F412081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 210 | 322 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10106748|Ga0070658_101067482 |
| Length | 291 |
| Sequence | MRASLPSPSILLQYALPHRLLSRIVYWATRWTWRPWKNFLIRHVVKSYAVDMAQAAEPDAFAYASFNAFFTRALRAGARVAPADALAVACPADGRVSQLGAIESNGSDGGRIVQAKGQDFSVAELLADDAEAAKYAHGQFITVYLSPRDYHRVHAPLSGTLRETLHIPGRLFSVAPAAVAHVPRLFARNERLVCHFDGAHGPFAVILVGAMLVSGVETVWSGVEIPPYASAIQRKDWRSKNVRLERFDELGRFNMGSTVIVLLPAGSAALDVNLKSEDFVQVGQEIGRFIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 2 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 3 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 4 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 5 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 6 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 7 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 8 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 9 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 10 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 11 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 12 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 13 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 126 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 131 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 132 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 206 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 207 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 208 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 209 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.52 |
| Metatranscriptomes | 0.6 |
| Isolates | 3.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.07 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 82.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002124 | 3300001904 | Bacteria | 3519 |
| 2 | JGI24738J21930_10004508 | 3300002075 | Bacteria | 3404 |
| 3 | JGI25162J39368_1005567 | 3300002737 | Bacteria | 2413 |
| 4 | Ga0006562J51391_1044937 | 3300003578 | Bacteria | 5090 |
| 5 | Ga0006562J51391_1044938 | 3300003578 | Bacteria | 3850 |
| 6 | Ga0055533_1008474 | 3300003756 | Bacteria | 1299 |
| 7 | Ga0055543_1006859 | 3300004625 | Bacteria | 2702 |
| 8 | Ga0065165_1000118 | 3300005262 | Bacteria | 134488 |
| 9 | Ga0070658_10072510 | 3300005327 | Bacteria | 2822 |
| 10 | Ga0070658_10106748 | 3300005327 | Bacteria | 2317 |
| 11 | Ga0070676_10057237 | 3300005328 | Bacteria | 2307 |
| 12 | Ga0068869_100037777 | 3300005334 | Bacteria | 3435 |
| 13 | Ga0068869_100098677 | 3300005334 | Bacteria | 2207 |
| 14 | Ga0070666_10002860 | 3300005335 | Bacteria | 10423 |
| 15 | Ga0070660_100198892 | 3300005339 | Bacteria | 1625 |
| 16 | Ga0070660_100305405 | 3300005339 | Bacteria | 1305 |
| 17 | Ga0070661_100013309 | 3300005344 | Bacteria | 5775 |
| 18 | Ga0070661_100127591 | 3300005344 | Bacteria | 1909 |
| 19 | Ga0070671_100437729 | 3300005355 | Bacteria | 1121 |
| 20 | Ga0070673_100147659 | 3300005364 | Bacteria | 1989 |
| 21 | Ga0070659_100032894 | 3300005366 | Bacteria | 4026 |
| 22 | Ga0070667_100029138 | 3300005367 | Bacteria | 4597 |
| 23 | Ga0070667_100029340 | 3300005367 | Bacteria | 4582 |
| 24 | Ga0070667_100114606 | 3300005367 | Bacteria | 2340 |
| 25 | Ga0070709_10036319 | 3300005434 | Bacteria | 3001 |
| 26 | Ga0070708_100001161 | 3300005445 | Bacteria | 20274 |
| 27 | Ga0070663_100055132 | 3300005455 | Bacteria | 2844 |
| 28 | Ga0070663_100063104 | 3300005455 | Bacteria | 2674 |
| 29 | Ga0070662_100070389 | 3300005457 | Bacteria | 2577 |
| 30 | Ga0070685_10172989 | 3300005466 | Bacteria | 1385 |
| 31 | Ga0070706_100000505 | 3300005467 | Bacteria | 45815 |
| 32 | Ga0070707_100009576 | 3300005468 | Bacteria | 8999 |
| 33 | Ga0070698_100115332 | 3300005471 | Bacteria | 2651 |
| 34 | Ga0070699_100005779 | 3300005518 | Bacteria | 10820 |
| 35 | Ga0070679_100388130 | 3300005530 | Bacteria | 1343 |
| 36 | Ga0070684_100311074 | 3300005535 | Bacteria | 1446 |
| 37 | Ga0068853_100000094 | 3300005539 | Bacteria | 60921 |
| 38 | Ga0068853_100091303 | 3300005539 | Bacteria | 2678 |
| 39 | Ga0068853_100171262 | 3300005539 | Bacteria | 1964 |
| 40 | Ga0070665_100000077 | 3300005548 | Bacteria | 188308 |
| 41 | Ga0070665_100008335 | 3300005548 | Bacteria | 10483 |
| 42 | Ga0070665_100086173 | 3300005548 | Bacteria | 3146 |
| 43 | Ga0068855_100041569 | 3300005563 | Bacteria | 5448 |
| 44 | Ga0070664_100045831 | 3300005564 | Bacteria | 3692 |
| 45 | Ga0068857_100035689 | 3300005577 | Bacteria | 4404 |
| 46 | Ga0068857_100060060 | 3300005577 | Bacteria | 3378 |
| 47 | Ga0068854_100174443 | 3300005578 | Bacteria | 1675 |
| 48 | Ga0068854_100239586 | 3300005578 | Bacteria | 1444 |
| 49 | Ga0068856_100099825 | 3300005614 | Bacteria | 2894 |
| 50 | Ga0068856_100120882 | 3300005614 | Bacteria | 2620 |
| 51 | Ga0068856_100430994 | 3300005614 | Bacteria | 1339 |
| 52 | Ga0068852_100136727 | 3300005616 | Bacteria | 2263 |
| 53 | Ga0068859_100001643 | 3300005617 | Bacteria | 22816 |
| 54 | Ga0068864_100144111 | 3300005618 | Bacteria | 2152 |
| 55 | Ga0068851_10012343 | 3300005834 | Bacteria | 4025 |
| 56 | Ga0068851_10080103 | 3300005834 | Bacteria | 1704 |
| 57 | Ga0068863_100002896 | 3300005841 | Bacteria | 17005 |
| 58 | Ga0068863_100161401 | 3300005841 | Bacteria | 2147 |
| 59 | Ga0068858_100036717 | 3300005842 | Bacteria | 4543 |
| 60 | Ga0068862_100000453 | 3300005844 | Bacteria | 44400 |
| 61 | Ga0081540_1010601 | 3300005983 | Bacteria | 6223 |
| 62 | Ga0068871_100291024 | 3300006358 | Bacteria | 1431 |
| 63 | Ga0097620_100001643 | 3300006931 | Bacteria | 22816 |
| 64 | Ga0099794_10000121 | 3300007265 | Bacteria | 28467 |
| 65 | Ga0105240_10003874 | 3300009093 | Bacteria | 23103 |
| 66 | Ga0105240_10053682 | 3300009093 | Bacteria | 5057 |
| 67 | Ga0105240_10148007 | 3300009093 | Bacteria | 2800 |
| 68 | Ga0105245_10074350 | 3300009098 | Bacteria | 3092 |
