F412052

General Info

Members Datasets Scaffolds Average Seq Length
335 188 323 294

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10000030|JGI24739J22299_1000003035
Length 334
Sequence MYGKAKIRNSRSHCFPGSNCYFAIFTLYFLDNKSHYQMSNKNSRRDMIKKAAALAFASTTLSSLTNRVMAHEEAMDEKLKGNINHSVCAWCYNDIPLEDLCKAANKIGLASIDLLDPKDFATAKKYDLTCAMVASINKDWGITKGWNRVEHHDRLVEYYQYLIDETSKAGFPHLICFSGNREGLADELGLKNCAQGLQRIMGYAEKKNVTIVMELLNSKVNHHDYQCDHSAWGVELCKAIGSERFKLLYDIYHMQIMEGDVIRTIQENHPYFAHYHTGGVPGRNEIDETQELYYPAIMKAILETGFKGFVAQEFVPKRSDKLASLKQGVEICDI

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
7 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
160 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
166 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
167 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
168 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
169 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
172 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
188 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.9
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.52
Nodule 0
Rhizoplane 1.19
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005630 3300001979 Bacteria 5275
2 JGI24740J21852_10016155 3300001979 Unclassified 2704
3 JGI24739J22299_10000030 3300001989 Bacteria 39896
4 JGI24739J22299_10022126 3300001989 Bacteria 2258
5 JGI25154J39366_1000023 3300002738 Bacteria 219569
6 JGI25157J39369_1004050 3300002741 Bacteria 2773
7 JGI25152J39213_1000079 3300002773 Bacteria 65820
8 JGI25153J46596_10000551 3300003215 Bacteria 23390
9 JGI25153J46596_10008379 3300003215 Bacteria 4947
10 rootH1_10002187 3300003316 Bacteria 15443
11 rootH1_10034858 3300003316 Bacteria 21023
12 rootH1_10057866 3300003316 Bacteria 6592
13 rootH2_10003550 3300003320 Bacteria 62481
14 rootH2_10014026 3300003320 Bacteria 3667
15 rootH2_10143378 3300003320 Bacteria 2194
16 rootH2_10240261 3300003320 Bacteria 1741
17 rootL2_10003330 3300003322 Bacteria 14343
18 rootL2_10004867 3300003322 Bacteria 14604
19 rootL2_10013157 3300003322 Bacteria 3947
20 rootL2_10074626 3300003322 Bacteria 4323
21 rootL2_10209676 3300003322 Bacteria 3251
22 rootH1_10002424 3300003323 Bacteria 50256
23 rootH1_10013995 3300003323 Bacteria 73960
24 rootH1_10014349 3300003323 Bacteria 52043
25 rootH1_10020127 3300003323 Bacteria 8065
26 rootH1_10038075 3300003323 Bacteria 5225
27 rootH1_10055602 3300003323 Bacteria 9531
28 rootH1_10078003 3300003323 Bacteria 6116
29 rootH1_10142111 3300003323 Bacteria 2245
30 JGI25160J50197_1019625 3300003354 Bacteria 2066
31 Ga0055542_1003649 3300003762 Bacteria 4054
32 Ga0055526_1049155 3300003771 Bacteria 976
33 Ga0055528_1000532 3300003790 Bacteria 29352
34 Ga0055530_10000185 3300003791 Bacteria 55895
35 Ga0055531_10000038 3300003794 Bacteria 143598
36 Ga0055531_10000080 3300003794 Bacteria 103922
37 Ga0055531_10043653 3300003794 Bacteria 1266
38 Ga0055543_1008856 3300004625 Bacteria 2200
39 Ga0055543_1027535 3300004625 Bacteria 1005
40 Ga0065165_1000027 3300005262 Bacteria 228507
41 Ga0065165_1000169 3300005262 Bacteria 115398
42 Ga0065165_1002573 3300005262 Bacteria 14962
43 Ga0065704_10176816 3300005289 Bacteria 1259
44 Ga0070658_10010626 3300005327 Bacteria 7376
45 Ga0070658_10353356 3300005327 Bacteria 1258
46 Ga0070683_100047754 3300005329 Bacteria 3957
47 Ga0070683_100602983 3300005329 Bacteria 1051
48 Ga0070670_100091952 3300005331 Bacteria 2609
49 Ga0068869_100150488 3300005334 Bacteria 1805
50 Ga0070680_100002384 3300005336 Bacteria 13903
51 Ga0070680_100033472 3300005336 Bacteria 4143
52 Ga0070680_100061482 3300005336 Bacteria 3074
53 Ga0070682_100075010 3300005337 Bacteria 2174
54 Ga0070660_100000589 3300005339 Bacteria 24352
55 Ga0070660_100046062 3300005339 Bacteria 3341
56 Ga0070660_100127716 3300005339 Bacteria 2032
57 Ga0070660_100193980 3300005339 Bacteria 1646
58 Ga0070660_100315992 3300005339 Bacteria 1282
59 Ga0070668_100315238 3300005347 Bacteria 1315
60 Ga0070669_100028482 3300005353 Bacteria 4023
61 Ga0070659_100018572 3300005366 Bacteria 5247
62 Ga0070659_100023085 3300005366 Bacteria 4756
63 Ga0070659_100175444 3300005366 Bacteria 1757
64 Ga0070705_100085367 3300005440 Bacteria 1951
65 Ga0070663_100000935 3300005455 Bacteria 15875
66 Ga0070663_100302652 3300005455 Unclassified 1280
67 Ga0070681_10001937 3300005458 Bacteria 18677
68 Ga0070681_10064297 3300005458 Bacteria 3640
69 Ga0070681_10088789 3300005458 Bacteria 3043
70 Ga0070681_10247170 3300005458 Unclassified 1697
71 Ga0070681_10266910 3300005458 Bacteria 1623
72 Ga0070679_100004034 3300005530 Bacteria 13534
73 Ga0070679_100062001 3300005530 Bacteria 3727
74 Ga0070679_100064616 3300005530 Bacteria 3647
75 Ga0070679_100086751 3300005530 Bacteria 3116
