F412305

General Info

Members Datasets Scaffolds Average Seq Length
335 197 670 155

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_11162874|Ga0307406_111628741
Length 188
Sequence MPRAVCRIREIAGVGLARVQEKIGGRRRGRSSTVPDMTADEFVPVGFDPPTSLTTDQFRLEPLGPQHNQADHAAWMSSIEHIRSTPGYPDGNWPPRSGMTLEENLADLRRHADDFRQGAGFTFTVLDPRDDDVIGCVYLYPSGSEECDVTVQSWVRADRSDLDVPLADAVARWLATDWPWQHVDRCGR

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
142 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
143 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 14.03
Rhizosphere 85.07
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_11162874 3300031901 Bacteria 669
2 JGI24738J21930_10006834 3300002075 Bacteria 2650
3 Ga0070683_100028661 3300005329 Bacteria 5034
4 Ga0070683_100538350 3300005329 Bacteria 1116
5 Ga0070670_100175791 3300005331 Bacteria 1858
6 Ga0070670_100329241 3300005331 Bacteria 1339
7 Ga0070677_10593365 3300005333 Bacteria 612
8 Ga0070680_100021675 3300005336 Bacteria 5109
9 Ga0070682_100066956 3300005337 Bacteria 2286
10 Ga0070682_100111969 3300005337 Bacteria 1820
11 Ga0070682_100267192 3300005337 Bacteria 1241
12 Ga0070682_100655799 3300005337 Bacteria 836
13 Ga0068868_100029418 3300005338 Bacteria 4206
14 Ga0068868_100035957 3300005338 Bacteria 3831
15 Ga0070660_100204372 3300005339 Bacteria 1603
16 Ga0070660_100605880 3300005339 Bacteria 916
17 Ga0070689_100125582 3300005340 Bacteria 2053
18 Ga0070689_100275472 3300005340 Bacteria 1394
19 Ga0070689_100338441 3300005340 Bacteria 1260
20 Ga0070691_10007067 3300005341 Bacteria 5145
21 Ga0070691_10087041 3300005341 Bacteria 1536
22 Ga0070687_100097875 3300005343 Bacteria 1637
23 Ga0070661_100287244 3300005344 Bacteria 1277
24 Ga0070692_10096135 3300005345 Bacteria 1617
25 Ga0070675_100058600 3300005354 Bacteria 3176
26 Ga0070675_100522950 3300005354 Bacteria 1071
27 Ga0070671_100073730 3300005355 Bacteria 2851
28 Ga0070674_100061795 3300005356 Bacteria 2615
29 Ga0070673_100012001 3300005364 Bacteria 5932
30 Ga0070673_100329693 3300005364 Bacteria 1350
31 Ga0070659_100096141 3300005366 Bacteria 2379
32 Ga0070701_10007359 3300005438 Bacteria 4697
33 Ga0070701_10193095 3300005438 Bacteria 1199
34 Ga0070701_10500294 3300005438 Bacteria 789
35 Ga0070700_100016846 3300005441 Bacteria 4168
36 Ga0070663_100383126 3300005455 Bacteria 1146
37 Ga0070663_100508879 3300005455 Bacteria 1001
38 Ga0070663_101293739 3300005455 Bacteria 643
39 Ga0070678_100004880 3300005456 Bacteria 7666
40 Ga0070678_100367377 3300005456 Bacteria 1241
41 Ga0070662_100996377 3300005457 Bacteria 717
42 Ga0070681_10011996 3300005458 Bacteria 8590
43 Ga0068867_100019264 3300005459 Bacteria 4863
44 Ga0070685_10658835 3300005466 Bacteria 759
45 Ga0070684_100053910 3300005535 Bacteria 3502
46 Ga0070684_100112333 3300005535 Bacteria 2444
47 Ga0070684_100340688 3300005535 Bacteria 1378
48 Ga0070684_100525493 3300005535 Bacteria 1097
49 Ga0070672_100049236 3300005543 Bacteria 3277
50 Ga0070693_100071938 3300005547 Bacteria 2039
51 Ga0070693_100176384 3300005547 Bacteria 1373
52 Ga0070693_100409902 3300005547 Bacteria 942
53 Ga0070664_100182363 3300005564 Bacteria 1866
54 Ga0070664_100184892 3300005564 Bacteria 1854
