F412081

General Info

Members Datasets Scaffolds Average Seq Length
335 210 322 284

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10106748|Ga0070658_101067482
Length 291
Sequence MRASLPSPSILLQYALPHRLLSRIVYWATRWTWRPWKNFLIRHVVKSYAVDMAQAAEPDAFAYASFNAFFTRALRAGARVAPADALAVACPADGRVSQLGAIESNGSDGGRIVQAKGQDFSVAELLADDAEAAKYAHGQFITVYLSPRDYHRVHAPLSGTLRETLHIPGRLFSVAPAAVAHVPRLFARNERLVCHFDGAHGPFAVILVGAMLVSGVETVWSGVEIPPYASAIQRKDWRSKNVRLERFDELGRFNMGSTVIVLLPAGSAALDVNLKSEDFVQVGQEIGRFIS

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
4 2734482264 Dyella sp. AD052 Isolate Unclassified
5 2738543009 Luteibacter sp. OK325 Isolate Unclassified
6 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
7 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
8 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
9 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
10 2919085039 Luteibacter sp. 1214 Isolate Unclassified
11 2919404418 Luteibacter sp. 3190 Isolate Unclassified
12 2941471342 Luteibacter sp. 621 Isolate Unclassified
13 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0.6
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0
Rhizoplane 2.69
Rhizosphere 82.09
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002124 3300001904 Bacteria 3519
2 JGI24738J21930_10004508 3300002075 Bacteria 3404
3 JGI25162J39368_1005567 3300002737 Bacteria 2413
4 Ga0006562J51391_1044937 3300003578 Bacteria 5090
5 Ga0006562J51391_1044938 3300003578 Bacteria 3850
6 Ga0055533_1008474 3300003756 Bacteria 1299
7 Ga0055543_1006859 3300004625 Bacteria 2702
8 Ga0065165_1000118 3300005262 Bacteria 134488
9 Ga0070658_10072510 3300005327 Bacteria 2822
10 Ga0070658_10106748 3300005327 Bacteria 2317
11 Ga0070676_10057237 3300005328 Bacteria 2307
12 Ga0068869_100037777 3300005334 Bacteria 3435
13 Ga0068869_100098677 3300005334 Bacteria 2207
14 Ga0070666_10002860 3300005335 Bacteria 10423
15 Ga0070660_100198892 3300005339 Bacteria 1625
16 Ga0070660_100305405 3300005339 Bacteria 1305
17 Ga0070661_100013309 3300005344 Bacteria 5775
18 Ga0070661_100127591 3300005344 Bacteria 1909
19 Ga0070671_100437729 3300005355 Bacteria 1121
20 Ga0070673_100147659 3300005364 Bacteria 1989
21 Ga0070659_100032894 3300005366 Bacteria 4026
22 Ga0070667_100029138 3300005367 Bacteria 4597
23 Ga0070667_100029340 3300005367 Bacteria 4582
24 Ga0070667_100114606 3300005367 Bacteria 2340
25 Ga0070709_10036319 3300005434 Bacteria 3001
26 Ga0070708_100001161 3300005445 Bacteria 20274
27 Ga0070663_100055132 3300005455 Bacteria 2844
28 Ga0070663_100063104 3300005455 Bacteria 2674
29 Ga0070662_100070389 3300005457 Bacteria 2577
30 Ga0070685_10172989 3300005466 Bacteria 1385
31 Ga0070706_100000505 3300005467 Bacteria 45815
32 Ga0070707_100009576 3300005468 Bacteria 8999
33 Ga0070698_100115332 3300005471 Bacteria 2651
34 Ga0070699_100005779 3300005518 Bacteria 10820
35 Ga0070679_100388130 3300005530 Bacteria 1343
36 Ga0070684_100311074 3300005535 Bacteria 1446
37 Ga0068853_100000094 3300005539 Bacteria 60921
38 Ga0068853_100091303 3300005539 Bacteria 2678
39 Ga0068853_100171262 3300005539 Bacteria 1964
40 Ga0070665_100000077 3300005548 Bacteria 188308
41 Ga0070665_100008335 3300005548 Bacteria 10483
42 Ga0070665_100086173 3300005548 Bacteria 3146
43 Ga0068855_100041569 3300005563 Bacteria 5448
44 Ga0070664_100045831 3300005564 Bacteria 3692
45 Ga0068857_100035689 3300005577 Bacteria 4404
46 Ga0068857_100060060 3300005577 Bacteria 3378
47 Ga0068854_100174443 3300005578 Bacteria 1675
48 Ga0068854_100239586 3300005578 Bacteria 1444
49 Ga0068856_100099825 3300005614 Bacteria 2894
50 Ga0068856_100120882 3300005614 Bacteria 2620
51 Ga0068856_100430994 3300005614 Bacteria 1339
52 Ga0068852_100136727 3300005616 Bacteria 2263
53 Ga0068859_100001643 3300005617 Bacteria 22816
54 Ga0068864_100144111 3300005618 Bacteria 2152
55 Ga0068851_10012343 3300005834 Bacteria 4025
56 Ga0068851_10080103 3300005834 Bacteria 1704
57 Ga0068863_100002896 3300005841 Bacteria 17005
58 Ga0068863_100161401 3300005841 Bacteria 2147
59 Ga0068858_100036717 3300005842 Bacteria 4543
60 Ga0068862_100000453 3300005844 Bacteria 44400
61 Ga0081540_1010601 3300005983 Bacteria 6223
62 Ga0068871_100291024 3300006358 Bacteria 1431
63 Ga0097620_100001643 3300006931 Bacteria 22816
64 Ga0099794_10000121 3300007265 Bacteria 28467
65 Ga0105240_10003874 3300009093 Bacteria 23103
66 Ga0105240_10053682 3300009093 Bacteria 5057
67 Ga0105240_10148007 3300009093 Bacteria 2800
68 Ga0105245_10074350 3300009098 Bacteria 3092
69 Ga0105245_10245219 3300009098 Bacteria 1739
70 Ga0105247_10013414 3300009101 Bacteria 4914
71 Ga0105241_10003925 3300009174 Bacteria 11013
72 Ga0105241_10024856 3300009174 Bacteria 4450
73 Ga0105241_10069399 3300009174 Bacteria 2733
74 Ga0105241_10158752 3300009174 Bacteria 1857
75 Ga0105248_10035775 3300009177 Bacteria 5555