76 Ga0070679_100133824 3300005530 Bacteria 2460
77 Ga0068853_100182603 3300005539 Bacteria 1903
78 Ga0070672_100132754 3300005543 Bacteria 2048
79 Ga0068855_100002978 3300005563 Bacteria 20697
80 Ga0068855_100012595 3300005563 Bacteria 10206
81 Ga0068855_100017499 3300005563 Bacteria 8619
82 Ga0068855_100490697 3300005563 Bacteria 1336
83 Ga0068857_100066782 3300005577 Bacteria 3201
84 Ga0068857_100162191 3300005577 Bacteria 2029
85 Ga0068854_100106961 3300005578 Unclassified 2105
86 Ga0068856_100008552 3300005614 Bacteria 9949
87 Ga0068856_100045873 3300005614 Bacteria 4304
88 Ga0068856_100095030 3300005614 Bacteria 2968
89 Ga0068852_100015434 3300005616 Bacteria 5925
90 Ga0068852_100120940 3300005616 Bacteria 2397
91 Ga0068859_100036136 3300005617 Bacteria 4959
92 Ga0068859_100255733 3300005617 Bacteria 1842
93 Ga0068863_100179044 3300005841 Bacteria 2035
94 Ga0068860_100003349 3300005843 Bacteria 16500
95 Ga0075428_100007808 3300006844 Bacteria 11859
96 Ga0075428_100026809 3300006844 Bacteria 6380
97 Ga0075428_100509050 3300006844 Bacteria 1288
98 Ga0075431_100117634 3300006847 Bacteria 2743
99 Ga0097620_100036136 3300006931 Bacteria 4959
100 Ga0097620_100255729 3300006931 Bacteria 1842
101 Ga0105240_10315525 3300009093 Bacteria 1783
102 Ga0111539_10008980 3300009094 Bacteria 12654
103 Ga0111539_10025044 3300009094 Bacteria 7313
104 Ga0111539_10071008 3300009094 Bacteria 4109
105 Ga0105241_10208302 3300009174 Unclassified 1637
106 Ga0105238_10001621 3300009551 Bacteria 22514
107 Ga0105249_10104379 3300009553 Bacteria 2671
108 Ga0105239_10147417 3300010375 Unclassified 2626
109 Ga0105239_10192365 3300010375 Bacteria 2284
110 Ga0157373_10015649 3300013100 Bacteria 5541
111 Ga0157373_10077855 3300013100 Bacteria 2339
112 Ga0157373_10109884 3300013100 Bacteria 1938
113 Ga0157373_10328316 3300013100 Bacteria 1089
114 Ga0157371_10003077 3300013102 Bacteria 15475
115 Ga0157371_10006552 3300013102 Bacteria 9574
116 Ga0157371_10007327 3300013102 Bacteria 8951
117 Ga0157371_10010482 3300013102 Bacteria 7213
118 Ga0157371_10011445 3300013102 Bacteria 6831
119 Ga0157371_10024970 3300013102 Bacteria 4361
120 Ga0157371_10028001 3300013102 Bacteria 4083
121 Ga0157371_10073277 3300013102 Bacteria 2425
122 Ga0157371_10217113 3300013102 Bacteria 1373
123 Ga0157370_10000408 3300013104 Bacteria 54355
124 Ga0157370_10002931 3300013104 Bacteria 20307
125 Ga0157370_10013614 3300013104 Bacteria 8371
126 Ga0157370_10159074 3300013104 Bacteria 2102
127 Ga0157370_10233198 3300013104 Bacteria 1703
128 Ga0157370_10235377 3300013104 Bacteria 1695
129 Ga0157369_10000605 3300013105 Bacteria 46691
130 Ga0157369_10046814 3300013105 Bacteria 4700
131 Ga0157369_10242608 3300013105 Bacteria 1882
132 Ga0157378_10322582 3300013297 Bacteria 1501
133 Ga0163162_10109971 3300013306 Bacteria 2853
134 Ga0157372_10000015 3300013307 Bacteria 225365
135 Ga0157372_10002383 3300013307 Bacteria 20341
136 Ga0157372_10026913 3300013307 Bacteria 6260
137 Ga0157372_10064472 3300013307 Bacteria 4111
138 Ga0157372_10422602 3300013307 Unclassified 1553
139 Ga0157372_10612642 3300013307 Bacteria 1269
140 Ga0157372_10625276 3300013307 Bacteria 1255
141 Ga0163163_10449326 3300014325 Bacteria 1349
142 Ga0157380_10030564 3300014326 Bacteria 4127
143 Ga0157379_10353786 3300014968 Bacteria 1345
144 Ga0182006_1053409 3300015261 Bacteria 1549
145 Ga0183373_1004 3300015682 Bacteria 537398
146 Ga0206351_10822572 3300020077 Unclassified 1687
147 Ga0209258_100116 3300025242 Bacteria 190317
148 Ga0209646_1000004 3300025246 Bacteria 786587
149 Ga0209026_1000136 3300025250 Bacteria 116507
150 Ga0209148_1000251 3300025254 Bacteria 85638
151 Ga0209673_1000203 3300025273 Bacteria 119623
152 Ga0209676_1002138 3300025292 Bacteria 15037
153 Ga0209564_1017064 3300025295 Bacteria 2853
154 Ga0209758_1001443 3300025297 Bacteria 28004
155 Ga0209758_1015166 3300025297 Bacteria 4018
156 Ga0209050_1000276 3300025298 Bacteria 109997
157 Ga0209050_1001434 3300025298 Bacteria 25653
158 Ga0209050_1001560 3300025298 Bacteria 23881
159 Ga0209050_1027684 3300025298 Bacteria 1861
160 Ga0207426_1000957 3300025302 Bacteria 28456
161 Ga0207426_1001718 3300025302 Bacteria 16783
162 Ga0209257_1000004 3300025304 Bacteria 1678347
163 Ga0209257_1000007 3300025304 Bacteria 1564415
164 Ga0209257_1006752 3300025304 Bacteria 7236
165 Ga0209257_1023027 3300025304 Bacteria 2203
166 Ga0207705_10001474 3300025909 Bacteria 18740
167 Ga0207705_10068406 3300025909 Bacteria 2571
168 Ga0207707_10027410 3300025912 Bacteria 4983
169 Ga0207707_10043073 3300025912 Bacteria 3939
170 Ga0207707_10291529 3300025912 Bacteria 1412
171 Ga0207695_10179311 3300025913 Unclassified 2040
172 Ga0207660_10003228 3300025917 Bacteria 10668
173 Ga0207660_10025881 3300025917 Bacteria 3989