55 Ga0068857_100100306 3300005577 Bacteria 2597
56 Ga0068857_100302960 3300005577 Bacteria 1473
57 Ga0068854_100039840 3300005578 Bacteria 3312
58 Ga0068854_100040773 3300005578 Bacteria 3277
59 Ga0068856_100078783 3300005614 Bacteria 3267
60 Ga0068856_100578337 3300005614 Bacteria 1144
61 Ga0068852_100056196 3300005616 Bacteria 3400
62 Ga0068852_100073595 3300005616 Bacteria 3006
63 Ga0068859_100208803 3300005617 Bacteria 2039
64 Ga0068859_100734084 3300005617 Bacteria 1077
65 Ga0068864_100015055 3300005618 Bacteria 6429
66 Ga0068864_100282105 3300005618 Bacteria 1551
67 Ga0068866_10047631 3300005718 Bacteria 2162
68 Ga0068861_100049100 3300005719 Bacteria 3193
69 Ga0068861_100152507 3300005719 Bacteria 1897
70 Ga0068851_10066778 3300005834 Bacteria 1854
71 Ga0068870_10021262 3300005840 Bacteria 3171
72 Ga0068863_100142188 3300005841 Bacteria 2294
73 Ga0068863_100842446 3300005841 Bacteria 916
74 Ga0068858_100182729 3300005842 Bacteria 1980
75 Ga0081455_10008238 3300005937 Bacteria 10866
76 Ga0081455_10141467 3300005937 Bacteria 1868
77 Ga0081455_10382178 3300005937 Bacteria 983
78 Ga0081538_10000439 3300005981 Bacteria 46752
79 Ga0075365_10321630 3300006038 Bacteria 1089
80 Ga0097621_100022720 3300006237 Bacteria 4872
81 Ga0075431_100001557 3300006847 Bacteria 21285
82 Ga0075431_100002436 3300006847 Bacteria 17903
83 Ga0075433_10039027 3300006852 Bacteria 4104
84 Ga0075434_100018476 3300006871 Bacteria 6737
85 Ga0075429_100015813 3300006880 Bacteria 6534
86 Ga0075429_100319243 3300006880 Bacteria 1359
87 Ga0068865_100066621 3300006881 Bacteria 2541
88 Ga0068865_100201530 3300006881 Bacteria 1545
89 Ga0097620_100208791 3300006931 Bacteria 2039
90 Ga0097620_100734234 3300006931 Bacteria 1077
91 Ga0075435_100137235 3300007076 Bacteria 2050
92 Ga0105240_10372473 3300009093 Bacteria 1614
93 Ga0111539_10034609 3300009094 Bacteria 6122
94 Ga0111539_10078524 3300009094 Bacteria 3883
95 Ga0111539_10680239 3300009094 Bacteria 1198
96 Ga0105245_10034205 3300009098 Bacteria 4506
97 Ga0105245_10077724 3300009098 Bacteria 3026
98 Ga0105245_10211297 3300009098 Bacteria 1868
99 Ga0105245_11875504 3300009098 Bacteria 652
100 Ga0105247_10051972 3300009101 Bacteria 2525
101 Ga0105247_10153893 3300009101 Bacteria 1517
102 Ga0105243_10005922 3300009148 Bacteria 9470
103 Ga0105243_10321017 3300009148 Bacteria 1411
104 Ga0105243_10555603 3300009148 Bacteria 1098
105 Ga0105241_10079168 3300009174 Bacteria 2569
106 Ga0105241_11723897 3300009174 Bacteria 609
107 Ga0105242_11043664 3300009176 Bacteria 828
108 Ga0105242_11556116 3300009176 Bacteria 694
109 Ga0105248_10017453 3300009177 Bacteria 7914
110 Ga0105248_10109301 3300009177 Bacteria 3117
111 Ga0105248_10113425 3300009177 Bacteria 3057
112 Ga0105237_10334929 3300009545 Bacteria 1518
113 Ga0105237_10402571 3300009545 Bacteria 1373
114 Ga0105238_10416556 3300009551 Bacteria 1338
115 Ga0105238_10929794 3300009551 Bacteria 889
116 Ga0105249_10535270 3300009553 Bacteria 1220
117 Ga0105249_10557980 3300009553 Bacteria 1197
118 Ga0105249_10709386 3300009553 Bacteria 1066
119 Ga0105239_10641157 3300010375 Bacteria 1213
120 Ga0105239_11213472 3300010375 Bacteria 869
121 Ga0105246_10059093 3300011119 Bacteria 2659