76 Ga0105237_10037182 3300009545 Bacteria 4922
77 Ga0105237_10109957 3300009545 Bacteria 2748
78 Ga0105237_10157844 3300009545 Bacteria 2266
79 Ga0105237_10253449 3300009545 Bacteria 1762
80 Ga0105238_10017602 3300009551 Bacteria 7264
81 Ga0105249_10059016 3300009553 Bacteria 3518
82 Ga0105239_10002497 3300010375 Bacteria 23416
83 Ga0105239_10005331 3300010375 Bacteria 15084
84 Ga0105239_10010054 3300010375 Bacteria 10607
85 Ga0105239_10019395 3300010375 Bacteria 7509
86 Ga0105239_10169252 3300010375 Bacteria 2443
87 Ga0105239_10299125 3300010375 Bacteria 1812
88 Ga0157373_10022734 3300013100 Bacteria 4547
89 Ga0157370_10000033 3300013104 Bacteria 138137
90 Ga0157370_10208598 3300013104 Bacteria 1811
91 Ga0157369_10000107 3300013105 Bacteria 117307
92 Ga0157369_10001162 3300013105 Bacteria 32848
93 Ga0157369_10013887 3300013105 Bacteria 9099
94 Ga0157374_10149526 3300013296 Bacteria 2270
95 Ga0157378_10000130 3300013297 Bacteria 72949
96 Ga0157372_10013923 3300013307 Bacteria 8594
97 Ga0157372_10168587 3300013307 Bacteria 2533
98 Ga0157372_10408967 3300013307 Bacteria 1581
99 Ga0163163_10000168 3300014325 Bacteria 68808
100 Ga0163163_10265638 3300014325 Bacteria 1767
101 Ga0182008_10018884 3300014497 Bacteria 3565
102 Ga0182008_10047342 3300014497 Bacteria 2136
103 Ga0157379_10100575 3300014968 Bacteria 2595
104 Ga0157379_10346212 3300014968 Bacteria 1360
105 Ga0157376_10096261 3300014969 Bacteria 2576
106 Ga0182006_1000027 3300015261 Bacteria 252946
107 Ga0182006_1000594 3300015261 Bacteria 26468
108 Ga0182007_10004103 3300015262 Bacteria 6700
109 Ga0182005_1000054 3300015265 Bacteria 112885
110 Ga0182005_1001774 3300015265 Bacteria 8305
111 Ga0182005_1003986 3300015265 Bacteria 4868
112 Ga0209674_100559 3300025226 Bacteria 14723
113 Ga0209147_105205 3300025229 Bacteria 1988
114 Ga0209437_101329 3300025233 Bacteria 6485
115 Ga0209148_1000843 3300025254 Bacteria 21760
116 Ga0209129_1001177 3300025258 Bacteria 15055
117 Ga0209758_1010423 3300025297 Bacteria 5563
118 Ga0209256_1023206 3300025299 Bacteria 1856
119 Ga0209051_1012258 3300025303 Bacteria 4157
120 Ga0209051_1012929 3300025303 Bacteria 4004
121 Ga0207656_10028570 3300025321 Bacteria 2290
122 Ga0207656_10093867 3300025321 Bacteria 1366
123 Ga0207680_10002020 3300025903 Bacteria 9512
124 Ga0207680_10168102 3300025903 Bacteria 1475
125 Ga0207647_10000221 3300025904 Bacteria 46891
126 Ga0207645_10065630 3300025907 Bacteria 2320
127 Ga0207684_10000062 3300025910 Bacteria 202863
128 Ga0207654_10000072 3300025911 Bacteria 66188
129 Ga0207707_10176145 3300025912 Bacteria 1868
130 Ga0207695_10001009 3300025913 Bacteria 49724
131 Ga0207695_10020104 3300025913 Bacteria 7660
132 Ga0207671_10023827 3300025914 Bacteria 4612
133 Ga0207671_10216769 3300025914 Bacteria 1498
134 Ga0207671_10409429 3300025914 Bacteria 1079
135 Ga0207657_10001113 3300025919 Bacteria 28509
136 Ga0207649_10003854 3300025920 Bacteria 8178
137 Ga0207646_10024748 3300025922 Bacteria 5495
138 Ga0207644_10325859 3300025931 Bacteria 1243
139 Ga0207704_10106448 3300025938 Bacteria 1884
140 Ga0207691_10041677 3300025940 Bacteria 4237
141 Ga0207711_10020414 3300025941 Bacteria 5523
142 Ga0207689_10043186 3300025942 Bacteria 3726
143 Ga0207667_10002516 3300025949 Bacteria 22863
144 Ga0207667_10015232 3300025949 Bacteria 8743
145 Ga0207667_10050445 3300025949 Bacteria 4390
146 Ga0207640_10019112 3300025981 Bacteria 4041
147 Ga0207640_10206679 3300025981 Bacteria 1492
148 Ga0207658_10037140 3300025986 Bacteria 3497
149 Ga0207658_10095779 3300025986 Bacteria 2313
150 Ga0207703_10054296 3300026035 Bacteria 3258
151 Ga0207639_10000722 3300026041 Bacteria 22566
152 Ga0207639_10008263 3300026041 Bacteria 7131
153 Ga0207639_10083068 3300026041 Bacteria 2541
154 Ga0207678_10051667 3300026067 Bacteria 3548
155 Ga0207678_10120908 3300026067 Bacteria 2235
156 Ga0207702_10024342 3300026078 Bacteria 5023
157 Ga0207641_10011821 3300026088 Bacteria 7163
158 Ga0207641_10608381 3300026088 Bacteria 1071
159 Ga0207676_10026841 3300026095 Bacteria 4284
160 Ga0207674_10023124 3300026116 Bacteria 6664
161 Ga0207674_10023495 3300026116 Bacteria 6602
162 Ga0207674_10047606 3300026116 Bacteria 4394
163 Ga0207698_10048695 3300026142 Bacteria 3219
164 Ga0209588_1000004 3300027671 Bacteria 228800
165 Ga0268266_10000001 3300028379 Bacteria 4040580
166 Ga0268266_10100934 3300028379 Bacteria 2543
167 Ga0268265_10000431 3300028380 Bacteria 44419
168 Ga0268264_10055359 3300028381 Bacteria 3314
169 Ga0307509_10230993 3300031507 Bacteria 1653
170 Ga0307508_10181993 3300031616 Bacteria 1704
171 Ga0307412_10001314 3300031911 Bacteria 13918
172 Ga0439436_0000010 3300041404 Bacteria 104480
173 Ga0451791_0806195 3300041451 Bacteria 2593
174 Ga0451791_1639907 3300041451 Bacteria 1891
175 Ga0451797_0083339 3300041453 Bacteria 1969