174 Ga0207660_10320946 3300025917 Bacteria 1237
175 Ga0207657_10020993 3300025919 Bacteria 6157
176 Ga0207657_10024891 3300025919 Bacteria 5532
177 Ga0207657_10034473 3300025919 Bacteria 4551
178 Ga0207657_10078987 3300025919 Bacteria 2769
179 Ga0207652_10000160 3300025921 Bacteria 72867
180 Ga0207652_10001233 3300025921 Bacteria 22917
181 Ga0207652_10051324 3300025921 Bacteria 3536
182 Ga0207652_10073747 3300025921 Bacteria 2970
183 Ga0207652_10119821 3300025921 Bacteria 2341
184 Ga0207652_10221678 3300025921 Unclassified 1704
185 Ga0207681_10006905 3300025923 Bacteria 6963
186 Ga0207694_10034670 3300025924 Bacteria 3870
187 Ga0207650_10091982 3300025925 Bacteria 2319
188 Ga0207690_10012659 3300025932 Bacteria 5053
189 Ga0207690_10019114 3300025932 Bacteria 4211
190 Ga0207690_10095029 3300025932 Bacteria 2116
191 Ga0207670_10299851 3300025936 Bacteria 1258
192 Ga0207691_10085846 3300025940 Bacteria 2825
193 Ga0207667_10000630 3300025949 Bacteria 45583
194 Ga0207667_10016493 3300025949 Bacteria 8346
195 Ga0207667_10019347 3300025949 Bacteria 7604
196 Ga0207667_10026416 3300025949 Bacteria 6344
197 Ga0207667_10265742 3300025949 Bacteria 1754
198 Ga0207712_10378348 3300025961 Bacteria 1184
199 Ga0207640_10103493 3300025981 Bacteria 2002
200 Ga0207639_10154991 3300026041 Bacteria 1923
201 Ga0207639_10159038 3300026041 Unclassified 1902
202 Ga0207678_10006569 3300026067 Bacteria 10308
203 Ga0207678_10337648 3300026067 Unclassified 1298
204 Ga0207702_10436886 3300026078 Bacteria 1268
205 Ga0207641_10155212 3300026088 Bacteria 2076
206 Ga0207674_10023207 3300026116 Bacteria 6649
207 Ga0207674_10058204 3300026116 Bacteria 3916
208 Ga0207674_10102615 3300026116 Bacteria 2840
209 Ga0207674_10284917 3300026116 Bacteria 1600
210 Ga0207428_10007264 3300027907 Bacteria 10129
211 Ga0207428_10067706 3300027907 Bacteria 2811
212 Ga0207428_10083263 3300027907 Bacteria 2495
213 Ga0268265_10097159 3300028380 Bacteria 2369
214 Ga0268264_10057611 3300028381 Bacteria 3250
215 Ga0265337_1014152 3300028556 Bacteria 2652
216 Ga0265319_1013754 3300028563 Bacteria 3201
217 Ga0265334_10009911 3300028573 Bacteria 4028
218 Ga0265336_10048809 3300028666 Bacteria 1283
219 Ga0307517_10002284 3300028786 Bacteria 30925
220 Ga0307515_10000094 3300028794 Bacteria 210723
221 Ga0265338_10017335 3300028800 Bacteria 7772
222 Ga0265338_10019568 3300028800 Bacteria 7173
223 Ga0265327_10000985 3300031251 Bacteria 40550
224 Ga0265327_10004892 3300031251 Bacteria 11574
225 Ga0307509_10074669 3300031507 Bacteria 3525
226 Ga0316579_10213504 3300031691 Unclassified 933
227 Ga0316576_10270489 3300031727 Bacteria 1274
228 Ga0307516_10000656 3300031730 Bacteria 46771
229 Ga0307405_10136395 3300031731 Bacteria 1704
230 Ga0316577_10036770 3300031733 Unclassified 2739
231 Ga0307407_10069388 3300031903 Bacteria 2092
232 Ga0307412_10081525 3300031911 Bacteria 2238
233 Ga0307409_100062733 3300031995 Bacteria 2911
234 Ga0307416_100000002 3300032002 Bacteria 509907
235 Ga0307416_100005017 3300032002 Bacteria 8071
236 Ga0307415_100228264 3300032126 Bacteria 1497
237 Ga0373931_0334742 3300035691 Bacteria 944
238 Ga0316582_0509284 3300036647 Unclassified 829
239 Ga0395899_0000615 3300037312 Bacteria 37072
240 Ga0395899_0002489 3300037312 Bacteria 14953
241 Ga0395899_0006074 3300037312 Bacteria 9377
242 Ga0395899_0007101 3300037312 Bacteria 8668
243 Ga0395899_0043169 3300037312 Bacteria 3364
244 Ga0395900_0002996 3300037418 Bacteria 18376
245 Ga0395900_0024025 3300037418 Bacteria 6236
246 Ga0395900_0032543 3300037418 Bacteria 5362
247 Ga0395900_0062154 3300037418 Bacteria 3838
248 Ga0395900_0289568 3300037418 Unclassified 1627
249 Ga0395900_0524609 3300037418 Bacteria 1132
250 Ga0395898_0000738 3300037466 Bacteria 57155
251 Ga0395898_0006085 3300037466 Bacteria 12948
252 Ga0395898_0041215 3300037466 Bacteria 4561
253 Ga0395901_0002864 3300038443 Bacteria 17425
254 Ga0395901_0018348 3300038443 Bacteria 7143
255 Ga0395901_0038364 3300038443 Bacteria 4955
256 Ga0451798_0784811 3300041458 Bacteria 922
257 Ga0451800_0141886 3300041459 Bacteria 1070
258 Ga0451807_1689593 3300041486 Bacteria 1250
259 Ga0451849_0558546 3300041505 Bacteria 1103
260 Ga0451577_0015367 3300042876 Bacteria 7124
261 Ga0453683_0007051 3300044673 Bacteria 7657
262 Ga0466965_0149299 3300044683 Bacteria 1221
263 Ga0453684_0001857 3300044712 Bacteria 55136
264 Ga0466959_0152878 3300045049 Unclassified 1625
265 Ga0451576_0006481 3300045051 Bacteria 14343
266 Ga0451576_0008597 3300045051 Bacteria 11963
267 Ga0451576_0093702 3300045051 Unclassified 3123
268 Ga0466958_0005750 3300045836 Bacteria 6703
269 Ga0495638_0000004 3300046460 Bacteria 700795
270 Ga0495638_0000006 3300046460 Bacteria 668846
271 Ga0495662_0102016 3300046476 Bacteria 1403