122 Ga0105246_10080471 3300011119 Bacteria 2319
123 Ga0105246_10159154 3300011119 Bacteria 1719
124 Ga0157341_1004946 3300012494 Bacteria 982
125 Ga0157373_10190717 3300013100 Bacteria 1444
126 Ga0157371_10066831 3300013102 Bacteria 2545
127 Ga0157371_10104446 3300013102 Bacteria 2010
128 Ga0157371_10171778 3300013102 Bacteria 1549
129 Ga0157371_10364675 3300013102 Bacteria 1053
130 Ga0157370_10038673 3300013104 Bacteria 4614
131 Ga0157370_10356410 3300013104 Bacteria 1348
132 Ga0157369_10187400 3300013105 Bacteria 2175
133 Ga0157369_10402549 3300013105 Bacteria 1420
134 Ga0157374_10423697 3300013296 Bacteria 1330
135 Ga0163162_10269671 3300013306 Bacteria 1834
136 Ga0163162_11418982 3300013306 Bacteria 790
137 Ga0157372_10045809 3300013307 Bacteria 4854
138 Ga0157372_10069907 3300013307 Bacteria 3949
139 Ga0157372_10090634 3300013307 Bacteria 3476
140 Ga0157372_10121903 3300013307 Bacteria 2996
141 Ga0157372_10204480 3300013307 Bacteria 2288
142 Ga0157375_10033369 3300013308 Bacteria 4890
143 Ga0157375_10053229 3300013308 Bacteria 3981
144 Ga0157375_10532843 3300013308 Bacteria 1337
145 Ga0163163_10046848 3300014325 Bacteria 4247
146 Ga0163163_10130052 3300014325 Bacteria 2558
147 Ga0163163_10178857 3300014325 Bacteria 2168
148 Ga0157380_10031846 3300014326 Bacteria 4050
149 Ga0157380_10043552 3300014326 Bacteria 3515
150 Ga0157380_10226412 3300014326 Bacteria 1676
151 Ga0182008_10072539 3300014497 Bacteria 1694
152 Ga0157377_10049495 3300014745 Bacteria 2363
153 Ga0157377_10052140 3300014745 Bacteria 2309
154 Ga0157379_10008395 3300014968 Bacteria 8976
155 Ga0157379_11084516 3300014968 Bacteria 766
156 Ga0157376_10365855 3300014969 Bacteria 1384
157 Ga0157376_10624618 3300014969 Bacteria 1075
158 Ga0157376_11959295 3300014969 Bacteria 623
159 Ga0206353_11522892 3300020082 Bacteria 2767
160 Ga0206353_11815566 3300020082 Bacteria 595
161 Ga0207697_10083516 3300025315 Bacteria 1348
162 Ga0207656_10055216 3300025321 Bacteria 1728
163 Ga0207682_10407217 3300025893 Bacteria 643
164 Ga0207642_10021974 3300025899 Bacteria 2522
165 Ga0207645_10018861 3300025907 Bacteria 4531
166 Ga0207643_10000096 3300025908 Bacteria 60233
167 Ga0207643_10011956 3300025908 Bacteria 4687
168 Ga0207705_10219573 3300025909 Bacteria 1443
169 Ga0207695_11086645 3300025913 Bacteria 680
170 Ga0207660_10483844 3300025917 Bacteria 1003
171 Ga0207649_10259712 3300025920 Bacteria 1255
172 Ga0207694_10143086 3300025924 Bacteria 1923
173 Ga0207694_10147040 3300025924 Bacteria 1897
174 Ga0207650_10126666 3300025925 Bacteria 1994
175 Ga0207650_10263734 3300025925 Bacteria 1398
176 Ga0207659_10159138 3300025926 Bacteria 1771
177 Ga0207687_10016363 3300025927 Bacteria 4870
178 Ga0207687_10038118 3300025927 Bacteria 3283
179 Ga0207644_10547600 3300025931 Bacteria 957
180 Ga0207690_10211025 3300025932 Bacteria 1480
181 Ga0207706_10357544 3300025933 Bacteria 1269
182 Ga0207709_10209624 3300025935 Bacteria 1398
183 Ga0207669_10116856 3300025937 Bacteria 1801
184 Ga0207704_10168647 3300025938 Bacteria 1567
185 Ga0207691_10064824 3300025940 Bacteria 3309
186 Ga0207711_10596287 3300025941 Bacteria 1031
187 Ga0207689_10059962 3300025942 Bacteria 3129