| 69 | Ga0105245_10245219 | 3300009098 | Bacteria | 1739 |
| 70 | Ga0105247_10013414 | 3300009101 | Bacteria | 4914 |
| 71 | Ga0105241_10003925 | 3300009174 | Bacteria | 11013 |
| 72 | Ga0105241_10024856 | 3300009174 | Bacteria | 4450 |
| 73 | Ga0105241_10069399 | 3300009174 | Bacteria | 2733 |
| 74 | Ga0105241_10158752 | 3300009174 | Bacteria | 1857 |
| 75 | Ga0105248_10035775 | 3300009177 | Bacteria | 5555 |
| 76 | Ga0105237_10037182 | 3300009545 | Bacteria | 4922 |
| 77 | Ga0105237_10109957 | 3300009545 | Bacteria | 2748 |
| 78 | Ga0105237_10157844 | 3300009545 | Bacteria | 2266 |
| 79 | Ga0105237_10253449 | 3300009545 | Bacteria | 1762 |
| 80 | Ga0105238_10017602 | 3300009551 | Bacteria | 7264 |
| 81 | Ga0105249_10059016 | 3300009553 | Bacteria | 3518 |
| 82 | Ga0105239_10002497 | 3300010375 | Bacteria | 23416 |
| 83 | Ga0105239_10005331 | 3300010375 | Bacteria | 15084 |
| 84 | Ga0105239_10010054 | 3300010375 | Bacteria | 10607 |
| 85 | Ga0105239_10019395 | 3300010375 | Bacteria | 7509 |
| 86 | Ga0105239_10169252 | 3300010375 | Bacteria | 2443 |
| 87 | Ga0105239_10299125 | 3300010375 | Bacteria | 1812 |
| 88 | Ga0157373_10022734 | 3300013100 | Bacteria | 4547 |
| 89 | Ga0157370_10000033 | 3300013104 | Bacteria | 138137 |
| 90 | Ga0157370_10208598 | 3300013104 | Bacteria | 1811 |
| 91 | Ga0157369_10000107 | 3300013105 | Bacteria | 117307 |
| 92 | Ga0157369_10001162 | 3300013105 | Bacteria | 32848 |
| 93 | Ga0157369_10013887 | 3300013105 | Bacteria | 9099 |
| 94 | Ga0157374_10149526 | 3300013296 | Bacteria | 2270 |
| 95 | Ga0157378_10000130 | 3300013297 | Bacteria | 72949 |
| 96 | Ga0157372_10013923 | 3300013307 | Bacteria | 8594 |
| 97 | Ga0157372_10168587 | 3300013307 | Bacteria | 2533 |
| 98 | Ga0157372_10408967 | 3300013307 | Bacteria | 1581 |
| 99 | Ga0163163_10000168 | 3300014325 | Bacteria | 68808 |
| 100 | Ga0163163_10265638 | 3300014325 | Bacteria | 1767 |
| 101 | Ga0182008_10018884 | 3300014497 | Bacteria | 3565 |
| 102 | Ga0182008_10047342 | 3300014497 | Bacteria | 2136 |
| 103 | Ga0157379_10100575 | 3300014968 | Bacteria | 2595 |
| 104 | Ga0157379_10346212 | 3300014968 | Bacteria | 1360 |
| 105 | Ga0157376_10096261 | 3300014969 | Bacteria | 2576 |
| 106 | Ga0182006_1000027 | 3300015261 | Bacteria | 252946 |
| 107 | Ga0182006_1000594 | 3300015261 | Bacteria | 26468 |
| 108 | Ga0182007_10004103 | 3300015262 | Bacteria | 6700 |
| 109 | Ga0182005_1000054 | 3300015265 | Bacteria | 112885 |
| 110 | Ga0182005_1001774 | 3300015265 | Bacteria | 8305 |
| 111 | Ga0182005_1003986 | 3300015265 | Bacteria | 4868 |
| 112 | Ga0209674_100559 | 3300025226 | Bacteria | 14723 |
| 113 | Ga0209147_105205 | 3300025229 | Bacteria | 1988 |
| 114 | Ga0209437_101329 | 3300025233 | Bacteria | 6485 |
| 115 | Ga0209148_1000843 | 3300025254 | Bacteria | 21760 |
| 116 | Ga0209129_1001177 | 3300025258 | Bacteria | 15055 |
| 117 | Ga0209758_1010423 | 3300025297 | Bacteria | 5563 |
| 118 | Ga0209256_1023206 | 3300025299 | Bacteria | 1856 |
| 119 | Ga0209051_1012258 | 3300025303 | Bacteria | 4157 |
| 120 | Ga0209051_1012929 | 3300025303 | Bacteria | 4004 |
| 121 | Ga0207656_10028570 | 3300025321 | Bacteria | 2290 |
| 122 | Ga0207656_10093867 | 3300025321 | Bacteria | 1366 |
| 123 | Ga0207680_10002020 | 3300025903 | Bacteria | 9512 |
| 124 | Ga0207680_10168102 | 3300025903 | Bacteria | 1475 |
| 125 | Ga0207647_10000221 | 3300025904 | Bacteria | 46891 |
| 126 | Ga0207645_10065630 | 3300025907 | Bacteria | 2320 |
| 127 | Ga0207684_10000062 | 3300025910 | Bacteria | 202863 |
| 128 | Ga0207654_10000072 | 3300025911 | Bacteria | 66188 |
| 129 | Ga0207707_10176145 | 3300025912 | Bacteria | 1868 |
| 130 | Ga0207695_10001009 | 3300025913 | Bacteria | 49724 |
| 131 | Ga0207695_10020104 | 3300025913 | Bacteria | 7660 |
| 132 | Ga0207671_10023827 | 3300025914 | Bacteria | 4612 |
| 133 | Ga0207671_10216769 | 3300025914 | Bacteria | 1498 |
| 134 | Ga0207671_10409429 | 3300025914 | Bacteria | 1079 |
| 135 | Ga0207657_10001113 | 3300025919 | Bacteria | 28509 |
| 136 | Ga0207649_10003854 | 3300025920 | Bacteria | 8178 |
| 137 | Ga0207646_10024748 | 3300025922 | Bacteria | 5495 |
| 138 | Ga0207644_10325859 | 3300025931 | Bacteria | 1243 |
| 139 | Ga0207704_10106448 | 3300025938 | Bacteria | 1884 |
| 140 | Ga0207691_10041677 | 3300025940 | Bacteria | 4237 |
| 141 | Ga0207711_10020414 | 3300025941 | Bacteria | 5523 |
| 142 | Ga0207689_10043186 | 3300025942 | Bacteria | 3726 |
| 143 | Ga0207667_10002516 | 3300025949 | Bacteria | 22863 |
| 144 | Ga0207667_10015232 | 3300025949 | Bacteria | 8743 |
| 145 | Ga0207667_10050445 | 3300025949 | Bacteria | 4390 |
| 146 | Ga0207640_10019112 | 3300025981 | Bacteria | 4041 |
| 147 | Ga0207640_10206679 | 3300025981 | Bacteria | 1492 |
| 148 | Ga0207658_10037140 | 3300025986 | Bacteria | 3497 |
| 149 | Ga0207658_10095779 | 3300025986 | Bacteria | 2313 |
| 150 | Ga0207703_10054296 | 3300026035 | Bacteria | 3258 |
| 151 | Ga0207639_10000722 | 3300026041 | Bacteria | 22566 |
| 152 | Ga0207639_10008263 | 3300026041 | Bacteria | 7131 |
| 153 | Ga0207639_10083068 | 3300026041 | Bacteria | 2541 |
| 154 | Ga0207678_10051667 | 3300026067 | Bacteria | 3548 |
| 155 | Ga0207678_10120908 | 3300026067 | Bacteria | 2235 |
| 156 | Ga0207702_10024342 | 3300026078 | Bacteria | 5023 |
| 157 | Ga0207641_10011821 | 3300026088 | Bacteria | 7163 |
| 158 | Ga0207641_10608381 | 3300026088 | Bacteria | 1071 |
| 159 | Ga0207676_10026841 | 3300026095 | Bacteria | 4284 |
| 160 | Ga0207674_10023124 | 3300026116 | Bacteria | 6664 |
| 161 | Ga0207674_10023495 | 3300026116 | Bacteria | 6602 |
| 162 | Ga0207674_10047606 | 3300026116 | Bacteria | 4394 |
| 163 | Ga0207698_10048695 | 3300026142 | Bacteria | 3219 |
| 164 | Ga0209588_1000004 | 3300027671 | Bacteria | 228800 |
| 165 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 166 | Ga0268266_10100934 | 3300028379 | Bacteria | 2543 |