272 Ga0495606_0059860 3300046507 Bacteria 2442
273 Ga0495618_0001313 3300046514 Bacteria 16719
274 Ga0495628_0000140 3300046516 Bacteria 62202
275 Ga0495640_0015274 3300046533 Bacteria 5780
276 Ga0495645_0001437 3300046543 Bacteria 16062
277 Ga0495633_0000116 3300046558 Bacteria 108667
278 Ga0495599_0047397 3300046678 Bacteria 2693
279 Ga0495624_0031236 3300046690 Bacteria 3465
280 Ga0495674_0010849 3300047319 Bacteria 8615
281 Ga0495681_0049422 3300047470 Bacteria 1988
282 Ga0496101_0092151 3300048904 Bacteria 2256
283 Ga0496126_0021648 3300048929 Bacteria 6276
284 Ga0501309_013296 3300049129 Bacteria 1093
285 Ga0501300_002628 3300049523 Bacteria 2693
286 Ga0501336_005245 3300049552 Bacteria 931
287 Ga0501033_0034102 3300049570 Bacteria 3820
288 Ga0501033_0412778 3300049570 Bacteria 941
289 Ga0501034_0155786 3300049571 Bacteria 2258
290 Ga0501034_0295830 3300049571 Bacteria 1556
291 Ga0501043_0207750 3300049579 Bacteria 1518
292 Ga0501047_0023388 3300049581 Bacteria 5933
293 Ga0501206_006541 3300049653 Bacteria 1516
294 Ga0501217_001988 3300049661 Bacteria 3944
295 Ga0501236_004723 3300049670 Bacteria 1625
296 Ga0501242_000924 3300049674 Bacteria 2805
297 Ga0501247_000618 3300049677 Bacteria 2952
298 Ga0501257_001169 3300049686 Bacteria 5367
299 Ga0501241_000709 3300049758 Bacteria 7191
300 Ga0501264_000066 3300049761 Bacteria 14768
301 nmdc:mga06r32_262639_c1 3300050510 Bacteria 1714
302 nmdc:mga08y16_333241_c1 3300050511 Bacteria 1561
303 nmdc:mga08y16_56189_c1 3300050511 Bacteria 4114
304 nmdc:mga08y16_8143_c1 3300050511 Bacteria 10966
305 Ga0500644_0000469 3300053088 Bacteria 17883
306 Ga0500646_0002201 3300053090 Bacteria 5086
307 Ga0500562_000004 3300053108 Bacteria 270087
308 Ga0500569_000534 3300053109 Bacteria 6350
309 Ga0500618_005550 3300053125 Bacteria 3816
310 Ga0500655_005657 3300053133 Bacteria 2248
311 Ga0500658_0003895 3300053134 Bacteria 5614
312 Ga0500559_0010236 3300053136 Bacteria 4032
313 Ga0500616_0000015 3300053153 Bacteria 633259
314 Ga0500616_0000065 3300053153 Bacteria 239287
315 Ga0500616_0026020 3300053153 Bacteria 3243
316 Ga0500616_0030483 3300053153 Bacteria 2962
317 Ga0500622_0000379 3300053156 Bacteria 42858
318 Ga0500622_0000418 3300053156 Bacteria 40378
319 Ga0500622_0000421 3300053156 Bacteria 40169
320 Ga0500633_0001068 3300053160 Bacteria 4904
321 Ga0500636_0008604 3300053177 Bacteria 5911
322 Ga0500661_006563 3300055283 Bacteria 2164
323 Ga0500661_008500 3300055283 Bacteria 1889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0524609 Ga0395900_0524609_404_1114 236
2 3300041458 Ga0451798_0784811 Ga0451798_0784811_131_874 244
3 3300046460 Ga0495638_0000004 Ga0495638_0000004_457678_458442 254
4 3300053153 Ga0500616_0000015 Ga0500616_0000015_367329_368093 254
5 3300036647 Ga0316582_0509284 Ga0316582_0509284_31_810 259
6 3300006847 Ga0075431_100117634 Ga0075431_1001176342 267
7 3300028556 Ga0265337_1014152 Ga0265337_10141522 267
8 3300028563 Ga0265319_1013754 Ga0265319_10137542 267
9 3300028800 Ga0265338_10017335 Ga0265338_100173353 267
10 3300028800 Ga0265338_10019568 Ga0265338_100195686 267
11 3300037418 Ga0395900_0289568 Ga0395900_0289568_788_1600 268
12 3300027907 Ga0207428_10067706 Ga0207428_100677063 269
13 3300045051 Ga0451576_0093702 Ga0451576_0093702_1460_2353 269
14 3300005347 Ga0070668_100315238 Ga0070668_1003152381 270
15 3300049570 Ga0501033_0412778 Ga0501033_0412778_25_837 270
16 3300003323 rootH1_10038075 rootH1_100380754 275
17 3300005339 Ga0070660_100000589 Ga0070660_10000058914 276
18 3300009093 Ga0105240_10315525 Ga0105240_103155252 276
19 3300003323 rootH1_10002424 rootH1_1000242430 277
20 3300004625 Ga0055543_1027535 Ga0055543_10275351 277
21 3300005262 Ga0065165_1000169 Ga0065165_100016968 277
22 3300025292 Ga0209676_1002138 Ga0209676_10021385 277
23 3300035691 Ga0373931_0334742 Ga0373931_0334742_42_887 277
24 iso_pu_bacteria 2840677318 2840678778 277
25 3300025298 Ga0209050_1001560 Ga0209050_100156012 278
26 3300045049 Ga0466959_0152878 Ga0466959_0152878_646_1494 278
27 3300031691 Ga0316579_10213504 Ga0316579_102135041 280
28 3300031733 Ga0316577_10036770 Ga0316577_100367703 280
29 3300003316 rootH1_10057866 rootH1_100578662 281
30 3300003322 rootL2_10209676 rootL2_102096763 281
31 3300013102 Ga0157371_10073277 Ga0157371_100732771 281
32 3300025917 Ga0207660_10320946 Ga0207660_103209461 281
33 3300031731 Ga0307405_10136395 Ga0307405_101363952 281
34 3300031903 Ga0307407_10069388 Ga0307407_100693882 281
35 3300031911 Ga0307412_10081525 Ga0307412_100815252 281
36 3300032002 Ga0307416_100005017 Ga0307416_1000050175 281
37 3300049653 Ga0501206_006541 Ga0501206_006541_573_1421 281
38 3300049674 Ga0501242_000924 Ga0501242_000924_1918_2766 281
39 3300025909 Ga0207705_10068406 Ga0207705_100684061 282