188 Ga0207661_10055279 3300025944 Bacteria 3183
189 Ga0207661_10063688 3300025944 Bacteria 2987
190 Ga0207661_10098258 3300025944 Bacteria 2453
191 Ga0207661_10115159 3300025944 Bacteria 2280
192 Ga0207661_10169187 3300025944 Bacteria 1901
193 Ga0207661_10460558 3300025944 Bacteria 1159
194 Ga0207679_10105658 3300025945 Bacteria 2211
195 Ga0207679_10135473 3300025945 Bacteria 1982
196 Ga0207679_10150873 3300025945 Bacteria 1891
197 Ga0207640_10040667 3300025981 Bacteria 2951
198 Ga0207658_10376949 3300025986 Bacteria 1242
199 Ga0207658_10398917 3300025986 Bacteria 1209
200 Ga0207677_10015636 3300026023 Bacteria 4471
201 Ga0207703_10316376 3300026035 Bacteria 1428
202 Ga0207678_10000533 3300026067 Bacteria 34724
203 Ga0207678_10060842 3300026067 Bacteria 3248
204 Ga0207708_10020272 3300026075 Bacteria 5015
205 Ga0207708_10027721 3300026075 Bacteria 4289
206 Ga0207702_10032484 3300026078 Bacteria 4355
207 Ga0207702_10093631 3300026078 Bacteria 2635
208 Ga0207641_10136748 3300026088 Bacteria 2206
209 Ga0207648_10009713 3300026089 Bacteria 9201
210 Ga0207676_10165221 3300026095 Bacteria 1922
211 Ga0207674_10007467 3300026116 Bacteria 12740
212 Ga0207674_10058084 3300026116 Bacteria 3921
213 Ga0207674_10088960 3300026116 Bacteria 3081
214 Ga0207675_100010523 3300026118 Bacteria 8667
215 Ga0207683_10016405 3300026121 Bacteria 6304
216 Ga0207683_10305503 3300026121 Bacteria 1455
217 Ga0207698_10558760 3300026142 Bacteria 1123
218 Ga0207428_10060231 3300027907 Bacteria 3008
219 Ga0268265_10610173 3300028380 Bacteria 1044
220 Ga0268264_10379864 3300028381 Bacteria 1352
221 Ga0265330_10431320 3300031235 Bacteria 559
222 Ga0265340_10005785 3300031247 Bacteria 6839
223 Ga0265316_10104610 3300031344 Bacteria 2149
224 Ga0265314_10058529 3300031711 Bacteria 2640
225 Ga0265342_10099827 3300031712 Bacteria 1655
226 Ga0307518_10001044 3300031838 Bacteria 20736
227 Ga0307410_10401285 3300031852 Bacteria 1108
228 Ga0307410_10900293 3300031852 Bacteria 758
229 Ga0307406_10817288 3300031901 Bacteria 788
230 Ga0307412_10391034 3300031911 Bacteria 1129
231 Ga0307409_100223927 3300031995 Bacteria 1700
232 Ga0307414_10908224 3300032004 Bacteria 808
233 Ga0373943_0801404 3300035170 Bacteria 561
234 Ga0395900_0984078 3300037418 Bacteria 764
235 Ga0395898_0626822 3300037466 Bacteria 1018
236 Ga0451797_0035616 3300041453 Bacteria 946
237 Ga0451802_1592991 3300041460 Bacteria 631
238 Ga0451835_0861681 3300041492 Bacteria 503
239 Ga0450888_012077 3300042126 Bacteria 1019
240 Ga0450902_031377 3300042137 Bacteria 895
241 Ga0439459_0021829 3300042438 Bacteria 1233
242 Ga0466966_0139309 3300044684 Bacteria 1483
243 Ga0466966_0244449 3300044684 Bacteria 1081
244 Ga0466961_0181801 3300044693 Bacteria 1305
245 Ga0466961_0698368 3300044693 Bacteria 608
246 Ga0466963_0019192 3300044694 Bacteria 4284
247 Ga0466963_0021822 3300044694 Bacteria 4045
248 Ga0466963_0161017 3300044694 Bacteria 1562
249 Ga0466963_0480310 3300044694 Bacteria 877
250 Ga0466964_0006820 3300044706 Bacteria 4260
251 Ga0466970_0047298 3300044765 Bacteria 2292
252 Ga0466970_0140545 3300044765 Bacteria 1330
253 Ga0466970_0188146 3300044765 Unclassified 1147
254 Ga0466970_0435331 3300044765 Bacteria 751
