phasing of a nucleoside hydrolase-related hypothetical protein from saccharophagus degradans that is associated with carbohydrate metabolism 0.4863 98 148
4v8c-assembly1.cif.gz_AQ crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.4763 6 45
8edc-assembly1.cif.gz_A structure of c. elegans unc-5 ig 1+2 domains 0.4369 270 296
ID Description Score Start End Superfamily
1xj6A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6452 172 187 3.30.450.20
af_P38097_545_674_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6078 266 292 3.30.450.20
3volA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5865 268 294 3.30.450.20
af_Q06067_265_373_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5762 268 290 3.30.450.20
af_P53255_262_381_1.25.40.280 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;alix/aip1 like domains 0.5602 268 290 1.25.40.280
ID Description Score Start End GO Terms
AF-A0A426UMV1-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9646 1 365 GO:0046872
GO:0051536
AF-G7CC61-F1-model_v4 [NiFe] hydrogenase subunit beta 0.9645 2 365 GO:0046872
GO:0051536
AF-A0A6H9LNY6-F1-model_v4 Sulfite reductase subunit A 0.9638 2 365 GO:0046872
GO:0051536
AF-A0A426UMV1-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.962 1 365 GO:0046872
GO:0051536
AF-A0A6I3L3J6-F1-model_v4 4Fe-4S ferredoxin 0.9618 2 363 GO:0046872
GO:0051536

Map