| 167 | Ga0268265_10000431 | 3300028380 | Bacteria | 44419 |
| 168 | Ga0268264_10055359 | 3300028381 | Bacteria | 3314 |
| 169 | Ga0307509_10230993 | 3300031507 | Bacteria | 1653 |
| 170 | Ga0307508_10181993 | 3300031616 | Bacteria | 1704 |
| 171 | Ga0307412_10001314 | 3300031911 | Bacteria | 13918 |
| 172 | Ga0439436_0000010 | 3300041404 | Bacteria | 104480 |
| 173 | Ga0451791_0806195 | 3300041451 | Bacteria | 2593 |
| 174 | Ga0451791_1639907 | 3300041451 | Bacteria | 1891 |
| 175 | Ga0451797_0083339 | 3300041453 | Bacteria | 1969 |
| 176 | Ga0451807_0536136 | 3300041486 | Bacteria | 3959 |
| 177 | Ga0451807_1517285 | 3300041486 | Bacteria | 2249 |
| 178 | Ga0439445_0030127 | 3300042004 | Bacteria | 1405 |
| 179 | Ga0450908_000074 | 3300042184 | Bacteria | 19802 |
| 180 | Ga0466972_0002304 | 3300044658 | Bacteria | 9392 |
| 181 | Ga0466982_0000048 | 3300044672 | Bacteria | 37037 |
| 182 | Ga0453684_0000672 | 3300044712 | Bacteria | 122591 |
| 183 | Ga0466970_0002763 | 3300044765 | Bacteria | 8470 |
| 184 | Ga0451576_0000268 | 3300045051 | Bacteria | 127422 |
| 185 | Ga0495617_000113 | 3300046452 | Bacteria | 56843 |
| 186 | Ga0495617_000203 | 3300046452 | Bacteria | 37588 |
| 187 | Ga0495638_0000522 | 3300046460 | Bacteria | 44904 |
| 188 | Ga0495638_0045660 | 3300046460 | Bacteria | 2755 |
| 189 | Ga0495650_0004556 | 3300046471 | Bacteria | 9459 |
| 190 | Ga0495650_0046774 | 3300046471 | Bacteria | 1814 |
| 191 | Ga0495584_0000769 | 3300046491 | Bacteria | 21244 |
| 192 | Ga0495584_0069858 | 3300046491 | Bacteria | 1765 |
| 193 | Ga0495585_0000019 | 3300046492 | Bacteria | 156966 |
| 194 | Ga0495585_0001923 | 3300046492 | Bacteria | 15545 |
| 195 | Ga0495607_0000019 | 3300046501 | Bacteria | 167319 |
| 196 | Ga0495607_0000538 | 3300046501 | Bacteria | 37198 |
| 197 | Ga0495606_0000181 | 3300046507 | Bacteria | 111247 |
| 198 | Ga0495606_0007303 | 3300046507 | Bacteria | 9950 |
| 199 | Ga0495606_0007724 | 3300046507 | Bacteria | 9525 |
| 200 | Ga0495610_0001640 | 3300046512 | Bacteria | 19663 |
| 201 | Ga0495616_0000047 | 3300046513 | Bacteria | 110592 |
| 202 | Ga0495616_0001193 | 3300046513 | Bacteria | 18315 |
| 203 | Ga0495620_0000524 | 3300046515 | Bacteria | 24699 |
| 204 | Ga0495620_0004114 | 3300046515 | Bacteria | 8252 |
| 205 | Ga0495631_0000184 | 3300046518 | Bacteria | 42706 |
| 206 | Ga0495631_0000929 | 3300046518 | Bacteria | 18225 |
| 207 | Ga0495632_0000080 | 3300046519 | Bacteria | 99523 |
| 208 | Ga0495632_0006767 | 3300046519 | Bacteria | 7323 |
| 209 | Ga0495632_0017694 | 3300046519 | Bacteria | 3928 |
| 210 | Ga0495632_0208952 | 3300046519 | Bacteria | 886 |
| 211 | Ga0495637_0056957 | 3300046520 | Bacteria | 1616 |
| 212 | Ga0495643_0033272 | 3300046522 | Bacteria | 2854 |
| 213 | Ga0495648_0000424 | 3300046524 | Bacteria | 46425 |
| 214 | Ga0495648_0014506 | 3300046524 | Bacteria | 5765 |
| 215 | Ga0495668_0008627 | 3300046616 | Bacteria | 6337 |
| 216 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 217 | Ga0495611_0000103 | 3300046648 | Bacteria | 58463 |
| 218 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 219 | Ga0495625_0017931 | 3300046660 | Bacteria | 5533 |
| 220 | Ga0495625_0019904 | 3300046660 | Bacteria | 5193 |
| 221 | Ga0495661_0000396 | 3300046665 | Bacteria | 46420 |
| 222 | Ga0495670_0001939 | 3300046691 | Bacteria | 10200 |
| 223 | Ga0495670_0002433 | 3300046691 | Bacteria | 9195 |
| 224 | Ga0495671_0001113 | 3300046692 | Bacteria | 18576 |
| 225 | Ga0495649_0046089 | 3300046694 | Bacteria | 2375 |
| 226 | Ga0495589_0000272 | 3300046794 | Bacteria | 42126 |
| 227 | Ga0495660_0000415 | 3300046810 | Bacteria | 36278 |
| 228 | Ga0495660_0000466 | 3300046810 | Bacteria | 33526 |
| 229 | Ga0495683_0001307 | 3300047323 | Bacteria | 16716 |
| 230 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 231 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 232 | Ga0495673_0000464 | 3300047469 | Bacteria | 44038 |
| 233 | Ga0495673_0000937 | 3300047469 | Bacteria | 26461 |
| 234 | Ga0495686_0000085 | 3300047472 | Bacteria | 198128 |
| 235 | Ga0495686_0000255 | 3300047472 | Bacteria | 95600 |
| 236 | Ga0495686_0006213 | 3300047472 | Bacteria | 9210 |
| 237 | Ga0495686_0006900 | 3300047472 | Bacteria | 8596 |
| 238 | Ga0495686_0077302 | 3300047472 | Bacteria | 2038 |
| 239 | Ga0496100_0000244 | 3300048903 | Bacteria | 28418 |
| 240 | Ga0496101_0003789 | 3300048904 | Bacteria | 9448 |
| 241 | Ga0496102_0430990 | 3300048905 | Bacteria | 1238 |
| 242 | Ga0496106_0002620 | 3300048909 | Bacteria | 13386 |
| 243 | Ga0496116_0152467 | 3300048919 | Bacteria | 1281 |
| 244 | Ga0496117_0032884 | 3300048920 | Bacteria | 3932 |
| 245 | Ga0496118_0000749 | 3300048921 | Bacteria | 52548 |
| 246 | Ga0496118_0002232 | 3300048921 | Bacteria | 26711 |
| 247 | Ga0496118_0003119 | 3300048921 | Bacteria | 21231 |
| 248 | Ga0496119_0016565 | 3300048922 | Bacteria | 5600 |
| 249 | Ga0496120_0132024 | 3300048923 | Bacteria | 1278 |
| 250 | Ga0496121_0000210 | 3300048924 | Bacteria | 128287 |
| 251 | Ga0496121_0001261 | 3300048924 | Bacteria | 43799 |
| 252 | Ga0496121_0005273 | 3300048924 | Bacteria | 16676 |
| 253 | Ga0496121_0206750 | 3300048924 | Bacteria | 1394 |
| 254 | Ga0496122_0035515 | 3300048925 | Bacteria | 4052 |
| 255 | Ga0496122_0232471 | 3300048925 | Bacteria | 1047 |
| 256 | Ga0496123_0003676 | 3300048926 | Bacteria | 16915 |
| 257 | Ga0496123_0050420 | 3300048926 | Bacteria | 2781 |
| 258 | Ga0496123_0119485 | 3300048926 | Bacteria | 1486 |
| 259 | Ga0496124_0002009 | 3300048927 | Bacteria | 27702 |
| 260 | Ga0496124_0002041 | 3300048927 | Bacteria | 27442 |
| 261 | Ga0496126_0034876 | 3300048929 | Bacteria | 4720 |
| 262 | Ga0495678_000207 | 3300049459 | Bacteria | 68441 |
| 263 | Ga0495682_0002794 | 3300049460 | Bacteria | 8063 |
| 264 | Ga0495682_0010089 | 3300049460 | Bacteria | 3666 |
| 265 | Ga0501031_0008125 | 3300049568 | Bacteria | 6834 |