255 Ga0466957_0771831 3300044842 Bacteria 682
256 Ga0466959_0376453 3300045049 Bacteria 966
257 Ga0451576_0329677 3300045051 Bacteria 1598
258 Ga0466958_0521071 3300045836 Bacteria 772
259 Ga0466967_0034618 3300045976 Bacteria 4289
260 Ga0466967_0182710 3300045976 Bacteria 1979
261 Ga0495603_0174407 3300046455 Bacteria 1245
262 Ga0495584_0405043 3300046491 Bacteria 693
263 Ga0495657_0494201 3300046675 Bacteria 714
264 Ga0495647_0045226 3300046681 Bacteria 1691
265 Ga0495636_0345922 3300047318 Bacteria 701
266 Ga0496100_0420381 3300048903 Bacteria 1021
267 Ga0496100_0965421 3300048903 Bacteria 670
268 Ga0496101_0044804 3300048904 Bacteria 3167
269 Ga0496101_0347807 3300048904 Bacteria 1165
270 Ga0496101_0373039 3300048904 Bacteria 1122
271 Ga0496101_0502458 3300048904 Bacteria 958
272 Ga0496101_0797111 3300048904 Bacteria 745
273 Ga0496102_0003830 3300048905 Bacteria 12728
274 Ga0496102_0067621 3300048905 Bacteria 3278
275 Ga0496102_0210560 3300048905 Bacteria 1833
276 Ga0496102_1428093 3300048905 Bacteria 611
277 Ga0496103_0226562 3300048906 Bacteria 1202
278 Ga0496103_0259952 3300048906 Bacteria 1117
279 Ga0496103_0441249 3300048906 Bacteria 835
280 Ga0496104_0000949 3300048907 Bacteria 24942
281 Ga0496104_0403730 3300048907 Bacteria 1279
282 Ga0496105_0025690 3300048908 Bacteria 4797
283 Ga0496105_0122048 3300048908 Bacteria 2148
284 Ga0496105_0377897 3300048908 Bacteria 1128
285 Ga0496106_0045880 3300048909 Bacteria 3284
286 Ga0496108_0018867 3300048911 Bacteria 5656
287 Ga0496108_0204461 3300048911 Bacteria 1714
288 Ga0496108_0346849 3300048911 Bacteria 1295
289 Ga0496108_0777424 3300048911 Bacteria 827
290 Ga0496108_0790434 3300048911 Bacteria 819
291 Ga0496108_0992659 3300048911 Bacteria 717
292 Ga0496109_0070594 3300048912 Bacteria 3206
293 Ga0496109_0100095 3300048912 Bacteria 2689
294 Ga0496109_0114516 3300048912 Bacteria 2508
295 Ga0496109_0299253 3300048912 Bacteria 1517
296 Ga0496110_0034979 3300048913 Bacteria 4355
297 Ga0496110_0077638 3300048913 Bacteria 2955
298 Ga0496110_0237852 3300048913 Bacteria 1657
299 Ga0496110_0363705 3300048913 Bacteria 1318
300 Ga0496111_0041760 3300048914 Bacteria 3292
301 Ga0496111_0097875 3300048914 Bacteria 2154
302 Ga0496111_0102452 3300048914 Bacteria 2104
303 Ga0496113_0101841 3300048916 Bacteria 2226
304 Ga0496113_0386685 3300048916 Bacteria 1123
305 Ga0496114_0009544 3300048917 Bacteria 7700
306 Ga0496114_0088294 3300048917 Bacteria 2630
307 Ga0496114_0128321 3300048917 Bacteria 2188
308 Ga0496114_0504791 3300048917 Bacteria 1070
309 Ga0496114_1080413 3300048917 Bacteria 687
310 Ga0496115_0085736 3300048918 Bacteria 2569
311 Ga0501036_0279666 3300049572 Bacteria 1397
312 Ga0501039_0200362 3300049575 Bacteria 1570
313 Ga0501040_0794981 3300049576 Bacteria 684
314 Ga0501042_1195532 3300049578 Bacteria 554
315 Ga0501067_0111509 3300049583 Bacteria 1521
316 Ga0501069_0252983 3300049585 Bacteria 1028
317 Ga0501070_0461150 3300049586 Bacteria 1024
318 Ga0501072_0365028 3300049588 Bacteria 1146
319 Ga0501074_0265607 3300049590 Bacteria 1220
320 Ga0501209_245431 3300049656 Bacteria 559
321 Ga0501081_0118428 3300049743 Bacteria 1884
322 Ga0501045_0592474 3300049824 Bacteria 821