176 Ga0451807_0536136 3300041486 Bacteria 3959
177 Ga0451807_1517285 3300041486 Bacteria 2249
178 Ga0439445_0030127 3300042004 Bacteria 1405
179 Ga0450908_000074 3300042184 Bacteria 19802
180 Ga0466972_0002304 3300044658 Bacteria 9392
181 Ga0466982_0000048 3300044672 Bacteria 37037
182 Ga0453684_0000672 3300044712 Bacteria 122591
183 Ga0466970_0002763 3300044765 Bacteria 8470
184 Ga0451576_0000268 3300045051 Bacteria 127422
185 Ga0495617_000113 3300046452 Bacteria 56843
186 Ga0495617_000203 3300046452 Bacteria 37588
187 Ga0495638_0000522 3300046460 Bacteria 44904
188 Ga0495638_0045660 3300046460 Bacteria 2755
189 Ga0495650_0004556 3300046471 Bacteria 9459
190 Ga0495650_0046774 3300046471 Bacteria 1814
191 Ga0495584_0000769 3300046491 Bacteria 21244
192 Ga0495584_0069858 3300046491 Bacteria 1765
193 Ga0495585_0000019 3300046492 Bacteria 156966
194 Ga0495585_0001923 3300046492 Bacteria 15545
195 Ga0495607_0000019 3300046501 Bacteria 167319
196 Ga0495607_0000538 3300046501 Bacteria 37198
197 Ga0495606_0000181 3300046507 Bacteria 111247
198 Ga0495606_0007303 3300046507 Bacteria 9950
199 Ga0495606_0007724 3300046507 Bacteria 9525
200 Ga0495610_0001640 3300046512 Bacteria 19663
201 Ga0495616_0000047 3300046513 Bacteria 110592
202 Ga0495616_0001193 3300046513 Bacteria 18315
203 Ga0495620_0000524 3300046515 Bacteria 24699
204 Ga0495620_0004114 3300046515 Bacteria 8252
205 Ga0495631_0000184 3300046518 Bacteria 42706
206 Ga0495631_0000929 3300046518 Bacteria 18225
207 Ga0495632_0000080 3300046519 Bacteria 99523
208 Ga0495632_0006767 3300046519 Bacteria 7323
209 Ga0495632_0017694 3300046519 Bacteria 3928
210 Ga0495632_0208952 3300046519 Bacteria 886
211 Ga0495637_0056957 3300046520 Bacteria 1616
212 Ga0495643_0033272 3300046522 Bacteria 2854
213 Ga0495648_0000424 3300046524 Bacteria 46425
214 Ga0495648_0014506 3300046524 Bacteria 5765
215 Ga0495668_0008627 3300046616 Bacteria 6337
216 Ga0495611_0000001 3300046648 Bacteria 2628469
217 Ga0495611_0000103 3300046648 Bacteria 58463
218 Ga0495625_0000001 3300046660 Bacteria 1641829
219 Ga0495625_0017931 3300046660 Bacteria 5533
220 Ga0495625_0019904 3300046660 Bacteria 5193
221 Ga0495661_0000396 3300046665 Bacteria 46420
222 Ga0495670_0001939 3300046691 Bacteria 10200
223 Ga0495670_0002433 3300046691 Bacteria 9195
224 Ga0495671_0001113 3300046692 Bacteria 18576
225 Ga0495649_0046089 3300046694 Bacteria 2375
226 Ga0495589_0000272 3300046794 Bacteria 42126
227 Ga0495660_0000415 3300046810 Bacteria 36278
228 Ga0495660_0000466 3300046810 Bacteria 33526
229 Ga0495683_0001307 3300047323 Bacteria 16716
230 Ga0495679_000001 3300047446 Bacteria 1607568
231 Ga0495673_0000001 3300047469 Bacteria 1630730
232 Ga0495673_0000464 3300047469 Bacteria 44038
233 Ga0495673_0000937 3300047469 Bacteria 26461
234 Ga0495686_0000085 3300047472 Bacteria 198128
235 Ga0495686_0000255 3300047472 Bacteria 95600
236 Ga0495686_0006213 3300047472 Bacteria 9210
237 Ga0495686_0006900 3300047472 Bacteria 8596
238 Ga0495686_0077302 3300047472 Bacteria 2038
239 Ga0496100_0000244 3300048903 Bacteria 28418
240 Ga0496101_0003789 3300048904 Bacteria 9448
241 Ga0496102_0430990 3300048905 Bacteria 1238
242 Ga0496106_0002620 3300048909 Bacteria 13386
243 Ga0496116_0152467 3300048919 Bacteria 1281
244 Ga0496117_0032884 3300048920 Bacteria 3932
245 Ga0496118_0000749 3300048921 Bacteria 52548
246 Ga0496118_0002232 3300048921 Bacteria 26711
247 Ga0496118_0003119 3300048921 Bacteria 21231
248 Ga0496119_0016565 3300048922 Bacteria 5600
249 Ga0496120_0132024 3300048923 Bacteria 1278
250 Ga0496121_0000210 3300048924 Bacteria 128287
251 Ga0496121_0001261 3300048924 Bacteria 43799
252 Ga0496121_0005273 3300048924 Bacteria 16676
253 Ga0496121_0206750 3300048924 Bacteria 1394
254 Ga0496122_0035515 3300048925 Bacteria 4052
255 Ga0496122_0232471 3300048925 Bacteria 1047
256 Ga0496123_0003676 3300048926 Bacteria 16915
257 Ga0496123_0050420 3300048926 Bacteria 2781
258 Ga0496123_0119485 3300048926 Bacteria 1486
259 Ga0496124_0002009 3300048927 Bacteria 27702
260 Ga0496124_0002041 3300048927 Bacteria 27442
261 Ga0496126_0034876 3300048929 Bacteria 4720
262 Ga0495678_000207 3300049459 Bacteria 68441
263 Ga0495682_0002794 3300049460 Bacteria 8063
264 Ga0495682_0010089 3300049460 Bacteria 3666
265 Ga0501031_0008125 3300049568 Bacteria 6834
266 Ga0501031_0019414 3300049568 Bacteria 4429
267 Ga0501032_0028649 3300049569 Bacteria 3826
268 Ga0501032_0053459 3300049569 Bacteria 2719
269 Ga0501033_0001525 3300049570 Bacteria 20468
270 Ga0501033_0002150 3300049570 Bacteria 17042
271 Ga0501034_0002351 3300049571 Bacteria 23045
272 Ga0501034_0003794 3300049571 Bacteria 17052
273 Ga0501034_0350147 3300049571 Bacteria 1405
274 Ga0501036_0003706 3300049572 Bacteria 12246
275 Ga0501036_0021696 3300049572 Bacteria 5398
276 Ga0501036_0122592 3300049572 Bacteria 2195