| 266 | Ga0501031_0019414 | 3300049568 | Bacteria | 4429 |
| 267 | Ga0501032_0028649 | 3300049569 | Bacteria | 3826 |
| 268 | Ga0501032_0053459 | 3300049569 | Bacteria | 2719 |
| 269 | Ga0501033_0001525 | 3300049570 | Bacteria | 20468 |
| 270 | Ga0501033_0002150 | 3300049570 | Bacteria | 17042 |
| 271 | Ga0501034_0002351 | 3300049571 | Bacteria | 23045 |
| 272 | Ga0501034_0003794 | 3300049571 | Bacteria | 17052 |
| 273 | Ga0501034_0350147 | 3300049571 | Bacteria | 1405 |
| 274 | Ga0501036_0003706 | 3300049572 | Bacteria | 12246 |
| 275 | Ga0501036_0021696 | 3300049572 | Bacteria | 5398 |
| 276 | Ga0501036_0122592 | 3300049572 | Bacteria | 2195 |
| 277 | Ga0501037_0000336 | 3300049573 | Bacteria | 39761 |
| 278 | Ga0501037_0026462 | 3300049573 | Bacteria | 4289 |
| 279 | Ga0501037_0032458 | 3300049573 | Bacteria | 3856 |
| 280 | Ga0501038_0006022 | 3300049574 | Bacteria | 11222 |
| 281 | Ga0501038_0020596 | 3300049574 | Bacteria | 5927 |
| 282 | Ga0501038_0118095 | 3300049574 | Bacteria | 2190 |
| 283 | Ga0501039_0030654 | 3300049575 | Bacteria | 4147 |
| 284 | Ga0501039_0062081 | 3300049575 | Bacteria | 2895 |
| 285 | Ga0501043_0006855 | 3300049579 | Bacteria | 9094 |
| 286 | Ga0501043_0139992 | 3300049579 | Bacteria | 1895 |
| 287 | Ga0501043_0157415 | 3300049579 | Bacteria | 1776 |
| 288 | Ga0501046_0000908 | 3300049580 | Bacteria | 28913 |
| 289 | Ga0501046_0013023 | 3300049580 | Bacteria | 7057 |
| 290 | Ga0501047_0004939 | 3300049581 | Bacteria | 12520 |
| 291 | Ga0501047_0009431 | 3300049581 | Bacteria | 9222 |
| 292 | Ga0501047_0336889 | 3300049581 | Bacteria | 1346 |
| 293 | Ga0501048_0044183 | 3300049582 | Bacteria | 3187 |
| 294 | Ga0501067_0000630 | 3300049583 | Bacteria | 18924 |
| 295 | Ga0501068_0055468 | 3300049584 | Bacteria | 2401 |
| 296 | Ga0501069_0001151 | 3300049585 | Bacteria | 12806 |
| 297 | Ga0501069_0023080 | 3300049585 | Bacteria | 3389 |
| 298 | Ga0501069_0030478 | 3300049585 | Bacteria | 2962 |
| 299 | Ga0501070_0020295 | 3300049586 | Bacteria | 5574 |
| 300 | Ga0501070_0186585 | 3300049586 | Bacteria | 1705 |
| 301 | Ga0501071_0130509 | 3300049587 | Bacteria | 1866 |
| 302 | Ga0501072_0022095 | 3300049588 | Bacteria | 4935 |
| 303 | Ga0501073_0001086 | 3300049589 | Bacteria | 19668 |
| 304 | Ga0501073_0036781 | 3300049589 | Bacteria | 3477 |
| 305 | Ga0501074_0046942 | 3300049590 | Bacteria | 3122 |
| 306 | Ga0501079_0022694 | 3300049741 | Bacteria | 4815 |
| 307 | Ga0501079_0030908 | 3300049741 | Bacteria | 4115 |
| 308 | Ga0501080_0020021 | 3300049742 | Bacteria | 6193 |
| 309 | Ga0501080_0037138 | 3300049742 | Bacteria | 4548 |
| 310 | Ga0501080_0073038 | 3300049742 | Bacteria | 3191 |
| 311 | Ga0501083_0001373 | 3300049744 | Bacteria | 16526 |
| 312 | Ga0501035_0008886 | 3300049822 | Bacteria | 9350 |
| 313 | Ga0501035_0029081 | 3300049822 | Bacteria | 5039 |
| 314 | Ga0501044_0002330 | 3300049823 | Bacteria | 21651 |
| 315 | Ga0501044_0010585 | 3300049823 | Bacteria | 10005 |
| 316 | Ga0501044_0159731 | 3300049823 | Bacteria | 2231 |
| 317 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 318 | Ga0500651_0002382 | 3300053093 | Bacteria | 9897 |
| 319 | Ga0500555_000077 | 3300053103 | Bacteria | 46807 |
| 320 | Ga0500633_0008583 | 3300053160 | Bacteria | 2643 |
| 321 | Ga0501084_0246197 | 3300054114 | Bacteria | 1509 |
| 322 | Ga0501082_0027866 | 3300060353 | Bacteria | 4865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0001151 | Ga0501069_0001151_2712_3545 | 256 |
| 2 | 3300006358 | Ga0068871_100291024 | Ga0068871_1002910241 | 263 |
| 3 | 3300044658 | Ga0466972_0002304 | Ga0466972_0002304_2575_3438 | 265 |
| 4 | 3300044765 | Ga0466970_0002763 | Ga0466970_0002763_5778_6641 | 265 |
| 5 | 3300025940 | Ga0207691_10041677 | Ga0207691_100416774 | 269 |
| 6 | 3300005617 | Ga0068859_100001643 | Ga0068859_10000164319 | 273 |
| 7 | 3300005834 | Ga0068851_10080103 | Ga0068851_100801032 | 273 |
| 8 | 3300005841 | Ga0068863_100161401 | Ga0068863_1001614013 | 273 |
| 9 | 3300006931 | Ga0097620_100001643 | Ga0097620_10000164319 | 273 |
| 10 | 3300009545 | Ga0105237_10157844 | Ga0105237_101578443 | 273 |
| 11 | 3300025321 | Ga0207656_10093867 | Ga0207656_100938672 | 273 |
| 12 | 3300025914 | Ga0207671_10409429 | Ga0207671_104094292 | 273 |
| 13 | 3300028381 | Ga0268264_10055359 | Ga0268264_100553593 | 273 |
| 14 | 3300005548 | Ga0070665_100086173 | Ga0070665_1000861733 | 274 |
| 15 | 3300005844 | Ga0068862_100000453 | Ga0068862_10000045311 | 274 |
| 16 | 3300014968 | Ga0157379_10346212 | Ga0157379_103462122 | 274 |
| 17 | 3300028380 | Ga0268265_10000431 | Ga0268265_1000043111 | 274 |
| 18 | 3300005445 | Ga0070708_100001161 | Ga0070708_1000011613 | 275 |
| 19 | 3300005467 | Ga0070706_100000505 | Ga0070706_10000050517 | 275 |
| 20 | 3300005468 | Ga0070707_100009576 | Ga0070707_1000095764 | 275 |
| 21 | 3300005471 | Ga0070698_100115332 | Ga0070698_1001153322 | 275 |
| 22 | 3300005518 | Ga0070699_100005779 | Ga0070699_10000577910 | 275 |
| 23 | 3300007265 | Ga0099794_10000121 | Ga0099794_1000012122 | 275 |
| 24 | 3300025910 | Ga0207684_10000062 | Ga0207684_1000006290 | 275 |
| 25 | 3300025922 | Ga0207646_10024748 | Ga0207646_100247485 | 275 |
| 26 | 3300027671 | Ga0209588_1000004 | Ga0209588_100000412 | 275 |
| 27 | 3300041486 | Ga0451807_0536136 | Ga0451807_0536136_506_1342 | 276 |
| 28 | 3300044712 | Ga0453684_0000672 | Ga0453684_0000672_9738_10577 | 277 |
| 29 | 3300045051 | Ga0451576_0000268 | Ga0451576_0000268_14568_15407 | 277 |
| 30 | iso_pu_bacteria | 2593339238 | 2595445729 | 277 |
| 31 | iso_pu_bacteria | 2593339239 | 2595449422 | 277 |
| 32 | iso_pu_bacteria | 2718218334 | 2721027968 | 277 |
| 33 | iso_pu_bacteria | 2734482264 | 2735836463 | 277 |
| 34 | iso_pu_bacteria | 2738543009 | 2739227440 | 277 |
| 35 | iso_pu_bacteria | 2842914999 | 2842915580 | 277 |
| 36 | iso_pu_bacteria | 2842918807 | 2842919594 | 277 |