40 3300031251 Ga0265327_10004892 Ga0265327_100048922 282
41 3300005336 Ga0070680_100033472 Ga0070680_1000334722 284
42 3300005339 Ga0070660_100046062 Ga0070660_1000460622 284
43 3300005366 Ga0070659_100018572 Ga0070659_1000185722 284
44 3300005366 Ga0070659_100023085 Ga0070659_1000230852 284
45 3300005458 Ga0070681_10088789 Ga0070681_100887892 284
46 3300005530 Ga0070679_100062001 Ga0070679_1000620012 284
47 3300005530 Ga0070679_100064616 Ga0070679_1000646162 284
48 3300005539 Ga0068853_100182603 Ga0068853_1001826032 284
49 3300005563 Ga0068855_100012595 Ga0068855_1000125956 284
50 3300005563 Ga0068855_100017499 Ga0068855_1000174999 284
51 3300005577 Ga0068857_100066782 Ga0068857_1000667822 284
52 3300025912 Ga0207707_10043073 Ga0207707_100430732 284
53 3300025917 Ga0207660_10025881 Ga0207660_100258812 284
54 3300025919 Ga0207657_10024891 Ga0207657_100248913 284
55 3300025921 Ga0207652_10051324 Ga0207652_100513241 284
56 3300025921 Ga0207652_10073747 Ga0207652_100737472 284
57 3300025932 Ga0207690_10012659 Ga0207690_100126593 284
58 3300025932 Ga0207690_10019114 Ga0207690_100191143 284
59 3300025949 Ga0207667_10019347 Ga0207667_100193472 284
60 3300025949 Ga0207667_10026416 Ga0207667_100264161 284
61 3300026041 Ga0207639_10154991 Ga0207639_101549912 284
62 3300026116 Ga0207674_10058204 Ga0207674_100582042 284
63 3300031995 Ga0307409_100062733 Ga0307409_1000627333 284
64 3300032126 Ga0307415_100228264 Ga0307415_1002282641 284
65 3300006844 Ga0075428_100509050 Ga0075428_1005090502 285
66 3300049677 Ga0501247_000618 Ga0501247_000618_639_1502 286
67 3300003794 Ga0055531_10000038 Ga0055531_1000003862 287
68 3300005262 Ga0065165_1002573 Ga0065165_100257311 287
69 3300005617 Ga0068859_100255733 Ga0068859_1002557332 287
70 3300006931 Ga0097620_100255729 Ga0097620_1002557292 287
71 3300025298 Ga0209050_1027684 Ga0209050_10276842 287
72 3300025304 Ga0209257_1000007 Ga0209257_1000007835 287
73 3300028786 Ga0307517_10002284 Ga0307517_1000228417 287
74 3300028794 Ga0307515_10000094 Ga0307515_1000009473 287
75 3300031507 Ga0307509_10074669 Ga0307509_100746693 287
76 3300044673 Ga0453683_0007051 Ga0453683_0007051_1380_2243 287
77 3300044712 Ga0453684_0001857 Ga0453684_0001857_46196_47059 287
78 3300045051 Ga0451576_0006481 Ga0451576_0006481_7659_8522 287
79 3300045051 Ga0451576_0008597 Ga0451576_0008597_9114_9977 287
80 3300053133 Ga0500655_005657 Ga0500655_005657_799_1662 287
81 3300053153 Ga0500616_0030483 Ga0500616_0030483_857_1720 287
82 3300053156 Ga0500622_0000418 Ga0500622_0000418_18530_19393 287
83 3300053156 Ga0500622_0000421 Ga0500622_0000421_20973_21836 287
84 iso_pu_bacteria 2522125168 2522551170 287
85 3300025297 Ga0209758_1001443 Ga0209758_10014436 288
86 3300042876 Ga0451577_0015367 Ga0451577_0015367_1450_2364 288
87 3300005339 Ga0070660_100315992 Ga0070660_1003159922 289
88 3300005841 Ga0068863_100179044 Ga0068863_1001790442 289
89 3300009551 Ga0105238_10001621 Ga0105238_100016219 289
90 3300013104 Ga0157370_10000408 Ga0157370_100004088 289
91 3300013297 Ga0157378_10322582 Ga0157378_103225822 289
92 3300025924 Ga0207694_10034670 Ga0207694_100346704 289
93 3300026088 Ga0207641_10155212 Ga0207641_101552122 289
94 3300028573 Ga0265334_10009911 Ga0265334_100099113 289
95 3300028666 Ga0265336_10048809 Ga0265336_100488092 289
96 3300031251 Ga0265327_10000985 Ga0265327_1000098519 289
97 3300005331 Ga0070670_100091952 Ga0070670_1000919522 290
98 3300013306 Ga0163162_10109971 Ga0163162_101099712 290
99 3300025925 Ga0207650_10091982 Ga0207650_100919822 290
100 3300053108 Ga0500562_000004 Ga0500562_000004_56111_56998 290
101 3300001979 JGI24740J21852_10016155 JGI24740J21852_100161552 291
102 3300002773 JGI25152J39213_1000079 JGI25152J39213_10000797 291
103 3300005327 Ga0070658_10010626 Ga0070658_100106264 291
104 3300005329 Ga0070683_100047754 Ga0070683_1000477542 291
105 3300005336 Ga0070680_100002384 Ga0070680_1000023846 291
106 3300005455 Ga0070663_100000935 Ga0070663_10000093510 291
107 3300005455 Ga0070663_100302652 Ga0070663_1003026521 291
108 3300005458 Ga0070681_10001937 Ga0070681_1000193711 291
109 3300005563 Ga0068855_100002978 Ga0068855_10000297816 291
110 3300005614 Ga0068856_100045873 Ga0068856_1000458732 291
111 3300005616 Ga0068852_100120940 Ga0068852_1001209402 291
112 3300013100 Ga0157373_10109884 Ga0157373_101098842 291
113 3300013102 Ga0157371_10003077 Ga0157371_1000307710 291
114 3300013102 Ga0157371_10006552 Ga0157371_100065523 291
115 3300013102 Ga0157371_10010482 Ga0157371_100104826 291
116 3300013102 Ga0157371_10011445 Ga0157371_100114457 291
117 3300013102 Ga0157371_10024970 Ga0157371_100249702 291
118 3300013104 Ga0157370_10233198 Ga0157370_102331982 291
119 3300013104 Ga0157370_10235377 Ga0157370_102353771 291