277 Ga0501037_0000336 3300049573 Bacteria 39761
278 Ga0501037_0026462 3300049573 Bacteria 4289
279 Ga0501037_0032458 3300049573 Bacteria 3856
280 Ga0501038_0006022 3300049574 Bacteria 11222
281 Ga0501038_0020596 3300049574 Bacteria 5927
282 Ga0501038_0118095 3300049574 Bacteria 2190
283 Ga0501039_0030654 3300049575 Bacteria 4147
284 Ga0501039_0062081 3300049575 Bacteria 2895
285 Ga0501043_0006855 3300049579 Bacteria 9094
286 Ga0501043_0139992 3300049579 Bacteria 1895
287 Ga0501043_0157415 3300049579 Bacteria 1776
288 Ga0501046_0000908 3300049580 Bacteria 28913
289 Ga0501046_0013023 3300049580 Bacteria 7057
290 Ga0501047_0004939 3300049581 Bacteria 12520
291 Ga0501047_0009431 3300049581 Bacteria 9222
292 Ga0501047_0336889 3300049581 Bacteria 1346
293 Ga0501048_0044183 3300049582 Bacteria 3187
294 Ga0501067_0000630 3300049583 Bacteria 18924
295 Ga0501068_0055468 3300049584 Bacteria 2401
296 Ga0501069_0001151 3300049585 Bacteria 12806
297 Ga0501069_0023080 3300049585 Bacteria 3389
298 Ga0501069_0030478 3300049585 Bacteria 2962
299 Ga0501070_0020295 3300049586 Bacteria 5574
300 Ga0501070_0186585 3300049586 Bacteria 1705
301 Ga0501071_0130509 3300049587 Bacteria 1866
302 Ga0501072_0022095 3300049588 Bacteria 4935
303 Ga0501073_0001086 3300049589 Bacteria 19668
304 Ga0501073_0036781 3300049589 Bacteria 3477
305 Ga0501074_0046942 3300049590 Bacteria 3122
306 Ga0501079_0022694 3300049741 Bacteria 4815
307 Ga0501079_0030908 3300049741 Bacteria 4115
308 Ga0501080_0020021 3300049742 Bacteria 6193
309 Ga0501080_0037138 3300049742 Bacteria 4548
310 Ga0501080_0073038 3300049742 Bacteria 3191
311 Ga0501083_0001373 3300049744 Bacteria 16526
312 Ga0501035_0008886 3300049822 Bacteria 9350
313 Ga0501035_0029081 3300049822 Bacteria 5039
314 Ga0501044_0002330 3300049823 Bacteria 21651
315 Ga0501044_0010585 3300049823 Bacteria 10005
316 Ga0501044_0159731 3300049823 Bacteria 2231
317 Ga0500643_000002 3300053087 Bacteria 1277657
318 Ga0500651_0002382 3300053093 Bacteria 9897
319 Ga0500555_000077 3300053103 Bacteria 46807
320 Ga0500633_0008583 3300053160 Bacteria 2643
321 Ga0501084_0246197 3300054114 Bacteria 1509
322 Ga0501082_0027866 3300060353 Bacteria 4865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0001151 Ga0501069_0001151_2712_3545 256
2 3300006358 Ga0068871_100291024 Ga0068871_1002910241 263
3 3300044658 Ga0466972_0002304 Ga0466972_0002304_2575_3438 265
4 3300044765 Ga0466970_0002763 Ga0466970_0002763_5778_6641 265
5 3300025940 Ga0207691_10041677 Ga0207691_100416774 269
6 3300005617 Ga0068859_100001643 Ga0068859_10000164319 273
7 3300005834 Ga0068851_10080103 Ga0068851_100801032 273
8 3300005841 Ga0068863_100161401 Ga0068863_1001614013 273
9 3300006931 Ga0097620_100001643 Ga0097620_10000164319 273
10 3300009545 Ga0105237_10157844 Ga0105237_101578443 273
11 3300025321 Ga0207656_10093867 Ga0207656_100938672 273
12 3300025914 Ga0207671_10409429 Ga0207671_104094292 273
13 3300028381 Ga0268264_10055359 Ga0268264_100553593 273
14 3300005548 Ga0070665_100086173 Ga0070665_1000861733 274
15 3300005844 Ga0068862_100000453 Ga0068862_10000045311 274
16 3300014968 Ga0157379_10346212 Ga0157379_103462122 274
17 3300028380 Ga0268265_10000431 Ga0268265_1000043111 274
18 3300005445 Ga0070708_100001161 Ga0070708_1000011613 275
19 3300005467 Ga0070706_100000505 Ga0070706_10000050517 275
20 3300005468 Ga0070707_100009576 Ga0070707_1000095764 275
21 3300005471 Ga0070698_100115332 Ga0070698_1001153322 275
22 3300005518 Ga0070699_100005779 Ga0070699_10000577910 275
23 3300007265 Ga0099794_10000121 Ga0099794_1000012122 275
24 3300025910 Ga0207684_10000062 Ga0207684_1000006290 275
25 3300025922 Ga0207646_10024748 Ga0207646_100247485 275
26 3300027671 Ga0209588_1000004 Ga0209588_100000412 275
27 3300041486 Ga0451807_0536136 Ga0451807_0536136_506_1342 276
28 3300044712 Ga0453684_0000672 Ga0453684_0000672_9738_10577 277
29 3300045051 Ga0451576_0000268 Ga0451576_0000268_14568_15407 277
30 iso_pu_bacteria 2593339238 2595445729 277
31 iso_pu_bacteria 2593339239 2595449422 277
32 iso_pu_bacteria 2718218334 2721027968 277
33 iso_pu_bacteria 2734482264 2735836463 277
34 iso_pu_bacteria 2738543009 2739227440 277
35 iso_pu_bacteria 2842914999 2842915580 277
36 iso_pu_bacteria 2842918807 2842919594 277
37 iso_pu_bacteria 2884338543 2884340106 277
38 iso_pu_bacteria 2904463128 2904463764 277
39 iso_pu_bacteria 2919085039 2919085806 277
40 iso_pu_bacteria 2919404418 2919405938 277
41 iso_pu_bacteria 2941471342 2941474591 277
42 iso_pu_bacteria 2953994433 2953997942 277
43 3300005334 Ga0068869_100037777 Ga0068869_1000377773 278
44 3300005335 Ga0070666_10002860 Ga0070666_100028607 278
45 3300005344 Ga0070661_100127591 Ga0070661_1001275912 278
46 3300005367 Ga0070667_100029138 Ga0070667_1000291384 278
47 3300005548 Ga0070665_100000077 Ga0070665_10000007722 278