| 37 | iso_pu_bacteria | 2884338543 | 2884340106 | 277 |
| 38 | iso_pu_bacteria | 2904463128 | 2904463764 | 277 |
| 39 | iso_pu_bacteria | 2919085039 | 2919085806 | 277 |
| 40 | iso_pu_bacteria | 2919404418 | 2919405938 | 277 |
| 41 | iso_pu_bacteria | 2941471342 | 2941474591 | 277 |
| 42 | iso_pu_bacteria | 2953994433 | 2953997942 | 277 |
| 43 | 3300005334 | Ga0068869_100037777 | Ga0068869_1000377773 | 278 |
| 44 | 3300005335 | Ga0070666_10002860 | Ga0070666_100028607 | 278 |
| 45 | 3300005344 | Ga0070661_100127591 | Ga0070661_1001275912 | 278 |
| 46 | 3300005367 | Ga0070667_100029138 | Ga0070667_1000291384 | 278 |
| 47 | 3300005548 | Ga0070665_100000077 | Ga0070665_10000007722 | 278 |
| 48 | 3300009093 | Ga0105240_10003874 | Ga0105240_100038746 | 278 |
| 49 | 3300009098 | Ga0105245_10245219 | Ga0105245_102452191 | 278 |
| 50 | 3300009177 | Ga0105248_10035775 | Ga0105248_100357753 | 278 |
| 51 | 3300009545 | Ga0105237_10109957 | Ga0105237_101099573 | 278 |
| 52 | 3300010375 | Ga0105239_10005331 | Ga0105239_1000533113 | 278 |
| 53 | 3300013296 | Ga0157374_10149526 | Ga0157374_101495263 | 278 |
| 54 | 3300013297 | Ga0157378_10000130 | Ga0157378_1000013052 | 278 |
| 55 | 3300025903 | Ga0207680_10002020 | Ga0207680_100020205 | 278 |
| 56 | 3300025913 | Ga0207695_10020104 | Ga0207695_100201043 | 278 |
| 57 | 3300025941 | Ga0207711_10020414 | Ga0207711_100204144 | 278 |
| 58 | 3300025942 | Ga0207689_10043186 | Ga0207689_100431862 | 278 |
| 59 | 3300025986 | Ga0207658_10037140 | Ga0207658_100371402 | 278 |
| 60 | 3300026041 | Ga0207639_10083068 | Ga0207639_100830683 | 278 |
| 61 | 3300026095 | Ga0207676_10026841 | Ga0207676_100268414 | 278 |
| 62 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011432 | 278 |
| 63 | 3300031616 | Ga0307508_10181993 | Ga0307508_101819932 | 278 |
| 64 | 3300005327 | Ga0070658_10072510 | Ga0070658_100725103 | 279 |
| 65 | 3300005327 | Ga0070658_10106748 | Ga0070658_101067482 | 279 |
| 66 | 3300005339 | Ga0070660_100198892 | Ga0070660_1001988922 | 279 |
| 67 | 3300005339 | Ga0070660_100305405 | Ga0070660_1003054052 | 279 |
| 68 | 3300005344 | Ga0070661_100013309 | Ga0070661_1000133093 | 279 |
| 69 | 3300005355 | Ga0070671_100437729 | Ga0070671_1004377291 | 279 |
| 70 | 3300005366 | Ga0070659_100032894 | Ga0070659_1000328944 | 279 |
| 71 | 3300005367 | Ga0070667_100029340 | Ga0070667_1000293403 | 279 |
| 72 | 3300005455 | Ga0070663_100055132 | Ga0070663_1000551322 | 279 |
| 73 | 3300005457 | Ga0070662_100070389 | Ga0070662_1000703892 | 279 |
| 74 | 3300005530 | Ga0070679_100388130 | Ga0070679_1003881301 | 279 |
| 75 | 3300005535 | Ga0070684_100311074 | Ga0070684_1003110742 | 279 |
| 76 | 3300005539 | Ga0068853_100091303 | Ga0068853_1000913033 | 279 |
| 77 | 3300005563 | Ga0068855_100041569 | Ga0068855_1000415696 | 279 |
| 78 | 3300005564 | Ga0070664_100045831 | Ga0070664_1000458313 | 279 |
| 79 | 3300005577 | Ga0068857_100035689 | Ga0068857_1000356894 | 279 |
| 80 | 3300005578 | Ga0068854_100174443 | Ga0068854_1001744431 | 279 |
| 81 | 3300005578 | Ga0068854_100239586 | Ga0068854_1002395862 | 279 |
| 82 | 3300005614 | Ga0068856_100099825 | Ga0068856_1000998253 | 279 |
| 83 | 3300005614 | Ga0068856_100120882 | Ga0068856_1001208823 | 279 |
| 84 | 3300005616 | Ga0068852_100136727 | Ga0068852_1001367272 | 279 |
| 85 | 3300005834 | Ga0068851_10012343 | Ga0068851_100123434 | 279 |
| 86 | 3300005842 | Ga0068858_100036717 | Ga0068858_1000367173 | 279 |
| 87 | 3300009093 | Ga0105240_10053682 | Ga0105240_100536825 | 279 |
| 88 | 3300009093 | Ga0105240_10148007 | Ga0105240_101480073 | 279 |
| 89 | 3300009098 | Ga0105245_10074350 | Ga0105245_100743503 | 279 |
| 90 | 3300009174 | Ga0105241_10003925 | Ga0105241_100039252 | 279 |
| 91 | 3300009174 | Ga0105241_10069399 | Ga0105241_100693992 | 279 |
| 92 | 3300009551 | Ga0105238_10017602 | Ga0105238_100176026 | 279 |
| 93 | 3300010375 | Ga0105239_10010054 | Ga0105239_100100542 | 279 |
| 94 | 3300010375 | Ga0105239_10299125 | Ga0105239_102991253 | 279 |
| 95 | 3300013100 | Ga0157373_10022734 | Ga0157373_100227344 | 279 |
| 96 | 3300013104 | Ga0157370_10208598 | Ga0157370_102085982 | 279 |
| 97 | 3300013105 | Ga0157369_10001162 | Ga0157369_1000116225 | 279 |
| 98 | 3300013105 | Ga0157369_10013887 | Ga0157369_100138872 | 279 |
| 99 | 3300013307 | Ga0157372_10013923 | Ga0157372_100139237 | 279 |
| 100 | 3300013307 | Ga0157372_10408967 | Ga0157372_104089672 | 279 |
| 101 | 3300014325 | Ga0163163_10000168 | Ga0163163_1000016823 | 279 |
| 102 | 3300014969 | Ga0157376_10096261 | Ga0157376_100962613 | 279 |
| 103 | 3300025321 | Ga0207656_10028570 | Ga0207656_100285703 | 279 |
| 104 | 3300025903 | Ga0207680_10168102 | Ga0207680_101681021 | 279 |
| 105 | 3300025912 | Ga0207707_10176145 | Ga0207707_101761451 | 279 |
| 106 | 3300025913 | Ga0207695_10001009 | Ga0207695_1000100944 | 279 |
| 107 | 3300025914 | Ga0207671_10023827 | Ga0207671_100238272 | 279 |
| 108 | 3300025919 | Ga0207657_10001113 | Ga0207657_1000111312 | 279 |
| 109 | 3300025920 | Ga0207649_10003854 | Ga0207649_100038545 | 279 |
| 110 | 3300025949 | Ga0207667_10015232 | Ga0207667_100152323 | 279 |
| 111 | 3300025949 | Ga0207667_10050445 | Ga0207667_100504453 | 279 |
| 112 | 3300025981 | Ga0207640_10019112 | Ga0207640_100191121 | 279 |
| 113 | 3300025981 | Ga0207640_10206679 | Ga0207640_102066792 | 279 |
| 114 | 3300025986 | Ga0207658_10095779 | Ga0207658_100957793 | 279 |
| 115 | 3300026035 | Ga0207703_10054296 | Ga0207703_100542963 | 279 |
| 116 | 3300026067 | Ga0207678_10051667 | Ga0207678_100516673 | 279 |
| 117 | 3300026078 | Ga0207702_10024342 | Ga0207702_100243422 | 279 |
| 118 | 3300026116 | Ga0207674_10023124 | Ga0207674_100231246 | 279 |
| 119 | 3300026142 | Ga0207698_10048695 | Ga0207698_100486953 | 279 |
| 120 | 3300031507 | Ga0307509_10230993 | Ga0307509_102309933 | 279 |
| 121 | 3300041451 | Ga0451791_0806195 | Ga0451791_0806195_1576_2418 | 279 |