120 3300013105 Ga0157369_10000605 Ga0157369_100006055 291
121 3300013105 Ga0157369_10046814 Ga0157369_100468142 291
122 3300013307 Ga0157372_10000015 Ga0157372_10000015148 291
123 3300013307 Ga0157372_10002383 Ga0157372_100023835 291
124 3300015261 Ga0182006_1053409 Ga0182006_10534092 291
125 3300015682 Ga0183373_1004 Ga0183373_1004346 291
126 3300020077 Ga0206351_10822572 Ga0206351_108225723 291
127 3300025909 Ga0207705_10001474 Ga0207705_100014746 291
128 3300025917 Ga0207660_10003228 Ga0207660_100032282 291
129 3300025919 Ga0207657_10034473 Ga0207657_100344734 291
130 3300025921 Ga0207652_10001233 Ga0207652_100012339 291
131 3300025949 Ga0207667_10000630 Ga0207667_1000063019 291
132 3300026067 Ga0207678_10006569 Ga0207678_100065692 291
133 3300026067 Ga0207678_10337648 Ga0207678_103376481 291
134 3300031727 Ga0316576_10270489 Ga0316576_102704892 291
135 3300031730 Ga0307516_10000656 Ga0307516_1000065625 291
136 3300032002 Ga0307416_100000002 Ga0307416_100000002117 291
137 3300037312 Ga0395899_0000615 Ga0395899_0000615_3982_4866 291
138 3300037312 Ga0395899_0006074 Ga0395899_0006074_6795_7688 291
139 3300037312 Ga0395899_0007101 Ga0395899_0007101_5541_6425 291
140 3300037312 Ga0395899_0043169 Ga0395899_0043169_2280_3173 291
141 3300037418 Ga0395900_0024025 Ga0395900_0024025_4791_5687 291
142 3300037418 Ga0395900_0062154 Ga0395900_0062154_1263_2156 291
143 3300037466 Ga0395898_0006085 Ga0395898_0006085_1369_2262 291
144 3300037466 Ga0395898_0041215 Ga0395898_0041215_3296_4180 291
145 3300038443 Ga0395901_0002864 Ga0395901_0002864_9849_10733 291
146 3300038443 Ga0395901_0018348 Ga0395901_0018348_2344_3237 291
147 3300045836 Ga0466958_0005750 Ga0466958_0005750_2112_2996 291
148 3300046507 Ga0495606_0059860 Ga0495606_0059860_1167_2051 291
149 3300047470 Ga0495681_0049422 Ga0495681_0049422_413_1303 291
150 3300053125 Ga0500618_005550 Ga0500618_005550_2064_2951 291
151 iso_pu_bacteria 2910245624 2910249027 291
152 3300005327 Ga0070658_10353356 Ga0070658_103533561 292
153 3300005329 Ga0070683_100602983 Ga0070683_1006029831 292
154 3300005334 Ga0068869_100150488 Ga0068869_1001504882 292
155 3300005336 Ga0070680_100061482 Ga0070680_1000614822 292
156 3300005337 Ga0070682_100075010 Ga0070682_1000750101 292
157 3300005339 Ga0070660_100127716 Ga0070660_1001277162 292
158 3300005339 Ga0070660_100193980 Ga0070660_1001939801 292
159 3300005366 Ga0070659_100175444 Ga0070659_1001754442 292
160 3300005458 Ga0070681_10064297 Ga0070681_100642973 292
161 3300005458 Ga0070681_10247170 Ga0070681_102471702 292
162 3300005458 Ga0070681_10266910 Ga0070681_102669102 292
163 3300005530 Ga0070679_100004034 Ga0070679_1000040342 292
164 3300005530 Ga0070679_100086751 Ga0070679_1000867513 292
165 3300005530 Ga0070679_100133824 Ga0070679_1001338242 292
166 3300005578 Ga0068854_100106961 Ga0068854_1001069612 292
167 3300005616 Ga0068852_100015434 Ga0068852_1000154343 292
168 3300005617 Ga0068859_100036136 Ga0068859_1000361362 292
169 3300005843 Ga0068860_100003349 Ga0068860_10000334914 292
170 3300006931 Ga0097620_100036136 Ga0097620_1000361364 292
171 3300009174 Ga0105241_10208302 Ga0105241_102083022 292
172 3300009553 Ga0105249_10104379 Ga0105249_101043792 292
173 3300010375 Ga0105239_10147417 Ga0105239_101474172 292
174 3300013100 Ga0157373_10015649 Ga0157373_100156493 292
175 3300013100 Ga0157373_10077855 Ga0157373_100778553 292
176 3300013102 Ga0157371_10028001 Ga0157371_100280013 292
177 3300013102 Ga0157371_10217113 Ga0157371_102171132 292
178 3300013307 Ga0157372_10064472 Ga0157372_100644723 292
179 3300014325 Ga0163163_10449326 Ga0163163_104493262 292
180 3300014968 Ga0157379_10353786 Ga0157379_103537862 292
181 3300025912 Ga0207707_10027410 Ga0207707_100274105 292
182 3300025912 Ga0207707_10291529 Ga0207707_102915292 292
183 3300025913 Ga0207695_10179311 Ga0207695_101793112 292
184 3300025919 Ga0207657_10020993 Ga0207657_100209933 292
185 3300025919 Ga0207657_10078987 Ga0207657_100789872 292
186 3300025921 Ga0207652_10000160 Ga0207652_1000016028 292
187 3300025921 Ga0207652_10119821 Ga0207652_101198212 292
188 3300025921 Ga0207652_10221678 Ga0207652_102216781 292
189 3300025932 Ga0207690_10095029 Ga0207690_100950292 292
190 3300025949 Ga0207667_10016493 Ga0207667_100164935 292
191 3300025949 Ga0207667_10265742 Ga0207667_102657422 292
192 3300025961 Ga0207712_10378348 Ga0207712_103783481 292
193 3300025981 Ga0207640_10103493 Ga0207640_101034932 292
194 3300026041 Ga0207639_10159038 Ga0207639_101590382 292
195 3300026078 Ga0207702_10436886 Ga0207702_104368861 292
196 3300026116 Ga0207674_10023207 Ga0207674_100232072 292
197 3300026116 Ga0207674_10284917 Ga0207674_102849172 292
198 3300028380 Ga0268265_10097159 Ga0268265_100971592 292