48 3300009093 Ga0105240_10003874 Ga0105240_100038746 278
49 3300009098 Ga0105245_10245219 Ga0105245_102452191 278
50 3300009177 Ga0105248_10035775 Ga0105248_100357753 278
51 3300009545 Ga0105237_10109957 Ga0105237_101099573 278
52 3300010375 Ga0105239_10005331 Ga0105239_1000533113 278
53 3300013296 Ga0157374_10149526 Ga0157374_101495263 278
54 3300013297 Ga0157378_10000130 Ga0157378_1000013052 278
55 3300025903 Ga0207680_10002020 Ga0207680_100020205 278
56 3300025913 Ga0207695_10020104 Ga0207695_100201043 278
57 3300025941 Ga0207711_10020414 Ga0207711_100204144 278
58 3300025942 Ga0207689_10043186 Ga0207689_100431862 278
59 3300025986 Ga0207658_10037140 Ga0207658_100371402 278
60 3300026041 Ga0207639_10083068 Ga0207639_100830683 278
61 3300026095 Ga0207676_10026841 Ga0207676_100268414 278
62 3300028379 Ga0268266_10000001 Ga0268266_100000011432 278
63 3300031616 Ga0307508_10181993 Ga0307508_101819932 278
64 3300005327 Ga0070658_10072510 Ga0070658_100725103 279
65 3300005327 Ga0070658_10106748 Ga0070658_101067482 279
66 3300005339 Ga0070660_100198892 Ga0070660_1001988922 279
67 3300005339 Ga0070660_100305405 Ga0070660_1003054052 279
68 3300005344 Ga0070661_100013309 Ga0070661_1000133093 279
69 3300005355 Ga0070671_100437729 Ga0070671_1004377291 279
70 3300005366 Ga0070659_100032894 Ga0070659_1000328944 279
71 3300005367 Ga0070667_100029340 Ga0070667_1000293403 279
72 3300005455 Ga0070663_100055132 Ga0070663_1000551322 279
73 3300005457 Ga0070662_100070389 Ga0070662_1000703892 279
74 3300005530 Ga0070679_100388130 Ga0070679_1003881301 279
75 3300005535 Ga0070684_100311074 Ga0070684_1003110742 279
76 3300005539 Ga0068853_100091303 Ga0068853_1000913033 279
77 3300005563 Ga0068855_100041569 Ga0068855_1000415696 279
78 3300005564 Ga0070664_100045831 Ga0070664_1000458313 279
79 3300005577 Ga0068857_100035689 Ga0068857_1000356894 279
80 3300005578 Ga0068854_100174443 Ga0068854_1001744431 279
81 3300005578 Ga0068854_100239586 Ga0068854_1002395862 279
82 3300005614 Ga0068856_100099825 Ga0068856_1000998253 279
83 3300005614 Ga0068856_100120882 Ga0068856_1001208823 279
84 3300005616 Ga0068852_100136727 Ga0068852_1001367272 279
85 3300005834 Ga0068851_10012343 Ga0068851_100123434 279
86 3300005842 Ga0068858_100036717 Ga0068858_1000367173 279
87 3300009093 Ga0105240_10053682 Ga0105240_100536825 279
88 3300009093 Ga0105240_10148007 Ga0105240_101480073 279
89 3300009098 Ga0105245_10074350 Ga0105245_100743503 279
90 3300009174 Ga0105241_10003925 Ga0105241_100039252 279
91 3300009174 Ga0105241_10069399 Ga0105241_100693992 279
92 3300009551 Ga0105238_10017602 Ga0105238_100176026 279
93 3300010375 Ga0105239_10010054 Ga0105239_100100542 279
94 3300010375 Ga0105239_10299125 Ga0105239_102991253 279
95 3300013100 Ga0157373_10022734 Ga0157373_100227344 279
96 3300013104 Ga0157370_10208598 Ga0157370_102085982 279
97 3300013105 Ga0157369_10001162 Ga0157369_1000116225 279
98 3300013105 Ga0157369_10013887 Ga0157369_100138872 279
99 3300013307 Ga0157372_10013923 Ga0157372_100139237 279
100 3300013307 Ga0157372_10408967 Ga0157372_104089672 279
101 3300014325 Ga0163163_10000168 Ga0163163_1000016823 279
102 3300014969 Ga0157376_10096261 Ga0157376_100962613 279
103 3300025321 Ga0207656_10028570 Ga0207656_100285703 279
104 3300025903 Ga0207680_10168102 Ga0207680_101681021 279
105 3300025912 Ga0207707_10176145 Ga0207707_101761451 279
106 3300025913 Ga0207695_10001009 Ga0207695_1000100944 279
107 3300025914 Ga0207671_10023827 Ga0207671_100238272 279
108 3300025919 Ga0207657_10001113 Ga0207657_1000111312 279
109 3300025920 Ga0207649_10003854 Ga0207649_100038545 279
110 3300025949 Ga0207667_10015232 Ga0207667_100152323 279
111 3300025949 Ga0207667_10050445 Ga0207667_100504453 279
112 3300025981 Ga0207640_10019112 Ga0207640_100191121 279
113 3300025981 Ga0207640_10206679 Ga0207640_102066792 279
114 3300025986 Ga0207658_10095779 Ga0207658_100957793 279
115 3300026035 Ga0207703_10054296 Ga0207703_100542963 279
116 3300026067 Ga0207678_10051667 Ga0207678_100516673 279
117 3300026078 Ga0207702_10024342 Ga0207702_100243422 279
118 3300026116 Ga0207674_10023124 Ga0207674_100231246 279
119 3300026142 Ga0207698_10048695 Ga0207698_100486953 279
120 3300031507 Ga0307509_10230993 Ga0307509_102309933 279
121 3300041451 Ga0451791_0806195 Ga0451791_0806195_1576_2418 279
122 3300041451 Ga0451791_1639907 Ga0451791_1639907_683_1525 279
123 3300041453 Ga0451797_0083339 Ga0451797_0083339_893_1735 279
124 3300041486 Ga0451807_1517285 Ga0451807_1517285_1286_2128 279
125 3300049569 Ga0501032_0028649 Ga0501032_0028649_1984_2829 279
126 3300049571 Ga0501034_0003794 Ga0501034_0003794_6462_7307 279
127 3300049572 Ga0501036_0122592 Ga0501036_0122592_512_1357 279
128 3300049573 Ga0501037_0026462 Ga0501037_0026462_827_1672 279
129 3300049574 Ga0501038_0118095 Ga0501038_0118095_811_1656 279