| 122 | 3300041451 | Ga0451791_1639907 | Ga0451791_1639907_683_1525 | 279 |
| 123 | 3300041453 | Ga0451797_0083339 | Ga0451797_0083339_893_1735 | 279 |
| 124 | 3300041486 | Ga0451807_1517285 | Ga0451807_1517285_1286_2128 | 279 |
| 125 | 3300049569 | Ga0501032_0028649 | Ga0501032_0028649_1984_2829 | 279 |
| 126 | 3300049571 | Ga0501034_0003794 | Ga0501034_0003794_6462_7307 | 279 |
| 127 | 3300049572 | Ga0501036_0122592 | Ga0501036_0122592_512_1357 | 279 |
| 128 | 3300049573 | Ga0501037_0026462 | Ga0501037_0026462_827_1672 | 279 |
| 129 | 3300049574 | Ga0501038_0118095 | Ga0501038_0118095_811_1656 | 279 |
| 130 | 3300049579 | Ga0501043_0139992 | Ga0501043_0139992_307_1152 | 279 |
| 131 | 3300049581 | Ga0501047_0004939 | Ga0501047_0004939_3494_4339 | 279 |
| 132 | 3300049583 | Ga0501067_0000630 | Ga0501067_0000630_205_1050 | 279 |
| 133 | 3300049584 | Ga0501068_0055468 | Ga0501068_0055468_709_1554 | 279 |
| 134 | 3300049585 | Ga0501069_0030478 | Ga0501069_0030478_745_1590 | 279 |
| 135 | 3300049586 | Ga0501070_0020295 | Ga0501070_0020295_1985_2830 | 279 |
| 136 | 3300049588 | Ga0501072_0022095 | Ga0501072_0022095_775_1620 | 279 |
| 137 | 3300049589 | Ga0501073_0001086 | Ga0501073_0001086_6389_7234 | 279 |
| 138 | 3300049741 | Ga0501079_0022694 | Ga0501079_0022694_827_1672 | 279 |
| 139 | 3300049742 | Ga0501080_0037138 | Ga0501080_0037138_3208_4053 | 279 |
| 140 | 3300049744 | Ga0501083_0001373 | Ga0501083_0001373_15236_16081 | 279 |
| 141 | 3300049823 | Ga0501044_0010585 | Ga0501044_0010585_7176_8021 | 279 |
| 142 | 3300054114 | Ga0501084_0246197 | Ga0501084_0246197_130_975 | 279 |
| 143 | 3300005455 | Ga0070663_100063104 | Ga0070663_1000631043 | 280 |
| 144 | 3300005539 | Ga0068853_100000094 | Ga0068853_1000000947 | 280 |
| 145 | 3300005548 | Ga0070665_100008335 | Ga0070665_1000083352 | 280 |
| 146 | 3300005841 | Ga0068863_100002896 | Ga0068863_1000028964 | 280 |
| 147 | 3300009545 | Ga0105237_10037182 | Ga0105237_100371823 | 280 |
| 148 | 3300009553 | Ga0105249_10059016 | Ga0105249_100590163 | 280 |
| 149 | 3300010375 | Ga0105239_10002497 | Ga0105239_1000249715 | 280 |
| 150 | 3300025949 | Ga0207667_10002516 | Ga0207667_1000251618 | 280 |
| 151 | 3300026041 | Ga0207639_10000722 | Ga0207639_1000072218 | 280 |
| 152 | 3300026067 | Ga0207678_10120908 | Ga0207678_101209082 | 280 |
| 153 | 3300026088 | Ga0207641_10011821 | Ga0207641_100118213 | 280 |
| 154 | 3300001904 | JGI24736J21556_1002124 | JGI24736J21556_10021241 | 281 |
| 155 | 3300002075 | JGI24738J21930_10004508 | JGI24738J21930_100045083 | 281 |
| 156 | 3300002737 | JGI25162J39368_1005567 | JGI25162J39368_10055672 | 281 |
| 157 | 3300003578 | Ga0006562J51391_1044937 | Ga0006562J51391_10449372 | 281 |
| 158 | 3300003578 | Ga0006562J51391_1044938 | Ga0006562J51391_10449383 | 281 |
| 159 | 3300003756 | Ga0055533_1008474 | Ga0055533_10084742 | 281 |
| 160 | 3300004625 | Ga0055543_1006859 | Ga0055543_10068593 | 281 |
| 161 | 3300005262 | Ga0065165_1000118 | Ga0065165_1000118103 | 281 |
| 162 | 3300005328 | Ga0070676_10057237 | Ga0070676_100572372 | 281 |
| 163 | 3300005334 | Ga0068869_100098677 | Ga0068869_1000986773 | 281 |
| 164 | 3300005364 | Ga0070673_100147659 | Ga0070673_1001476592 | 281 |
| 165 | 3300005367 | Ga0070667_100114606 | Ga0070667_1001146063 | 281 |
| 166 | 3300005434 | Ga0070709_10036319 | Ga0070709_100363193 | 281 |
| 167 | 3300005466 | Ga0070685_10172989 | Ga0070685_101729892 | 281 |
| 168 | 3300005539 | Ga0068853_100171262 | Ga0068853_1001712622 | 281 |
| 169 | 3300005577 | Ga0068857_100060060 | Ga0068857_1000600602 | 281 |
| 170 | 3300005614 | Ga0068856_100430994 | Ga0068856_1004309942 | 281 |
| 171 | 3300005618 | Ga0068864_100144111 | Ga0068864_1001441113 | 281 |
| 172 | 3300005983 | Ga0081540_1010601 | Ga0081540_10106013 | 281 |
| 173 | 3300009101 | Ga0105247_10013414 | Ga0105247_100134142 | 281 |
| 174 | 3300009174 | Ga0105241_10024856 | Ga0105241_100248565 | 281 |
| 175 | 3300009174 | Ga0105241_10158752 | Ga0105241_101587522 | 281 |
| 176 | 3300009545 | Ga0105237_10253449 | Ga0105237_102534492 | 281 |
| 177 | 3300010375 | Ga0105239_10019395 | Ga0105239_100193956 | 281 |
| 178 | 3300010375 | Ga0105239_10169252 | Ga0105239_101692522 | 281 |
| 179 | 3300013104 | Ga0157370_10000033 | Ga0157370_1000003352 | 281 |
| 180 | 3300013105 | Ga0157369_10000107 | Ga0157369_1000010771 | 281 |
| 181 | 3300013307 | Ga0157372_10168587 | Ga0157372_101685872 | 281 |
| 182 | 3300014325 | Ga0163163_10265638 | Ga0163163_102656382 | 281 |
| 183 | 3300014497 | Ga0182008_10018884 | Ga0182008_100188841 | 281 |
| 184 | 3300014497 | Ga0182008_10047342 | Ga0182008_100473423 | 281 |
| 185 | 3300014968 | Ga0157379_10100575 | Ga0157379_101005753 | 281 |
| 186 | 3300015261 | Ga0182006_1000027 | Ga0182006_100002758 | 281 |
| 187 | 3300015261 | Ga0182006_1000594 | Ga0182006_100059419 | 281 |
| 188 | 3300015262 | Ga0182007_10004103 | Ga0182007_100041035 | 281 |
| 189 | 3300015265 | Ga0182005_1000054 | Ga0182005_100005430 | 281 |
| 190 | 3300015265 | Ga0182005_1001774 | Ga0182005_10017744 | 281 |
| 191 | 3300015265 | Ga0182005_1003986 | Ga0182005_10039865 | 281 |
| 192 | 3300025226 | Ga0209674_100559 | Ga0209674_1005597 | 281 |
| 193 | 3300025229 | Ga0209147_105205 | Ga0209147_1052052 | 281 |
| 194 | 3300025233 | Ga0209437_101329 | Ga0209437_1013294 | 281 |
| 195 | 3300025254 | Ga0209148_1000843 | Ga0209148_10008438 | 281 |
| 196 | 3300025258 | Ga0209129_1001177 | Ga0209129_10011777 | 281 |
| 197 | 3300025297 | Ga0209758_1010423 | Ga0209758_10104232 | 281 |
| 198 | 3300025299 | Ga0209256_1023206 | Ga0209256_10232061 | 281 |
| 199 | 3300025303 | Ga0209051_1012258 | Ga0209051_10122583 | 281 |
| 200 | 3300025303 | Ga0209051_1012929 | Ga0209051_10129293 | 281 |
| 201 | 3300025904 | Ga0207647_10000221 | Ga0207647_1000022115 | 281 |
| 202 | 3300025907 | Ga0207645_10065630 | Ga0207645_100656301 | 281 |
| 203 | 3300025911 | Ga0207654_10000072 | Ga0207654_100000722 | 281 |