199 3300028381 Ga0268264_10057611 Ga0268264_100576112 292
200 3300037312 Ga0395899_0002489 Ga0395899_0002489_2448_3332 292
201 3300037418 Ga0395900_0002996 Ga0395900_0002996_5463_6347 292
202 3300037418 Ga0395900_0032543 Ga0395900_0032543_2478_3362 292
203 3300037466 Ga0395898_0000738 Ga0395898_0000738_3246_4130 292
204 3300038443 Ga0395901_0038364 Ga0395901_0038364_3107_3991 292
205 3300049570 Ga0501033_0034102 Ga0501033_0034102_1584_2483 292
206 3300049571 Ga0501034_0155786 Ga0501034_0155786_1091_1990 292
207 3300049579 Ga0501043_0207750 Ga0501043_0207750_25_924 292
208 3300049686 Ga0501257_001169 Ga0501257_001169_1721_2611 292
209 3300055283 Ga0500661_008500 Ga0500661_008500_437_1348 292
210 3300013100 Ga0157373_10328316 Ga0157373_103283161 293
211 3300013102 Ga0157371_10007327 Ga0157371_100073275 293
212 3300013104 Ga0157370_10002931 Ga0157370_1000293116 293
213 3300013307 Ga0157372_10026913 Ga0157372_100269132 293
214 iso_pu_bacteria 2884791551 2884796793 293
215 iso_pu_bacteria 2896085136 2896086596 293
216 iso_pu_bacteria 2896109856 2896113104 293
217 iso_pu_bacteria 2929239360 2929240055 293
218 iso_pu_bacteria 2929921140 2929921754 293
219 iso_pu_bacteria 8003151029 8003154300 293
220 3300003316 rootH1_10034858 rootH1_100348589 294
221 3300003320 rootH2_10143378 rootH2_101433782 294
222 3300003322 rootL2_10013157 rootL2_100131572 294
223 3300003323 rootH1_10013995 rootH1_1001399561 294
224 3300003323 rootH1_10055602 rootH1_100556022 294
225 3300005289 Ga0065704_10176816 Ga0065704_101768162 294
226 3300005614 Ga0068856_100095030 Ga0068856_1000950303 294
227 3300013104 Ga0157370_10013614 Ga0157370_100136142 294
228 3300013105 Ga0157369_10242608 Ga0157369_102426081 294
229 3300013307 Ga0157372_10612642 Ga0157372_106126421 294
230 3300041486 Ga0451807_1689593 Ga0451807_1689593_137_1033 294
231 3300041505 Ga0451849_0558546 Ga0451849_0558546_71_967 294
232 3300003316 rootH1_10002187 rootH1_100021873 295
233 3300003320 rootH2_10003550 rootH2_1000355010 295
234 3300003322 rootL2_10003330 rootL2_1000333012 295
235 3300003323 rootH1_10014349 rootH1_1001434940 295
236 3300003323 rootH1_10078003 rootH1_100780033 295
237 3300005543 Ga0070672_100132754 Ga0070672_1001327544 295
238 3300005563 Ga0068855_100490697 Ga0068855_1004906972 295
239 3300005577 Ga0068857_100162191 Ga0068857_1001621912 295
240 3300005614 Ga0068856_100008552 Ga0068856_1000085522 295
241 3300006844 Ga0075428_100007808 Ga0075428_1000078084 295
242 3300006844 Ga0075428_100026809 Ga0075428_1000268093 295
243 3300009094 Ga0111539_10008980 Ga0111539_100089804 295
244 3300009094 Ga0111539_10025044 Ga0111539_100250446 295
245 3300009094 Ga0111539_10025044 Ga0111539_100250447 295
246 3300009094 Ga0111539_10071008 Ga0111539_100710082 295
247 3300013104 Ga0157370_10159074 Ga0157370_101590742 295
248 3300013307 Ga0157372_10422602 Ga0157372_104226021 295
249 3300013307 Ga0157372_10625276 Ga0157372_106252761 295
250 3300014326 Ga0157380_10030564 Ga0157380_100305642 295
251 3300014326 Ga0157380_10030564 Ga0157380_100305643 295
252 3300025298 Ga0209050_1001434 Ga0209050_100143413 295
253 3300025304 Ga0209257_1023027 Ga0209257_10230272 295
254 3300025936 Ga0207670_10299851 Ga0207670_102998511 295
255 3300025940 Ga0207691_10085846 Ga0207691_100858461 295
256 3300026116 Ga0207674_10102615 Ga0207674_101026152 295
257 3300027907 Ga0207428_10007264 Ga0207428_100072642 295
258 3300027907 Ga0207428_10067706 Ga0207428_100677062 295
259 3300027907 Ga0207428_10083263 Ga0207428_100832632 295
260 3300041459 Ga0451800_0141886 Ga0451800_0141886_82_975 295
261 3300046460 Ga0495638_0000006 Ga0495638_0000006_81778_82674 295
262 3300046476 Ga0495662_0102016 Ga0495662_0102016_350_1237 295
263 3300046514 Ga0495618_0001313 Ga0495618_0001313_3143_4030 295
264 3300046516 Ga0495628_0000140 Ga0495628_0000140_28973_29860 295
265 3300046533 Ga0495640_0015274 Ga0495640_0015274_2156_3043 295
266 3300046543 Ga0495645_0001437 Ga0495645_0001437_2693_3580 295
267 3300046678 Ga0495599_0047397 Ga0495599_0047397_367_1254 295
268 3300046690 Ga0495624_0031236 Ga0495624_0031236_1487_2374 295
269 3300047319 Ga0495674_0010849 Ga0495674_0010849_5489_6376 295
270 3300049129 Ga0501309_013296 Ga0501309_013296_192_1082 295
271 3300049523 Ga0501300_002628 Ga0501300_002628_1554_2444 295
272 3300049552 Ga0501336_005245 Ga0501336_005245_21_911 295
273 3300049661 Ga0501217_001988 Ga0501217_001988_963_1853 295
274 3300049670 Ga0501236_004723 Ga0501236_004723_535_1425 295
275 3300049761 Ga0501264_000066 Ga0501264_000066_2855_3745 295
276 3300050510 nmdc:mga06r32_262639_c1 nmdc:mga06r32_262639_c1_646_1539 295
277 3300050511 nmdc:mga08y16_333241_c1 nmdc:mga08y16_333241_c1_336_1226 295
278 3300050511 nmdc:mga08y16_56189_c1 nmdc:mga08y16_56189_c1_1810_2703 295