130 3300049579 Ga0501043_0139992 Ga0501043_0139992_307_1152 279
131 3300049581 Ga0501047_0004939 Ga0501047_0004939_3494_4339 279
132 3300049583 Ga0501067_0000630 Ga0501067_0000630_205_1050 279
133 3300049584 Ga0501068_0055468 Ga0501068_0055468_709_1554 279
134 3300049585 Ga0501069_0030478 Ga0501069_0030478_745_1590 279
135 3300049586 Ga0501070_0020295 Ga0501070_0020295_1985_2830 279
136 3300049588 Ga0501072_0022095 Ga0501072_0022095_775_1620 279
137 3300049589 Ga0501073_0001086 Ga0501073_0001086_6389_7234 279
138 3300049741 Ga0501079_0022694 Ga0501079_0022694_827_1672 279
139 3300049742 Ga0501080_0037138 Ga0501080_0037138_3208_4053 279
140 3300049744 Ga0501083_0001373 Ga0501083_0001373_15236_16081 279
141 3300049823 Ga0501044_0010585 Ga0501044_0010585_7176_8021 279
142 3300054114 Ga0501084_0246197 Ga0501084_0246197_130_975 279
143 3300005455 Ga0070663_100063104 Ga0070663_1000631043 280
144 3300005539 Ga0068853_100000094 Ga0068853_1000000947 280
145 3300005548 Ga0070665_100008335 Ga0070665_1000083352 280
146 3300005841 Ga0068863_100002896 Ga0068863_1000028964 280
147 3300009545 Ga0105237_10037182 Ga0105237_100371823 280
148 3300009553 Ga0105249_10059016 Ga0105249_100590163 280
149 3300010375 Ga0105239_10002497 Ga0105239_1000249715 280
150 3300025949 Ga0207667_10002516 Ga0207667_1000251618 280
151 3300026041 Ga0207639_10000722 Ga0207639_1000072218 280
152 3300026067 Ga0207678_10120908 Ga0207678_101209082 280
153 3300026088 Ga0207641_10011821 Ga0207641_100118213 280
154 3300001904 JGI24736J21556_1002124 JGI24736J21556_10021241 281
155 3300002075 JGI24738J21930_10004508 JGI24738J21930_100045083 281
156 3300002737 JGI25162J39368_1005567 JGI25162J39368_10055672 281
157 3300003578 Ga0006562J51391_1044937 Ga0006562J51391_10449372 281
158 3300003578 Ga0006562J51391_1044938 Ga0006562J51391_10449383 281
159 3300003756 Ga0055533_1008474 Ga0055533_10084742 281
160 3300004625 Ga0055543_1006859 Ga0055543_10068593 281
161 3300005262 Ga0065165_1000118 Ga0065165_1000118103 281
162 3300005328 Ga0070676_10057237 Ga0070676_100572372 281
163 3300005334 Ga0068869_100098677 Ga0068869_1000986773 281
164 3300005364 Ga0070673_100147659 Ga0070673_1001476592 281
165 3300005367 Ga0070667_100114606 Ga0070667_1001146063 281
166 3300005434 Ga0070709_10036319 Ga0070709_100363193 281
167 3300005466 Ga0070685_10172989 Ga0070685_101729892 281
168 3300005539 Ga0068853_100171262 Ga0068853_1001712622 281
169 3300005577 Ga0068857_100060060 Ga0068857_1000600602 281
170 3300005614 Ga0068856_100430994 Ga0068856_1004309942 281
171 3300005618 Ga0068864_100144111 Ga0068864_1001441113 281
172 3300005983 Ga0081540_1010601 Ga0081540_10106013 281
173 3300009101 Ga0105247_10013414 Ga0105247_100134142 281
174 3300009174 Ga0105241_10024856 Ga0105241_100248565 281
175 3300009174 Ga0105241_10158752 Ga0105241_101587522 281
176 3300009545 Ga0105237_10253449 Ga0105237_102534492 281
177 3300010375 Ga0105239_10019395 Ga0105239_100193956 281
178 3300010375 Ga0105239_10169252 Ga0105239_101692522 281
179 3300013104 Ga0157370_10000033 Ga0157370_1000003352 281
180 3300013105 Ga0157369_10000107 Ga0157369_1000010771 281
181 3300013307 Ga0157372_10168587 Ga0157372_101685872 281
182 3300014325 Ga0163163_10265638 Ga0163163_102656382 281
183 3300014497 Ga0182008_10018884 Ga0182008_100188841 281
184 3300014497 Ga0182008_10047342 Ga0182008_100473423 281
185 3300014968 Ga0157379_10100575 Ga0157379_101005753 281
186 3300015261 Ga0182006_1000027 Ga0182006_100002758 281
187 3300015261 Ga0182006_1000594 Ga0182006_100059419 281
188 3300015262 Ga0182007_10004103 Ga0182007_100041035 281
189 3300015265 Ga0182005_1000054 Ga0182005_100005430 281
190 3300015265 Ga0182005_1001774 Ga0182005_10017744 281
191 3300015265 Ga0182005_1003986 Ga0182005_10039865 281
192 3300025226 Ga0209674_100559 Ga0209674_1005597 281
193 3300025229 Ga0209147_105205 Ga0209147_1052052 281
194 3300025233 Ga0209437_101329 Ga0209437_1013294 281
195 3300025254 Ga0209148_1000843 Ga0209148_10008438 281
196 3300025258 Ga0209129_1001177 Ga0209129_10011777 281
197 3300025297 Ga0209758_1010423 Ga0209758_10104232 281
198 3300025299 Ga0209256_1023206 Ga0209256_10232061 281
199 3300025303 Ga0209051_1012258 Ga0209051_10122583 281
200 3300025303 Ga0209051_1012929 Ga0209051_10129293 281
201 3300025904 Ga0207647_10000221 Ga0207647_1000022115 281
202 3300025907 Ga0207645_10065630 Ga0207645_100656301 281
203 3300025911 Ga0207654_10000072 Ga0207654_100000722 281
204 3300025914 Ga0207671_10216769 Ga0207671_102167692 281
205 3300025931 Ga0207644_10325859 Ga0207644_103258592 281
206 3300025938 Ga0207704_10106448 Ga0207704_101064483 281
207 3300026041 Ga0207639_10008263 Ga0207639_100082636 281
208 3300026088 Ga0207641_10608381 Ga0207641_106083811 281
209 3300026116 Ga0207674_10023495 Ga0207674_100234954 281