| 204 | 3300025914 | Ga0207671_10216769 | Ga0207671_102167692 | 281 |
| 205 | 3300025931 | Ga0207644_10325859 | Ga0207644_103258592 | 281 |
| 206 | 3300025938 | Ga0207704_10106448 | Ga0207704_101064483 | 281 |
| 207 | 3300026041 | Ga0207639_10008263 | Ga0207639_100082636 | 281 |
| 208 | 3300026088 | Ga0207641_10608381 | Ga0207641_106083811 | 281 |
| 209 | 3300026116 | Ga0207674_10023495 | Ga0207674_100234954 | 281 |
| 210 | 3300026116 | Ga0207674_10047606 | Ga0207674_100476062 | 281 |
| 211 | 3300028379 | Ga0268266_10100934 | Ga0268266_101009342 | 281 |
| 212 | 3300031911 | Ga0307412_10001314 | Ga0307412_100013149 | 281 |
| 213 | 3300041404 | Ga0439436_0000010 | Ga0439436_0000010_85433_86287 | 281 |
| 214 | 3300042004 | Ga0439445_0030127 | Ga0439445_0030127_432_1286 | 281 |
| 215 | 3300042184 | Ga0450908_000074 | Ga0450908_000074_6598_7452 | 281 |
| 216 | 3300044672 | Ga0466982_0000048 | Ga0466982_0000048_20889_21746 | 281 |
| 217 | 3300046452 | Ga0495617_000113 | Ga0495617_000113_27291_28145 | 281 |
| 218 | 3300046452 | Ga0495617_000203 | Ga0495617_000203_18104_18958 | 281 |
| 219 | 3300046460 | Ga0495638_0000522 | Ga0495638_0000522_4883_5737 | 281 |
| 220 | 3300046460 | Ga0495638_0045660 | Ga0495638_0045660_336_1190 | 281 |
| 221 | 3300046471 | Ga0495650_0004556 | Ga0495650_0004556_8122_8976 | 281 |
| 222 | 3300046471 | Ga0495650_0046774 | Ga0495650_0046774_53_907 | 281 |
| 223 | 3300046491 | Ga0495584_0000769 | Ga0495584_0000769_15475_16329 | 281 |
| 224 | 3300046491 | Ga0495584_0069858 | Ga0495584_0069858_232_1086 | 281 |
| 225 | 3300046492 | Ga0495585_0000019 | Ga0495585_0000019_94357_95211 | 281 |
| 226 | 3300046492 | Ga0495585_0001923 | Ga0495585_0001923_4767_5621 | 281 |
| 227 | 3300046501 | Ga0495607_0000019 | Ga0495607_0000019_136854_137708 | 281 |
| 228 | 3300046501 | Ga0495607_0000538 | Ga0495607_0000538_34092_34946 | 281 |
| 229 | 3300046507 | Ga0495606_0000181 | Ga0495606_0000181_95506_96360 | 281 |
| 230 | 3300046507 | Ga0495606_0007303 | Ga0495606_0007303_3717_4658 | 281 |
| 231 | 3300046507 | Ga0495606_0007724 | Ga0495606_0007724_484_1338 | 281 |
| 232 | 3300046512 | Ga0495610_0001640 | Ga0495610_0001640_333_1187 | 281 |
| 233 | 3300046513 | Ga0495616_0000047 | Ga0495616_0000047_55780_56634 | 281 |
| 234 | 3300046513 | Ga0495616_0001193 | Ga0495616_0001193_4076_4930 | 281 |
| 235 | 3300046515 | Ga0495620_0000524 | Ga0495620_0000524_23655_24509 | 281 |
| 236 | 3300046515 | Ga0495620_0004114 | Ga0495620_0004114_2201_3055 | 281 |
| 237 | 3300046518 | Ga0495631_0000184 | Ga0495631_0000184_29814_30668 | 281 |
| 238 | 3300046518 | Ga0495631_0000929 | Ga0495631_0000929_10879_11733 | 281 |
| 239 | 3300046519 | Ga0495632_0000080 | Ga0495632_0000080_32624_33478 | 281 |
| 240 | 3300046519 | Ga0495632_0006767 | Ga0495632_0006767_2503_3357 | 281 |
| 241 | 3300046519 | Ga0495632_0017694 | Ga0495632_0017694_1813_2667 | 281 |
| 242 | 3300046519 | Ga0495632_0208952 | Ga0495632_0208952_10_864 | 281 |
| 243 | 3300046520 | Ga0495637_0056957 | Ga0495637_0056957_153_1007 | 281 |
| 244 | 3300046522 | Ga0495643_0033272 | Ga0495643_0033272_1493_2347 | 281 |
| 245 | 3300046524 | Ga0495648_0000424 | Ga0495648_0000424_11530_12384 | 281 |
| 246 | 3300046524 | Ga0495648_0014506 | Ga0495648_0014506_4206_5060 | 281 |
| 247 | 3300046616 | Ga0495668_0008627 | Ga0495668_0008627_2891_3745 | 281 |
| 248 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_578202_579056 | 281 |
| 249 | 3300046648 | Ga0495611_0000103 | Ga0495611_0000103_29824_30678 | 281 |
| 250 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_1336991_1337845 | 281 |
| 251 | 3300046660 | Ga0495625_0017931 | Ga0495625_0017931_3430_4284 | 281 |
| 252 | 3300046660 | Ga0495625_0019904 | Ga0495625_0019904_329_1183 | 281 |
| 253 | 3300046665 | Ga0495661_0000396 | Ga0495661_0000396_28717_29571 | 281 |
| 254 | 3300046691 | Ga0495670_0001939 | Ga0495670_0001939_2394_3248 | 281 |
| 255 | 3300046691 | Ga0495670_0002433 | Ga0495670_0002433_5485_6339 | 281 |
| 256 | 3300046692 | Ga0495671_0001113 | Ga0495671_0001113_9559_10413 | 281 |
| 257 | 3300046694 | Ga0495649_0046089 | Ga0495649_0046089_1037_1894 | 281 |
| 258 | 3300046794 | Ga0495589_0000272 | Ga0495589_0000272_37804_38658 | 281 |
| 259 | 3300046810 | Ga0495660_0000415 | Ga0495660_0000415_11972_12826 | 281 |
| 260 | 3300046810 | Ga0495660_0000466 | Ga0495660_0000466_20740_21594 | 281 |
| 261 | 3300047323 | Ga0495683_0001307 | Ga0495683_0001307_3387_4241 | 281 |
| 262 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1009540_1010394 | 281 |
| 263 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_1406378_1407232 | 281 |
| 264 | 3300047469 | Ga0495673_0000464 | Ga0495673_0000464_16989_17843 | 281 |
| 265 | 3300047469 | Ga0495673_0000937 | Ga0495673_0000937_12224_13078 | 281 |
| 266 | 3300047472 | Ga0495686_0000085 | Ga0495686_0000085_5714_6565 | 281 |
| 267 | 3300047472 | Ga0495686_0000255 | Ga0495686_0000255_15228_16082 | 281 |
| 268 | 3300047472 | Ga0495686_0006213 | Ga0495686_0006213_8166_9020 | 281 |
| 269 | 3300047472 | Ga0495686_0006900 | Ga0495686_0006900_5036_5890 | 281 |
| 270 | 3300047472 | Ga0495686_0077302 | Ga0495686_0077302_1060_1914 | 281 |
| 271 | 3300048903 | Ga0496100_0000244 | Ga0496100_0000244_6969_7823 | 281 |
| 272 | 3300048904 | Ga0496101_0003789 | Ga0496101_0003789_130_984 | 281 |
| 273 | 3300048905 | Ga0496102_0430990 | Ga0496102_0430990_42_896 | 281 |
| 274 | 3300048909 | Ga0496106_0002620 | Ga0496106_0002620_4476_5330 | 281 |
| 275 | 3300048919 | Ga0496116_0152467 | Ga0496116_0152467_292_1146 | 281 |
| 276 | 3300048920 | Ga0496117_0032884 | Ga0496117_0032884_2572_3417 | 281 |
| 277 | 3300048921 | Ga0496118_0000749 | Ga0496118_0000749_42515_43360 | 281 |
| 278 | 3300048921 | Ga0496118_0002232 | Ga0496118_0002232_72_923 | 281 |
| 279 | 3300048921 | Ga0496118_0003119 | Ga0496118_0003119_6027_6902 | 281 |