323 nmdc:mga05p37_2029487_c1 3300050507 Bacteria 543
324 nmdc:mga0qj67_1387136_c1 3300050509 Bacteria 543
325 nmdc:mga06r32_1212412_c1 3300050510 Bacteria 701
326 nmdc:mga06r32_28021_c1 3300050510 Bacteria 5268
327 nmdc:mga08y16_723523_c1 3300050511 Bacteria 993
328 nmdc:mga0n895_381749_c1 3300050512 Bacteria 1426
329 nmdc:mga0rr50_52792_c1 3300050513 Bacteria 3022
330 nmdc:mga08x19_46738_c1 3300050514 Bacteria 2769
331 nmdc:mga0a205_34061_c1 3300050515 Bacteria 4886
332 Ga0495619_0025268 3300053085 Bacteria 3813
333 Ga0501082_0696171 3300060353 Bacteria 889
334 Ga0466962_0003858 3300061719 Bacteria 7162
335 Ga0530510_0673491 3300061734 Bacteria 788
336 Ga0307406_11162874
337 JGI24738J21930_10006834
338 Ga0070683_100028661
339 Ga0070683_100538350
340 Ga0070670_100175791
341 Ga0070670_100329241
342 Ga0070677_10593365
343 Ga0070680_100021675
344 Ga0070682_100066956
345 Ga0070682_100111969
346 Ga0070682_100267192
347 Ga0070682_100655799
348 Ga0068868_100029418
349 Ga0068868_100035957
350 Ga0070660_100204372
351 Ga0070660_100605880
352 Ga0070689_100125582
353 Ga0070689_100275472
354 Ga0070689_100338441
355 Ga0070691_10007067
356 Ga0070691_10087041
357 Ga0070687_100097875
358 Ga0070661_100287244
359 Ga0070692_10096135
360 Ga0070675_100058600
361 Ga0070675_100522950
362 Ga0070671_100073730
363 Ga0070674_100061795
364 Ga0070673_100012001
365 Ga0070673_100329693
366 Ga0070659_100096141
367 Ga0070701_10007359
368 Ga0070701_10193095
369 Ga0070701_10500294
370 Ga0070700_100016846
371 Ga0070663_100383126
372 Ga0070663_100508879
373 Ga0070663_101293739
374 Ga0070678_100004880
375 Ga0070678_100367377
376 Ga0070662_100996377
377 Ga0070681_10011996
378 Ga0068867_100019264
379 Ga0070685_10658835
380 Ga0070684_100053910
381 Ga0070684_100112333
382 Ga0070684_100340688
383 Ga0070684_100525493
384 Ga0070672_100049236
385 Ga0070693_100071938
386 Ga0070693_100176384
387 Ga0070693_100409902
388 Ga0070664_100182363
389 Ga0070664_100184892
390 Ga0068857_100100306
391 Ga0068857_100302960
392 Ga0068854_100039840
393 Ga0068854_100040773
394 Ga0068856_100078783
395 Ga0068856_100578337
396 Ga0068852_100056196
397 Ga0068852_100073595
398 Ga0068859_100208803
399 Ga0068859_100734084
400 Ga0068864_100015055
401 Ga0068864_100282105
402 Ga0068866_10047631
403 Ga0068861_100049100
404 Ga0068861_100152507
405 Ga0068851_10066778
406 Ga0068870_10021262
407 Ga0068863_100142188
408 Ga0068863_100842446
409 Ga0068858_100182729
410 Ga0081455_10008238
411 Ga0081455_10141467
412 Ga0081455_10382178
413 Ga0081538_10000439
414 Ga0075365_10321630
415 Ga0097621_100022720
416 Ga0075431_100001557
417 Ga0075431_100002436
418 Ga0075433_10039027
419 Ga0075434_100018476
420 Ga0075429_100015813
421 Ga0075429_100319243
422 Ga0068865_100066621
423 Ga0068865_100201530
424 Ga0097620_100208791
425 Ga0097620_100734234
426 Ga0075435_100137235
427 Ga0105240_10372473
428 Ga0111539_10034609
429 Ga0111539_10078524
430 Ga0111539_10680239
431 Ga0105245_10034205
432 Ga0105245_10077724
433 Ga0105245_10211297
434 Ga0105245_11875504
435 Ga0105247_10051972
436 Ga0105247_10153893
437 Ga0105243_10005922
438 Ga0105243_10321017
439 Ga0105243_10555603
440 Ga0105241_10079168
441 Ga0105241_11723897
442 Ga0105242_11043664