210 3300026116 Ga0207674_10047606 Ga0207674_100476062 281
211 3300028379 Ga0268266_10100934 Ga0268266_101009342 281
212 3300031911 Ga0307412_10001314 Ga0307412_100013149 281
213 3300041404 Ga0439436_0000010 Ga0439436_0000010_85433_86287 281
214 3300042004 Ga0439445_0030127 Ga0439445_0030127_432_1286 281
215 3300042184 Ga0450908_000074 Ga0450908_000074_6598_7452 281
216 3300044672 Ga0466982_0000048 Ga0466982_0000048_20889_21746 281
217 3300046452 Ga0495617_000113 Ga0495617_000113_27291_28145 281
218 3300046452 Ga0495617_000203 Ga0495617_000203_18104_18958 281
219 3300046460 Ga0495638_0000522 Ga0495638_0000522_4883_5737 281
220 3300046460 Ga0495638_0045660 Ga0495638_0045660_336_1190 281
221 3300046471 Ga0495650_0004556 Ga0495650_0004556_8122_8976 281
222 3300046471 Ga0495650_0046774 Ga0495650_0046774_53_907 281
223 3300046491 Ga0495584_0000769 Ga0495584_0000769_15475_16329 281
224 3300046491 Ga0495584_0069858 Ga0495584_0069858_232_1086 281
225 3300046492 Ga0495585_0000019 Ga0495585_0000019_94357_95211 281
226 3300046492 Ga0495585_0001923 Ga0495585_0001923_4767_5621 281
227 3300046501 Ga0495607_0000019 Ga0495607_0000019_136854_137708 281
228 3300046501 Ga0495607_0000538 Ga0495607_0000538_34092_34946 281
229 3300046507 Ga0495606_0000181 Ga0495606_0000181_95506_96360 281
230 3300046507 Ga0495606_0007303 Ga0495606_0007303_3717_4658 281
231 3300046507 Ga0495606_0007724 Ga0495606_0007724_484_1338 281
232 3300046512 Ga0495610_0001640 Ga0495610_0001640_333_1187 281
233 3300046513 Ga0495616_0000047 Ga0495616_0000047_55780_56634 281
234 3300046513 Ga0495616_0001193 Ga0495616_0001193_4076_4930 281
235 3300046515 Ga0495620_0000524 Ga0495620_0000524_23655_24509 281
236 3300046515 Ga0495620_0004114 Ga0495620_0004114_2201_3055 281
237 3300046518 Ga0495631_0000184 Ga0495631_0000184_29814_30668 281
238 3300046518 Ga0495631_0000929 Ga0495631_0000929_10879_11733 281
239 3300046519 Ga0495632_0000080 Ga0495632_0000080_32624_33478 281
240 3300046519 Ga0495632_0006767 Ga0495632_0006767_2503_3357 281
241 3300046519 Ga0495632_0017694 Ga0495632_0017694_1813_2667 281
242 3300046519 Ga0495632_0208952 Ga0495632_0208952_10_864 281
243 3300046520 Ga0495637_0056957 Ga0495637_0056957_153_1007 281
244 3300046522 Ga0495643_0033272 Ga0495643_0033272_1493_2347 281
245 3300046524 Ga0495648_0000424 Ga0495648_0000424_11530_12384 281
246 3300046524 Ga0495648_0014506 Ga0495648_0014506_4206_5060 281
247 3300046616 Ga0495668_0008627 Ga0495668_0008627_2891_3745 281
248 3300046648 Ga0495611_0000001 Ga0495611_0000001_578202_579056 281
249 3300046648 Ga0495611_0000103 Ga0495611_0000103_29824_30678 281
250 3300046660 Ga0495625_0000001 Ga0495625_0000001_1336991_1337845 281
251 3300046660 Ga0495625_0017931 Ga0495625_0017931_3430_4284 281
252 3300046660 Ga0495625_0019904 Ga0495625_0019904_329_1183 281
253 3300046665 Ga0495661_0000396 Ga0495661_0000396_28717_29571 281
254 3300046691 Ga0495670_0001939 Ga0495670_0001939_2394_3248 281
255 3300046691 Ga0495670_0002433 Ga0495670_0002433_5485_6339 281
256 3300046692 Ga0495671_0001113 Ga0495671_0001113_9559_10413 281
257 3300046694 Ga0495649_0046089 Ga0495649_0046089_1037_1894 281
258 3300046794 Ga0495589_0000272 Ga0495589_0000272_37804_38658 281
259 3300046810 Ga0495660_0000415 Ga0495660_0000415_11972_12826 281
260 3300046810 Ga0495660_0000466 Ga0495660_0000466_20740_21594 281
261 3300047323 Ga0495683_0001307 Ga0495683_0001307_3387_4241 281
262 3300047446 Ga0495679_000001 Ga0495679_000001_1009540_1010394 281
263 3300047469 Ga0495673_0000001 Ga0495673_0000001_1406378_1407232 281
264 3300047469 Ga0495673_0000464 Ga0495673_0000464_16989_17843 281
265 3300047469 Ga0495673_0000937 Ga0495673_0000937_12224_13078 281
266 3300047472 Ga0495686_0000085 Ga0495686_0000085_5714_6565 281
267 3300047472 Ga0495686_0000255 Ga0495686_0000255_15228_16082 281
268 3300047472 Ga0495686_0006213 Ga0495686_0006213_8166_9020 281
269 3300047472 Ga0495686_0006900 Ga0495686_0006900_5036_5890 281
270 3300047472 Ga0495686_0077302 Ga0495686_0077302_1060_1914 281
271 3300048903 Ga0496100_0000244 Ga0496100_0000244_6969_7823 281
272 3300048904 Ga0496101_0003789 Ga0496101_0003789_130_984 281
273 3300048905 Ga0496102_0430990 Ga0496102_0430990_42_896 281
274 3300048909 Ga0496106_0002620 Ga0496106_0002620_4476_5330 281
275 3300048919 Ga0496116_0152467 Ga0496116_0152467_292_1146 281
276 3300048920 Ga0496117_0032884 Ga0496117_0032884_2572_3417 281
277 3300048921 Ga0496118_0000749 Ga0496118_0000749_42515_43360 281
278 3300048921 Ga0496118_0002232 Ga0496118_0002232_72_923 281
279 3300048921 Ga0496118_0003119 Ga0496118_0003119_6027_6902 281
280 3300048922 Ga0496119_0016565 Ga0496119_0016565_775_1629 281
281 3300048923 Ga0496120_0132024 Ga0496120_0132024_228_1082 281
282 3300048924 Ga0496121_0000210 Ga0496121_0000210_21568_22413 281
283 3300048924 Ga0496121_0001261 Ga0496121_0001261_12132_12986 281