279 3300050511 nmdc:mga08y16_8143_c1 nmdc:mga08y16_8143_c1_1979_2878 295
280 3300053153 Ga0500616_0000065 Ga0500616_0000065_59355_60251 295
281 3300003323 rootH1_10020127 rootH1_100201276 296
282 3300005440 Ga0070705_100085367 Ga0070705_1000853672 296
283 3300001979 JGI24740J21852_10005630 JGI24740J21852_100056303 297
284 3300001989 JGI24739J22299_10000030 JGI24739J22299_1000003035 297
285 3300001989 JGI24739J22299_10022126 JGI24739J22299_100221264 297
286 3300002738 JGI25154J39366_1000023 JGI25154J39366_100002327 297
287 3300002741 JGI25157J39369_1004050 JGI25157J39369_10040502 297
288 3300003215 JGI25153J46596_10000551 JGI25153J46596_100005515 297
289 3300003215 JGI25153J46596_10008379 JGI25153J46596_100083795 297
290 3300003320 rootH2_10014026 rootH2_100140263 297
291 3300003320 rootH2_10240261 rootH2_102402612 297
292 3300003322 rootL2_10004867 rootL2_100048671 297
293 3300003322 rootL2_10074626 rootL2_100746262 297
294 3300003323 rootH1_10142111 rootH1_101421113 297
295 3300003354 JGI25160J50197_1019625 JGI25160J50197_10196251 297
296 3300003762 Ga0055542_1003649 Ga0055542_10036493 297
297 3300003771 Ga0055526_1049155 Ga0055526_10491551 297
298 3300003790 Ga0055528_1000532 Ga0055528_100053213 297
299 3300003791 Ga0055530_10000185 Ga0055530_100001858 297
300 3300003794 Ga0055531_10000080 Ga0055531_1000008052 297
301 3300003794 Ga0055531_10043653 Ga0055531_100436532 297
302 3300004625 Ga0055543_1008856 Ga0055543_10088562 297
303 3300005262 Ga0065165_1000027 Ga0065165_1000027199 297
304 3300005353 Ga0070669_100028482 Ga0070669_1000284823 297
305 3300010375 Ga0105239_10192365 Ga0105239_101923652 297
306 3300025242 Ga0209258_100116 Ga0209258_10011665 297
307 3300025246 Ga0209646_1000004 Ga0209646_1000004569 297
308 3300025250 Ga0209026_1000136 Ga0209026_100013690 297
309 3300025254 Ga0209148_1000251 Ga0209148_100025165 297
310 3300025273 Ga0209673_1000203 Ga0209673_100020388 297
311 3300025295 Ga0209564_1017064 Ga0209564_10170643 297
312 3300025297 Ga0209758_1015166 Ga0209758_10151661 297
313 3300025298 Ga0209050_1000276 Ga0209050_100027629 297
314 3300025302 Ga0207426_1000957 Ga0207426_10009578 297
315 3300025302 Ga0207426_1001718 Ga0207426_100171816 297
316 3300025304 Ga0209257_1000004 Ga0209257_100000452 297
317 3300025304 Ga0209257_1006752 Ga0209257_10067525 297
318 3300025923 Ga0207681_10006905 Ga0207681_100069052 297
319 3300044683 Ga0466965_0149299 Ga0466965_0149299_171_1175 297
320 3300046558 Ga0495633_0000116 Ga0495633_0000116_38188_39081 297
321 3300048904 Ga0496101_0092151 Ga0496101_0092151_1286_2179 297
322 3300048929 Ga0496126_0021648 Ga0496126_0021648_2949_3842 297
323 3300049571 Ga0501034_0295830 Ga0501034_0295830_580_1473 297
324 3300049581 Ga0501047_0023388 Ga0501047_0023388_2127_3020 297
325 3300049758 Ga0501241_000709 Ga0501241_000709_2096_2989 297
326 3300053088 Ga0500644_0000469 Ga0500644_0000469_12392_13285 297
327 3300053090 Ga0500646_0002201 Ga0500646_0002201_2031_2924 297
328 3300053109 Ga0500569_000534 Ga0500569_000534_2024_2917 297
329 3300053134 Ga0500658_0003895 Ga0500658_0003895_3835_4728 297
330 3300053136 Ga0500559_0010236 Ga0500559_0010236_2318_3211 297
331 3300053153 Ga0500616_0026020 Ga0500616_0026020_779_1672 297
332 3300053156 Ga0500622_0000379 Ga0500622_0000379_26009_26902 297
333 3300053160 Ga0500633_0001068 Ga0500633_0001068_1305_2198 297
334 3300053177 Ga0500636_0008604 Ga0500636_0008604_3466_4359 297
335 3300055283 Ga0500661_006563 Ga0500661_006563_240_1133 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

102

332

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8931 46 288
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8703 46 288
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8416 46 288
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.8193 46 290
7x7w-assembly1.cif.gz_B-2 the x-ray crystallographic structure of d-psicose 3-epimerase from clostridia bacterium 0.8173 46 295
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8921 46 288 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8818 46 288 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8652 47 288 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8615 46 288 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8416 46 292 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1V6DH27-F1-model_v4 deleted 0.9797 41 297
AF-A0A3B9APF4-F1-model_v4 Hydroxypyruvate isomerase 0.9774 120 297 GO:0016853
AF-A0A3M1BXT2-F1-model_v4 Hydroxypyruvate isomerase 0.9766 44 297 GO:0016853
AF-A0A7V8GM33-F1-model_v4 Hydroxypyruvate isomerase 0.9762 40 297 GO:0016853
AF-A0A3D4TDJ3-F1-model_v4 Hydroxypyruvate isomerase 0.9752 47 297 GO:0016853

Feature Viewer

pLDDT pTM Quality
88.63 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map