443 Ga0105242_11556116
444 Ga0105248_10017453
445 Ga0105248_10109301
446 Ga0105248_10113425
447 Ga0105237_10334929
448 Ga0105237_10402571
449 Ga0105238_10416556
450 Ga0105238_10929794
451 Ga0105249_10535270
452 Ga0105249_10557980
453 Ga0105249_10709386
454 Ga0105239_10641157
455 Ga0105239_11213472
456 Ga0105246_10059093
457 Ga0105246_10080471
458 Ga0105246_10159154
459 Ga0157341_1004946
460 Ga0157373_10190717
461 Ga0157371_10066831
462 Ga0157371_10104446
463 Ga0157371_10171778
464 Ga0157371_10364675
465 Ga0157370_10038673
466 Ga0157370_10356410
467 Ga0157369_10187400
468 Ga0157369_10402549
469 Ga0157374_10423697
470 Ga0163162_10269671
471 Ga0163162_11418982
472 Ga0157372_10045809
473 Ga0157372_10069907
474 Ga0157372_10090634
475 Ga0157372_10121903
476 Ga0157372_10204480
477 Ga0157375_10033369
478 Ga0157375_10053229
479 Ga0157375_10532843
480 Ga0163163_10046848
481 Ga0163163_10130052
482 Ga0163163_10178857
483 Ga0157380_10031846
484 Ga0157380_10043552
485 Ga0157380_10226412
486 Ga0182008_10072539
487 Ga0157377_10049495
488 Ga0157377_10052140
489 Ga0157379_10008395
490 Ga0157379_11084516
491 Ga0157376_10365855
492 Ga0157376_10624618
493 Ga0157376_11959295
494 Ga0206353_11522892
495 Ga0206353_11815566
496 Ga0207697_10083516
497 Ga0207656_10055216
498 Ga0207682_10407217
499 Ga0207642_10021974
500 Ga0207645_10018861
501 Ga0207643_10000096
502 Ga0207643_10011956
503 Ga0207705_10219573
504 Ga0207695_11086645
505 Ga0207660_10483844
506 Ga0207649_10259712
507 Ga0207694_10143086
508 Ga0207694_10147040
509 Ga0207650_10126666
510 Ga0207650_10263734
511 Ga0207659_10159138
512 Ga0207687_10016363
513 Ga0207687_10038118
514 Ga0207644_10547600
515 Ga0207690_10211025
516 Ga0207706_10357544
517 Ga0207709_10209624
518 Ga0207669_10116856
519 Ga0207704_10168647
520 Ga0207691_10064824
521 Ga0207711_10596287
522 Ga0207689_10059962
523 Ga0207661_10055279
524 Ga0207661_10063688
525 Ga0207661_10098258
526 Ga0207661_10115159
527 Ga0207661_10169187
528 Ga0207661_10460558
529 Ga0207679_10105658
530 Ga0207679_10135473
531 Ga0207679_10150873
532 Ga0207640_10040667
533 Ga0207658_10376949
534 Ga0207658_10398917
535 Ga0207677_10015636
536 Ga0207703_10316376
537 Ga0207678_10000533
538 Ga0207678_10060842
539 Ga0207708_10020272
540 Ga0207708_10027721
541 Ga0207702_10032484
542 Ga0207702_10093631
543 Ga0207641_10136748
544 Ga0207648_10009713
545 Ga0207676_10165221
546 Ga0207674_10007467
547 Ga0207674_10058084
548 Ga0207674_10088960
549 Ga0207675_100010523
550 Ga0207683_10016405
551 Ga0207683_10305503
552 Ga0207698_10558760
553 Ga0207428_10060231
554 Ga0268265_10610173
555 Ga0268264_10379864
556 Ga0265330_10431320
557 Ga0265340_10005785
558 Ga0265316_10104610
559 Ga0265314_10058529
560 Ga0265342_10099827
561 Ga0307518_10001044
562 Ga0307410_10401285
563 Ga0307410_10900293
564 Ga0307406_10817288
565 Ga0307412_10391034
566 Ga0307409_100223927
567 Ga0307414_10908224
568 Ga0373943_0801404
569 Ga0395900_0984078
570 Ga0395898_0626822
571 Ga0451797_0035616
572 Ga0451802_1592991
573 Ga0451835_0861681
574 Ga0450888_012077
575 Ga0450902_031377
576 Ga0439459_0021829
577 Ga0466966_0139309
578 Ga0466966_0244449
579 Ga0466961_0181801
580 Ga0466961_0698368
581 Ga0466963_0019192