284 3300048924 Ga0496121_0005273 Ga0496121_0005273_15689_16543 281
285 3300048924 Ga0496121_0206750 Ga0496121_0206750_251_1126 281
286 3300048925 Ga0496122_0035515 Ga0496122_0035515_595_1440 281
287 3300048925 Ga0496122_0232471 Ga0496122_0232471_119_964 281
288 3300048926 Ga0496123_0003676 Ga0496123_0003676_8347_9201 281
289 3300048926 Ga0496123_0050420 Ga0496123_0050420_1782_2627 281
290 3300048926 Ga0496123_0119485 Ga0496123_0119485_307_1152 281
291 3300048927 Ga0496124_0002009 Ga0496124_0002009_1243_2097 281
292 3300048927 Ga0496124_0002041 Ga0496124_0002041_25346_26200 281
293 3300048929 Ga0496126_0034876 Ga0496126_0034876_2694_3539 281
294 3300049459 Ga0495678_000207 Ga0495678_000207_37493_38347 281
295 3300049460 Ga0495682_0002794 Ga0495682_0002794_2311_3165 281
296 3300049460 Ga0495682_0010089 Ga0495682_0010089_2420_3274 281
297 3300049568 Ga0501031_0008125 Ga0501031_0008125_5424_6290 281
298 3300049568 Ga0501031_0019414 Ga0501031_0019414_74_934 281
299 3300049569 Ga0501032_0053459 Ga0501032_0053459_123_983 281
300 3300049570 Ga0501033_0001525 Ga0501033_0001525_13214_14080 281
301 3300049570 Ga0501033_0002150 Ga0501033_0002150_3340_4200 281
302 3300049571 Ga0501034_0002351 Ga0501034_0002351_9349_10215 281
303 3300049571 Ga0501034_0350147 Ga0501034_0350147_471_1331 281
304 3300049572 Ga0501036_0003706 Ga0501036_0003706_8934_9800 281
305 3300049572 Ga0501036_0021696 Ga0501036_0021696_2011_2871 281
306 3300049573 Ga0501037_0000336 Ga0501037_0000336_21490_22356 281
307 3300049573 Ga0501037_0032458 Ga0501037_0032458_2290_3150 281
308 3300049574 Ga0501038_0006022 Ga0501038_0006022_7864_8730 281
309 3300049574 Ga0501038_0020596 Ga0501038_0020596_1814_2674 281
310 3300049575 Ga0501039_0030654 Ga0501039_0030654_265_1125 281
311 3300049575 Ga0501039_0062081 Ga0501039_0062081_33_899 281
312 3300049579 Ga0501043_0006855 Ga0501043_0006855_6389_7255 281
313 3300049579 Ga0501043_0157415 Ga0501043_0157415_18_878 281
314 3300049580 Ga0501046_0000908 Ga0501046_0000908_1855_2721 281
315 3300049580 Ga0501046_0013023 Ga0501046_0013023_265_1125 281
316 3300049581 Ga0501047_0009431 Ga0501047_0009431_6517_7383 281
317 3300049581 Ga0501047_0336889 Ga0501047_0336889_363_1223 281
318 3300049582 Ga0501048_0044183 Ga0501048_0044183_439_1305 281
319 3300049585 Ga0501069_0023080 Ga0501069_0023080_532_1392 281
320 3300049586 Ga0501070_0186585 Ga0501070_0186585_75_935 281
321 3300049587 Ga0501071_0130509 Ga0501071_0130509_492_1352 281
322 3300049589 Ga0501073_0036781 Ga0501073_0036781_2006_2872 281
323 3300049590 Ga0501074_0046942 Ga0501074_0046942_949_1809 281
324 3300049741 Ga0501079_0030908 Ga0501079_0030908_144_1004 281
325 3300049742 Ga0501080_0020021 Ga0501080_0020021_205_1065 281
326 3300049742 Ga0501080_0073038 Ga0501080_0073038_1112_1978 281
327 3300049822 Ga0501035_0008886 Ga0501035_0008886_1968_2834 281
328 3300049822 Ga0501035_0029081 Ga0501035_0029081_3499_4359 281
329 3300049823 Ga0501044_0002330 Ga0501044_0002330_12634_13500 281
330 3300049823 Ga0501044_0159731 Ga0501044_0159731_825_1685 281
331 3300053087 Ga0500643_000002 Ga0500643_000002_1245327_1246181 281
332 3300053093 Ga0500651_0002382 Ga0500651_0002382_3010_3867 281
333 3300053103 Ga0500555_000077 Ga0500555_000077_19962_20816 281
334 3300053160 Ga0500633_0008583 Ga0500633_0008583_642_1496 281
335 3300060353 Ga0501082_0027866 Ga0501082_0027866_489_1349 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

66

288

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.9614 8 246
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9556 7 246
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.931 8 246
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9184 7 246
7utd-assembly1.cif.gz_A the 2.19-angstrom cryoem structure of the [nife]-hydrogenase huc from mycobacterium smegmatis - complex minus stalk 0.6361 179 202
ID Description Score Start End Superfamily
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9642 61 275 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9262 61 275 2.70.70.10
af_Q54CR2_119_353_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9135 62 275 2.70.70.10
af_C7FZZ8_173_397_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9127 62 275 2.70.70.10
af_A1A5T2_181_425_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9011 62 275 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A3M0FAF4-F1-model_v4 deleted 0.9911 1 280
AF-A0A0R0DQG4-F1-model_v4 deleted 0.9906 81 277
AF-A0A091B9H1-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9875 1 277 GO:0004609
GO:0005886
GO:0006646
AF-A0A6N1YAJ3-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9851 6 277 GO:0004609
GO:0005886
GO:0006646
AF-A0A3M0FAF4-F1-model_v4 deleted 0.9841 1 280

Feature Viewer

pLDDT pTM Quality
90.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map