| 280 | 3300048922 | Ga0496119_0016565 | Ga0496119_0016565_775_1629 | 281 |
| 281 | 3300048923 | Ga0496120_0132024 | Ga0496120_0132024_228_1082 | 281 |
| 282 | 3300048924 | Ga0496121_0000210 | Ga0496121_0000210_21568_22413 | 281 |
| 283 | 3300048924 | Ga0496121_0001261 | Ga0496121_0001261_12132_12986 | 281 |
| 284 | 3300048924 | Ga0496121_0005273 | Ga0496121_0005273_15689_16543 | 281 |
| 285 | 3300048924 | Ga0496121_0206750 | Ga0496121_0206750_251_1126 | 281 |
| 286 | 3300048925 | Ga0496122_0035515 | Ga0496122_0035515_595_1440 | 281 |
| 287 | 3300048925 | Ga0496122_0232471 | Ga0496122_0232471_119_964 | 281 |
| 288 | 3300048926 | Ga0496123_0003676 | Ga0496123_0003676_8347_9201 | 281 |
| 289 | 3300048926 | Ga0496123_0050420 | Ga0496123_0050420_1782_2627 | 281 |
| 290 | 3300048926 | Ga0496123_0119485 | Ga0496123_0119485_307_1152 | 281 |
| 291 | 3300048927 | Ga0496124_0002009 | Ga0496124_0002009_1243_2097 | 281 |
| 292 | 3300048927 | Ga0496124_0002041 | Ga0496124_0002041_25346_26200 | 281 |
| 293 | 3300048929 | Ga0496126_0034876 | Ga0496126_0034876_2694_3539 | 281 |
| 294 | 3300049459 | Ga0495678_000207 | Ga0495678_000207_37493_38347 | 281 |
| 295 | 3300049460 | Ga0495682_0002794 | Ga0495682_0002794_2311_3165 | 281 |
| 296 | 3300049460 | Ga0495682_0010089 | Ga0495682_0010089_2420_3274 | 281 |
| 297 | 3300049568 | Ga0501031_0008125 | Ga0501031_0008125_5424_6290 | 281 |
| 298 | 3300049568 | Ga0501031_0019414 | Ga0501031_0019414_74_934 | 281 |
| 299 | 3300049569 | Ga0501032_0053459 | Ga0501032_0053459_123_983 | 281 |
| 300 | 3300049570 | Ga0501033_0001525 | Ga0501033_0001525_13214_14080 | 281 |
| 301 | 3300049570 | Ga0501033_0002150 | Ga0501033_0002150_3340_4200 | 281 |
| 302 | 3300049571 | Ga0501034_0002351 | Ga0501034_0002351_9349_10215 | 281 |
| 303 | 3300049571 | Ga0501034_0350147 | Ga0501034_0350147_471_1331 | 281 |
| 304 | 3300049572 | Ga0501036_0003706 | Ga0501036_0003706_8934_9800 | 281 |
| 305 | 3300049572 | Ga0501036_0021696 | Ga0501036_0021696_2011_2871 | 281 |
| 306 | 3300049573 | Ga0501037_0000336 | Ga0501037_0000336_21490_22356 | 281 |
| 307 | 3300049573 | Ga0501037_0032458 | Ga0501037_0032458_2290_3150 | 281 |
| 308 | 3300049574 | Ga0501038_0006022 | Ga0501038_0006022_7864_8730 | 281 |
| 309 | 3300049574 | Ga0501038_0020596 | Ga0501038_0020596_1814_2674 | 281 |
| 310 | 3300049575 | Ga0501039_0030654 | Ga0501039_0030654_265_1125 | 281 |
| 311 | 3300049575 | Ga0501039_0062081 | Ga0501039_0062081_33_899 | 281 |
| 312 | 3300049579 | Ga0501043_0006855 | Ga0501043_0006855_6389_7255 | 281 |
| 313 | 3300049579 | Ga0501043_0157415 | Ga0501043_0157415_18_878 | 281 |
| 314 | 3300049580 | Ga0501046_0000908 | Ga0501046_0000908_1855_2721 | 281 |
| 315 | 3300049580 | Ga0501046_0013023 | Ga0501046_0013023_265_1125 | 281 |
| 316 | 3300049581 | Ga0501047_0009431 | Ga0501047_0009431_6517_7383 | 281 |
| 317 | 3300049581 | Ga0501047_0336889 | Ga0501047_0336889_363_1223 | 281 |
| 318 | 3300049582 | Ga0501048_0044183 | Ga0501048_0044183_439_1305 | 281 |
| 319 | 3300049585 | Ga0501069_0023080 | Ga0501069_0023080_532_1392 | 281 |
| 320 | 3300049586 | Ga0501070_0186585 | Ga0501070_0186585_75_935 | 281 |
| 321 | 3300049587 | Ga0501071_0130509 | Ga0501071_0130509_492_1352 | 281 |
| 322 | 3300049589 | Ga0501073_0036781 | Ga0501073_0036781_2006_2872 | 281 |
| 323 | 3300049590 | Ga0501074_0046942 | Ga0501074_0046942_949_1809 | 281 |
| 324 | 3300049741 | Ga0501079_0030908 | Ga0501079_0030908_144_1004 | 281 |
| 325 | 3300049742 | Ga0501080_0020021 | Ga0501080_0020021_205_1065 | 281 |
| 326 | 3300049742 | Ga0501080_0073038 | Ga0501080_0073038_1112_1978 | 281 |
| 327 | 3300049822 | Ga0501035_0008886 | Ga0501035_0008886_1968_2834 | 281 |
| 328 | 3300049822 | Ga0501035_0029081 | Ga0501035_0029081_3499_4359 | 281 |
| 329 | 3300049823 | Ga0501044_0002330 | Ga0501044_0002330_12634_13500 | 281 |
| 330 | 3300049823 | Ga0501044_0159731 | Ga0501044_0159731_825_1685 | 281 |
| 331 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_1245327_1246181 | 281 |
| 332 | 3300053093 | Ga0500651_0002382 | Ga0500651_0002382_3010_3867 | 281 |
| 333 | 3300053103 | Ga0500555_000077 | Ga0500555_000077_19962_20816 | 281 |
| 334 | 3300053160 | Ga0500633_0008583 | Ga0500633_0008583_642_1496 | 281 |
| 335 | 3300060353 | Ga0501082_0027866 | Ga0501082_0027866_489_1349 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cnz-assembly2.cif.gz_G | crystal structure of 10pe bound psd from e. coli (2.70 a) | 0.9614 | 8 | 246 |
| 7cnx-assembly2.cif.gz_E | crystal structure of apo psd from e. coli (2.63 a) | 0.9556 | 7 | 246 |
| 7cnz-assembly2.cif.gz_G | crystal structure of 10pe bound psd from e. coli (2.70 a) | 0.931 | 8 | 246 |
| 7cnx-assembly2.cif.gz_E | crystal structure of apo psd from e. coli (2.63 a) | 0.9184 | 7 | 246 |
| 7utd-assembly1.cif.gz_A | the 2.19-angstrom cryoem structure of the [nife]-hydrogenase huc from mycobacterium smegmatis - complex minus stalk | 0.6361 | 179 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9642 | 61 | 275 | 2.70.70.10 |
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9262 | 61 | 275 | 2.70.70.10 |
| af_Q54CR2_119_353_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9135 | 62 | 275 | 2.70.70.10 |
| af_C7FZZ8_173_397_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9127 | 62 | 275 | 2.70.70.10 |
| af_A1A5T2_181_425_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9011 | 62 | 275 | 2.70.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M0FAF4-F1-model_v4 | deleted | 0.9911 | 1 | 280 |
|
| AF-A0A0R0DQG4-F1-model_v4 | deleted | 0.9906 | 81 | 277 |
|
| AF-A0A091B9H1-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9875 | 1 | 277 |
GO:0004609
GO:0005886 GO:0006646 |
| AF-A0A6N1YAJ3-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9851 | 6 | 277 |
GO:0004609
GO:0005886 GO:0006646 |
| AF-A0A3M0FAF4-F1-model_v4 | deleted | 0.9841 | 1 | 280 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar