F412022

General Info

Members Datasets Scaffolds Average Seq Length
334 259 668 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881412998|2881414972
Length 244
Sequence ALITQNRKEARSMNAVPTSADVRQVPMMTIHDFPKGPYPTRVRIALAEKNLQSRARFVMVDLYKGEHKKPEFIATKNYSGTLPVLELADGTCIAECTAITEYLDNLDGQPALTGRTALEKGLIHMMSKRAELELLDAISVYFHHGTPGLGPQVELYQNPEWGCRQRDKALRGMHYFDAVLKNQPYVAGKAFSMADITVIGGLVFAAIVDLPVPEECGALLAWYERVRQRPSVKDQPAFLDLAAG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
171 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
172 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
173 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
174 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
175 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
176 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
177 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
178 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
179 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
180 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
181 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
182 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
183 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
184 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
185 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
186 2519103095 Burkholderia sp. KJ006 Isolate Nodule
187 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
188 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
189 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
190 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
191 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
192 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
193 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
194 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
195 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
196 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
197 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
198 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
199 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
200 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
201 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
202 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
203 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
204 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
205 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
206 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
207 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
208 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
209 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
210 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
211 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
212 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
213 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
214 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
215 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
216 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
217 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
218 2818991452 Burkholderia cepacia 561 Isolate Unclassified
219 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
220 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
221 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
222 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
223 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
224 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
225 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
226 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
227 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
228 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
229 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
230 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
231 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
232 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
233 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
234 2904564687 Burkholderia sp. 571 Isolate Unclassified
235 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
236 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
237 2906610324
238 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
239 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
240 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
241 2922425934
242 2928170801 Burkholderia sp. 572 Isolate Unclassified
243 2928536128 Burkholderia sola 565 Isolate Unclassified
244 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
245 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
246 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
247 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
248 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
249 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
250 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
251 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
252 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
253 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
254 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
255 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
256 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
257 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
258 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
259 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.8
Metatranscriptomes 0
Isolates 26.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 8.68
Rhizoplane 7.49
Rhizosphere 59.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4730273 2162886011 Bacteria 1848
2 JGI25151J46595_10000159 3300003187 Bacteria 87280
3 JGI25151J46595_10018434 3300003187 Bacteria 2997
4 rootH2_10250857 3300003320 Bacteria 1354
5 rootL2_10279818 3300003322 Bacteria 1303
6 Ga0055532_1000239 3300003758 Bacteria 40306
7 Ga0055527_1006604 3300003760 Bacteria 1448
8 Ga0055535_1000288 3300003761 Bacteria 53313
9 Ga0055542_1000258 3300003762 Bacteria 59741
10 Ga0055529_1000191 3300003763 Bacteria 83946
11 Ga0065165_1000329 3300005262 Bacteria 77564
12 Ga0065165_1000348 3300005262 Bacteria 75762
13 Ga0065714_10003726 3300005288 Bacteria 6244
14 Ga0065712_10067775 3300005290 Bacteria 42621
15 Ga0070676_10172072 3300005328 Bacteria 1402
16 Ga0070663_100056249 3300005455 Bacteria 2818
17 Ga0070706_100348273 3300005467 Bacteria 1381
18 Ga0075364_10056842 3300006051 Bacteria 2562
19 Ga0075369_10031130 3300006186 Bacteria 2250
20 Ga0079104_1000306 3300006946 Bacteria 62131
21 Ga0079104_1002837 3300006946 Bacteria 8707
22 Ga0105251_10120311 3300009011 Bacteria 1193
23 Ga0105244_10028699 3300009036 Bacteria 2982
24 Ga0105244_10063265 3300009036 Bacteria 1858
25 Ga0105240_10000393 3300009093 Bacteria 81664