582 Ga0466963_0021822
583 Ga0466963_0161017
584 Ga0466963_0480310
585 Ga0466964_0006820
586 Ga0466970_0047298
587 Ga0466970_0140545
588 Ga0466970_0188146
589 Ga0466970_0435331
590 Ga0466957_0771831
591 Ga0466959_0376453
592 Ga0451576_0329677
593 Ga0466958_0521071
594 Ga0466967_0034618
595 Ga0466967_0182710
596 Ga0495603_0174407
597 Ga0495584_0405043
598 Ga0495657_0494201
599 Ga0495647_0045226
600 Ga0495636_0345922
601 Ga0496100_0420381
602 Ga0496100_0965421
603 Ga0496101_0044804
604 Ga0496101_0347807
605 Ga0496101_0373039
606 Ga0496101_0502458
607 Ga0496101_0797111
608 Ga0496102_0003830
609 Ga0496102_0067621
610 Ga0496102_0210560
611 Ga0496102_1428093
612 Ga0496103_0226562
613 Ga0496103_0259952
614 Ga0496103_0441249
615 Ga0496104_0000949
616 Ga0496104_0403730
617 Ga0496105_0025690
618 Ga0496105_0122048
619 Ga0496105_0377897
620 Ga0496106_0045880
621 Ga0496108_0018867
622 Ga0496108_0204461
623 Ga0496108_0346849
624 Ga0496108_0777424
625 Ga0496108_0790434
626 Ga0496108_0992659
627 Ga0496109_0070594
628 Ga0496109_0100095
629 Ga0496109_0114516
630 Ga0496109_0299253
631 Ga0496110_0034979
632 Ga0496110_0077638
633 Ga0496110_0237852
634 Ga0496110_0363705
635 Ga0496111_0041760
636 Ga0496111_0097875
637 Ga0496111_0102452
638 Ga0496113_0101841
639 Ga0496113_0386685
640 Ga0496114_0009544
641 Ga0496114_0088294
642 Ga0496114_0128321
643 Ga0496114_0504791
644 Ga0496114_1080413
645 Ga0496115_0085736
646 Ga0501036_0279666
647 Ga0501039_0200362
648 Ga0501040_0794981
649 Ga0501042_1195532
650 Ga0501067_0111509
651 Ga0501069_0252983
652 Ga0501070_0461150
653 Ga0501072_0365028
654 Ga0501074_0265607
655 Ga0501209_245431
656 Ga0501081_0118428
657 Ga0501045_0592474
658 nmdc:mga05p37_2029487_c1
659 nmdc:mga0qj67_1387136_c1
660 nmdc:mga06r32_1212412_c1
661 nmdc:mga06r32_28021_c1
662 nmdc:mga08y16_723523_c1
663 nmdc:mga0n895_381749_c1
664 nmdc:mga0rr50_52792_c1
665 nmdc:mga08x19_46738_c1
666 nmdc:mga0a205_34061_c1
667 Ga0495619_0025268
668 Ga0501082_0696171
669 Ga0466962_0003858
670 Ga0530510_0673491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.8077 19 139
1nsl-assembly1.cif.gz_E crystal structure of probable acetyltransferase 0.762 16 139
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.7506 7 139
4xpl-assembly1.cif.gz_A the crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a 0.7477 65 140
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.741 11 138
ID Description Score Start End Superfamily
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8146 19 138 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8037 17 123 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7698 8 138 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7687 16 138 3.40.630.30
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7494 15 128 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Y5U714-F1-model_v4 N-acetyltransferase 0.9756 5 152 GO:0016740
AF-E6S7B0-F1-model_v4 DinB-like domain-containing protein 0.9732 3 152
AF-A0A5M3W926-F1-model_v4 SnoaL-like domain-containing protein 0.9718 2 148
AF-A0A538EHY1-F1-model_v4 N-acetyltransferase 0.9714 6 152 GO:0016740
AF-A0A2W6DQD5-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9683 2 147

Map