26 Ga0105240_10000405 3300009093 Bacteria 80014
27 Ga0105243_10087663 3300009148 Bacteria 2555
28 Ga0105237_10634955 3300009545 Bacteria 1075
29 Ga0105147_102164 3300009982 Bacteria 1620
30 Ga0105239_10000070 3300010375 Bacteria 144044
31 Ga0105246_10038144 3300011119 Bacteria 3228
32 Ga0163162_10091173 3300013306 Bacteria 3130
33 Ga0157375_10633225 3300013308 Bacteria 1227
34 Ga0182006_1005246 3300015261 Bacteria 6204
35 Ga0182007_10002498 3300015262 Bacteria 9095
36 Ga0163161_10019479 3300017792 Bacteria 4761
37 Ga0213872_10005891 3300021361 Bacteria 6217
38 Ga0213872_10013768 3300021361 Bacteria 3785
39 Ga0209566_100220 3300025225 Bacteria 56957
40 Ga0209674_102528 3300025226 Bacteria 3865
41 Ga0209672_100030 3300025228 Bacteria 337051
42 Ga0209147_100036 3300025229 Bacteria 337052
43 Ga0209258_100056 3300025242 Bacteria 337051
44 Ga0209148_1000105 3300025254 Bacteria 210795
45 Ga0209233_1001583 3300025261 Bacteria 8907
46 Ga0209455_1000061 3300025272 Bacteria 337052
47 Ga0209130_1017100 3300025284 Bacteria 1737
48 Ga0209025_1000026 3300025294 Bacteria 519850
49 Ga0209025_1002115 3300025294 Bacteria 22379
50 Ga0207426_1000128 3300025302 Bacteria 211383
51 Ga0207655_1004834 3300025728 Bacteria 9364
52 Ga0207695_10000255 3300025913 Bacteria 136470
53 Ga0207695_10000609 3300025913 Bacteria 71895
54 Ga0207709_10141101 3300025935 Bacteria 1656
55 Ga0209281_1000091 3300027111 Bacteria 242588
56 Ga0209281_1020625 3300027111 Bacteria 1285
57 Ga0316183_1001933 3300030742 Bacteria 6001
58 Ga0307408_100254684 3300031548 Bacteria 1449
59 Ga0307405_10001302 3300031731 Bacteria 10424
60 Ga0307405_10004925 3300031731 Bacteria 6376
61 Ga0307413_10093731 3300031824 Bacteria 1963
62 Ga0307407_10022728 3300031903 Bacteria 3259
63 Ga0307412_10002287 3300031911 Bacteria 10604
64 Ga0307412_10052601 3300031911 Bacteria 2697
65 Ga0307409_100021507 3300031995 Bacteria 4424
66 Ga0307416_100525305 3300032002 Bacteria 1252
67 Ga0307414_10090368 3300032004 Bacteria 2272
68 Ga0307414_10344692 3300032004 Bacteria 1276
69 Ga0307411_10044869 3300032005 Bacteria 2839
70 Ga0315911_1000006 3300033442 Bacteria 414563
71 Ga0395899_0023341 3300037312 Bacteria 4686
72 Ga0395900_0126545 3300037418 Bacteria 2621
73 Ga0395900_0655564 3300037418 Bacteria 986
74 Ga0436361_0706000 3300039447 Bacteria 19858
75 Ga0436361_0945239 3300039447 Bacteria 3469
76 Ga0439451_032451 3300042009 Bacteria 1050
77 Ga0466969_0012728 3300044656 Bacteria 4432
78 Ga0466969_0224406 3300044656 Bacteria 854
79 Ga0466972_0015258 3300044658 Bacteria 3841
80 Ga0466966_0018463 3300044684 Bacteria 4598
81 Ga0466961_0000279 3300044693 Bacteria 34067
82 Ga0466961_0018097 3300044693 Bacteria 4530
83 Ga0466961_0110075 3300044693 Bacteria 1733
84 Ga0466963_0060054 3300044694 Bacteria 2539
85 Ga0466970_0174593 3300044765 Bacteria 1191
86 Ga0466957_0000261 3300044842 Bacteria 25375
87 Ga0466957_0131990 3300044842 Bacteria 1601
88 Ga0466959_0004125 3300045049 Bacteria 9682
89 Ga0466967_0095907 3300045976 Bacteria 2705
90 Ga0495617_039494 3300046452 Bacteria 1579
91 Ga0495592_0118007 3300046454 Bacteria 1870
92 Ga0495603_0026978 3300046455 Bacteria 3468
93 Ga0495590_0022530 3300046457 Bacteria 2228
94 Ga0495591_011192 3300046458 Bacteria 3414
95 Ga0495641_0029071 3300046461 Bacteria 2667
96 Ga0495653_0010432 3300046463 Bacteria 7600
97 Ga0495653_0049001 3300046463 Bacteria 3257
98 Ga0495650_0001024 3300046471 Bacteria 31397
99 Ga0495650_0004746 3300046471 Bacteria 9143
100 Ga0495580_0012445 3300046472 Bacteria 6522
101 Ga0495580_0018557 3300046472 Bacteria 5177
102 Ga0495605_0001283 3300046474 Bacteria 16647
103 Ga0495605_0051541 3300046474 Bacteria 2004
104 Ga0495605_0054241 3300046474 Bacteria 1942
105 Ga0495605_0057712 3300046474 Bacteria 1868
106 Ga0495605_0074592 3300046474 Bacteria 1596
107 Ga0495662_0025159 3300046476 Bacteria 2874
108 Ga0495664_0004556 3300046477 Bacteria 7584
109 Ga0495584_0011329 3300046491 Bacteria 4566
110 Ga0495585_0001868 3300046492 Bacteria 15894
111 Ga0495596_0004554 3300046500 Bacteria 6738
112 Ga0495596_0004861 3300046500 Bacteria 6454
113 Ga0495607_0016510 3300046501 Bacteria 4762
114 Ga0495583_0000078 3300046506 Bacteria 171719
115 Ga0495583_0001047 3300046506 Bacteria 31180
116 Ga0495583_0012420 3300046506 Bacteria 4819
117 Ga0495606_0000504 3300046507 Bacteria 63622
118 Ga0495606_0018718 3300046507 Bacteria 5182
119 Ga0495606_0063246 3300046507 Bacteria 2359
120 Ga0495608_0041554 3300046511 Bacteria 3076
121 Ga0495616_0004215 3300046513 Bacteria 9103
122 Ga0495618_0030690 3300046514 Bacteria 3358
123 Ga0495620_0009615 3300046515 Bacteria 5132
124 Ga0495628_0016322 3300046516 Bacteria 6195
125 Ga0495631_0021606 3300046518 Bacteria 2996
126 Ga0495632_0001095 3300046519 Bacteria 23188
127 Ga0495637_0001115 3300046520 Bacteria 16443
128 Ga0495643_0001790 3300046522 Bacteria 18401
129 Ga0495643_0027824 3300046522 Bacteria 3173
130 Ga0495644_0009931 3300046523 Bacteria 3666
131 Ga0495644_0048661 3300046523 Bacteria 1592
132 Ga0495648_0001661 3300046524 Bacteria 21568
133 Ga0495648_0008821 3300046524 Bacteria 7888
134 Ga0495648_0072289 3300046524 Bacteria 1996
135 Ga0495648_0162599 3300046524 Bacteria 1152
136 Ga0495666_0023333 3300046526 Bacteria 3059
137 Ga0495652_0071306 3300046529 Bacteria 2900
138 Ga0495652_0523303 3300046529 Bacteria 819
139 Ga0495654_0048457 3300046530 Bacteria 2084
140 Ga0495654_0149638 3300046530 Bacteria 1033
141 Ga0495665_0039663 3300046531 Bacteria 2507
142 Ga0495640_0049880 3300046533 Bacteria 2884
143 Ga0495586_0113078 3300046535 Bacteria 1512
144 Ga0495587_0012063 3300046536 Bacteria 5458
145 Ga0495609_0000536 3300046538 Bacteria 30234
146 Ga0495633_0003995 3300046558 Bacteria 9551
147 Ga0495667_0279161 3300046559 Bacteria 1060
148 Ga0495656_0008926 3300046615 Bacteria 3595
149 Ga0495668_0003840 3300046616 Bacteria 10995
150 Ga0495668_0013176 3300046616 Bacteria 4889
151 Ga0495634_0050945 3300046642 Bacteria 2778
152 Ga0495625_0001167 3300046660 Bacteria 33819
153 Ga0495625_0286112 3300046660 Bacteria 1059
154 Ga0495625_0480716 3300046660 Bacteria 762
155 Ga0495635_0044635 3300046663 Bacteria 3057
156 Ga0495661_0001297 3300046665 Bacteria 21344
157 Ga0495661_0051777 3300046665 Bacteria 2477
158 Ga0495657_0030973 3300046675 Bacteria 3742
159 Ga0495599_0065809 3300046678 Bacteria 2264
160 Ga0495599_0215743 3300046678 Bacteria 1175
161 Ga0495646_0048663 3300046680 Bacteria 2574
162 Ga0495646_0115556 3300046680 Bacteria 1523
163 Ga0495669_0004883 3300046684 Bacteria 5564
164 Ga0495613_0004717 3300046689 Bacteria 10231
165 Ga0495624_0052610 3300046690 Bacteria 2572
166 Ga0495670_0136329 3300046691 Bacteria 1281
167 Ga0495671_0001368 3300046692 Bacteria 16546
168 Ga0495671_0027836 3300046692 Bacteria 2915
169 Ga0495671_0112815 3300046692 Bacteria 1327
170 Ga0495671_0155898 3300046692 Bacteria 1111
171 Ga0495649_0008961 3300046694 Bacteria 5981
172 Ga0495649_0018959 3300046694 Bacteria 3865
173 Ga0495649_0023529 3300046694 Bacteria 3441
174 Ga0495649_0033247 3300046694 Bacteria 2839
175 Ga0495649_0034550 3300046694 Bacteria 2782
176 Ga0495589_0027050 3300046794 Bacteria 2902
177 Ga0495589_0088524 3300046794 Bacteria 1503
178 Ga0495600_0019246 3300046809 Bacteria 4358
179 Ga0495660_0000072 3300046810 Bacteria 109692
180 Ga0495660_0105508 3300046810 Bacteria 1444
181 Ga0495604_0058748 3300047317 Bacteria 2952
182 Ga0495674_0140228 3300047319 Bacteria 2032
183 Ga0495672_0002721 3300047320 Bacteria 15870
184 Ga0495672_0070060 3300047320 Bacteria 1988
185 Ga0495672_0151515 3300047320 Bacteria 1202
186 Ga0495672_0157371 3300047320 Bacteria 1172
187 Ga0495676_0063514 3300047321 Bacteria 2877
188 Ga0495680_0009598 3300047322 Bacteria 8690
189 Ga0495680_0188713 3300047322 Bacteria 1484
190 Ga0495683_0008512 3300047323 Bacteria 5485
191 Ga0495683_0038148 3300047323 Bacteria 2433
192 Ga0495683_0053950 3300047323 Bacteria 2004
193 Ga0495687_010208 3300047443 Bacteria 5166
194 Ga0495677_0000905 3300047445 Bacteria 11921
195 Ga0495679_000074 3300047446 Bacteria 95881
196 Ga0495679_000758 3300047446 Bacteria 20566
197 Ga0495673_0003160 3300047469 Bacteria 11018
198 Ga0495673_0008312 3300047469 Bacteria 5851
199 Ga0495681_0000066 3300047470 Bacteria 97917
200 Ga0495593_0094639 3300047673 Bacteria 1536
201 Ga0495602_0027696 3300048088 Bacteria 5441
202 Ga0495602_0117948 3300048088 Bacteria 2141
203 Ga0495614_0009136 3300048089 Bacteria 4394
204 Ga0495626_0000992 3300048091 Bacteria 24369
205 Ga0495626_0038205 3300048091 Bacteria 2277
206 Ga0496100_0000047 3300048903 Bacteria 76930
207 Ga0496101_0000269 3300048904 Bacteria 36730
208 Ga0496102_0000138 3300048905 Bacteria 98703
209 Ga0496103_0014178 3300048906 Bacteria 4731
210 Ga0496104_0023693 3300048907 Bacteria 5646
211 Ga0496104_0049663 3300048907 Bacteria 3956
212 Ga0496105_0006743 3300048908 Bacteria 8829
213 Ga0496116_0154917 3300048919 Bacteria 1266
214 Ga0496117_0000245 3300048920 Bacteria 102799
215 Ga0496117_0024610 3300048920 Bacteria 4756
216 Ga0496118_0006975 3300048921 Bacteria 12189
217 Ga0496118_0020668 3300048921 Bacteria 5830
218 Ga0496119_0000048 3300048922 Bacteria 185846
219 Ga0496119_0017405 3300048922 Bacteria 5406
220 Ga0496120_0000133 3300048923 Bacteria 126194
221 Ga0496121_0010951 3300048924 Bacteria 10129
222 Ga0496121_0080141 3300048924 Bacteria 2590
223 Ga0496121_0340008 3300048924 Bacteria 1003
224 Ga0496121_0396551 3300048924 Bacteria 905
225 Ga0496122_0017689 3300048925 Bacteria 6641
226 Ga0496126_0012187 3300048929 Bacteria 8824
227 Ga0496126_0068420 3300048929 Bacteria 3170
228 Ga0496126_0248864 3300048929 Bacteria 1482
229 Ga0495678_018300 3300049459 Bacteria 3153
230 Ga0495678_047565 3300049459 Bacteria 1678
231 Ga0495678_139058 3300049459 Bacteria 796
232 Ga0495682_0000059 3300049460 Bacteria 102351
233 Ga0495682_0038287 3300049460 Bacteria 1762
234 Ga0501033_0004237 3300049570 Bacteria 11539
235 Ga0501047_0162878 3300049581 Bacteria 2102
236 nmdc:mga0yw44_36493_c1 3300050492 Bacteria 2896
237 nmdc:mga0sz30_89327_c1 3300050516 Bacteria 1339
238 Ga0500572_000449 3300053111 Bacteria 14311
239 Ga0500618_003614 3300053125 Bacteria 5242
240 Ga0500559_0001169 3300053136 Bacteria 15735
241 Ga0500559_0125780 3300053136 Bacteria 1195
242 Ga0500577_0083115 3300053142 Bacteria 1281
243 Ga0500616_0157260 3300053153 Bacteria 1045
244 Ga0500622_0024835 3300053156 Bacteria 3169
245 Ga0500649_183366 3300053722 Bacteria 703
246 2881414972 2881412998 Bacteria 6492157
247 2501070467 2501025501 Bacteria 7768574
248 2501085553 2501025502 Bacteria 9641094
249 2501409506 2501025504 Bacteria 8008976
250 2510248601 2510065045 Bacteria 7761063
251 2511093192 2510917013 Bacteria 9951648
252 2511099046 2510917014 Bacteria 8296963
253 2511108852 2510917015 Bacteria 7950052
254 2513641314 2513237094 Bacteria 8789602
255 2513657934 2513237096 Bacteria 8722461
256 2513855631 2513237137 Bacteria 9558895
257 2513919973 2513237145 Bacteria 8979722
258 2513962098 2513237151 Bacteria 6309801
259 2516020990 2515154189 Bacteria 9629850
260 2517892174 2517572143 Bacteria 9484767
261 2519461841 2519103095 Bacteria 6629912
262 2585293812 2582581311 Bacteria 6763856
263 2599747926 2599185240 Bacteria 7968121
264 2599767833 2599185248 Bacteria 6696816
265 2599887851 2599185289 Bacteria 6778765
266 2599899458 2599185291 Bacteria 6775623
267 2599963519 2599185305 Bacteria 6748700
268 2599966381 2599185306 Bacteria 6637356
269 2599977230 2599185308 Bacteria 6621546
270 2600009326 2599185313 Bacteria 6658188
271 2600011337 2599185314 Bacteria 6621749
272 2600020256 2599185315 Bacteria 6771107
273 2600044223 2599185319 Bacteria 6637840
274 2600054747 2599185321 Bacteria 6764560
275 2600065350 2599185323 Bacteria 6688755
276 2600073290 2599185324 Bacteria 6590677
277 2600209923 2599185355 Bacteria 7968906
278 2624482199 2623620443 Bacteria 6427864
279 2652547977 2651869719 Bacteria 6047974
280 2671091962 2667528170 Bacteria 6786960
281 2671120568 2667528175 Bacteria 7532676
282 2676741351 2675903129 Bacteria 7964495
283 2678266465 2675903515 Bacteria 6580491
284 2719642972 2718217991 Bacteria 7829542
285 2745007695 2744054620 Bacteria 6551379
286 2793073351 2791355197 Bacteria 8420563
287 2808972358 2808606384 Bacteria 8474373
288 2809007187 2808606390 Bacteria 8476311
289 2809014325 2808606391 Bacteria 8308166
290 2817258707 2816332253 Bacteria 6764532
291 2817280863 2816332256 Bacteria 6891714
292 2817453400 2816332286 Bacteria 6853759
293 2819636670 2818991452 Bacteria 8442785
294 2834644411 2834641062 Bacteria 5559922
295 2841964213 2841957949 Bacteria 8652217
296 2842325361 2842324504 Bacteria 9364110
297 2842349640 2842348783 Bacteria 9002918
298 2842455122 2842454564 Bacteria 8730687
299 2842820434 2842815866 Bacteria 5947510
300 2842849062 2842849001 Bacteria 5924277
301 2842855934 2842854478 Bacteria 6143501
302 2857366132 2857357740 Bacteria 9937880
303 2863423353 2863421361 Bacteria 7300805
304 2870069612 2870068957 Bacteria 8925310
305 2881368629 2881364244 Bacteria 7710352
306 2885382691 2885374607 Bacteria 8927485
307 2885417184 2885409591 Bacteria 9235467
308 2903755475 2903748898 Bacteria 9972761
309 2904571450 2904564687 Bacteria 7609577
310 2904578575 2904571731 Bacteria 7608790
311 2904696101 2904690495 Bacteria 9412302
312 2906617304
313 2906642685 2906635258 Bacteria 8601019
314 2906666138 2906660503 Bacteria 8595048
315 2908742450 2908739725 Bacteria 8628932
316 2922430521
317 2928178257 2928170801 Bacteria 8785406
318 2928536854 2928536128 Bacteria 7657547
319 2929203663 2929199973 Bacteria 7260745
320 2945933273 2945928738 Bacteria 6053221
321 3005480438 3005474847 Bacteria 9259049
322 3005587843 3005587118 Bacteria 7794411
323 642598446 642555112 Bacteria 8676562
324 8003404183 8003400568 Bacteria 5535898
325 8019556513 8019555841 Bacteria 9642137
326 8019568797 8019565922 Bacteria 9639779
327 8020812446 8020807995 Bacteria 6801506
328 8020954161 8020953355 Bacteria 7439080
329 8021124557 8021120328 Bacteria 8782274
330 8040169418 8040167225 Bacteria 6542727
331 8040173813 8040173305 Bacteria 6827067
332 8054288726 8054285046 Bacteria 6919322
333 8055306032 8055301274 Bacteria 8587385
334 8056691301 8056689827 Bacteria 6712655
335 MRS1b_contig_4730273
336 JGI25151J46595_10000159
337 JGI25151J46595_10018434
338 rootH2_10250857
339 rootL2_10279818
340 Ga0055532_1000239
341 Ga0055527_1006604
342 Ga0055535_1000288
343 Ga0055542_1000258
344 Ga0055529_1000191
345 Ga0065165_1000329
346 Ga0065165_1000348
347 Ga0065714_10003726
348 Ga0065712_10067775
349 Ga0070676_10172072
350 Ga0070663_100056249
351 Ga0070706_100348273
352 Ga0075364_10056842
353 Ga0075369_10031130
354 Ga0079104_1000306
355 Ga0079104_1002837
356 Ga0105251_10120311
357 Ga0105244_10028699
358 Ga0105244_10063265
359 Ga0105240_10000393
360 Ga0105240_10000405
361 Ga0105243_10087663
362 Ga0105237_10634955
363 Ga0105147_102164
364 Ga0105239_10000070
365 Ga0105246_10038144
366 Ga0163162_10091173
367 Ga0157375_10633225
368 Ga0182006_1005246
369 Ga0182007_10002498
370 Ga0163161_10019479
371 Ga0213872_10005891
372 Ga0213872_10013768
373 Ga0209566_100220
374 Ga0209674_102528
375 Ga0209672_100030
376 Ga0209147_100036
377 Ga0209258_100056
378 Ga0209148_1000105
379 Ga0209233_1001583
380 Ga0209455_1000061
381 Ga0209130_1017100
382 Ga0209025_1000026
383 Ga0209025_1002115
384 Ga0207426_1000128
385 Ga0207655_1004834
386 Ga0207695_10000255
387 Ga0207695_10000609
388 Ga0207709_10141101
389 Ga0209281_1000091
390 Ga0209281_1020625
391 Ga0316183_1001933
392 Ga0307408_100254684
393 Ga0307405_10001302
394 Ga0307405_10004925
395 Ga0307413_10093731
396 Ga0307407_10022728
397 Ga0307412_10002287
398 Ga0307412_10052601
399 Ga0307409_100021507
400 Ga0307416_100525305
401 Ga0307414_10090368
402 Ga0307414_10344692
403 Ga0307411_10044869
404 Ga0315911_1000006
405 Ga0395899_0023341
406 Ga0395900_0126545
407 Ga0395900_0655564
408 Ga0436361_0706000
409 Ga0436361_0945239
410 Ga0439451_032451
411 Ga0466969_0012728
412 Ga0466969_0224406
413 Ga0466972_0015258
414 Ga0466966_0018463
415 Ga0466961_0000279
416 Ga0466961_0018097
417 Ga0466961_0110075
418 Ga0466963_0060054
419 Ga0466970_0174593
420 Ga0466957_0000261
421 Ga0466957_0131990
422 Ga0466959_0004125
423 Ga0466967_0095907
424 Ga0495617_039494
425 Ga0495592_0118007
426 Ga0495603_0026978
427 Ga0495590_0022530
428 Ga0495591_011192
429 Ga0495641_0029071
430 Ga0495653_0010432
431 Ga0495653_0049001
432 Ga0495650_0001024
433 Ga0495650_0004746
434 Ga0495580_0012445
435 Ga0495580_0018557
436 Ga0495605_0001283
437 Ga0495605_0051541
438 Ga0495605_0054241
439 Ga0495605_0057712
440 Ga0495605_0074592
441 Ga0495662_0025159
442 Ga0495664_0004556
443 Ga0495584_0011329
444 Ga0495585_0001868
445 Ga0495596_0004554
446 Ga0495596_0004861
447 Ga0495607_0016510
448 Ga0495583_0000078
449 Ga0495583_0001047
450 Ga0495583_0012420
451 Ga0495606_0000504
452 Ga0495606_0018718
453 Ga0495606_0063246
454 Ga0495608_0041554
455 Ga0495616_0004215
456 Ga0495618_0030690
457 Ga0495620_0009615
458 Ga0495628_0016322
459 Ga0495631_0021606
460 Ga0495632_0001095
461 Ga0495637_0001115
462 Ga0495643_0001790
463 Ga0495643_0027824
464 Ga0495644_0009931
465 Ga0495644_0048661
466 Ga0495648_0001661
467 Ga0495648_0008821
468 Ga0495648_0072289
469 Ga0495648_0162599
470 Ga0495666_0023333
471 Ga0495652_0071306
472 Ga0495652_0523303
473 Ga0495654_0048457
474 Ga0495654_0149638
475 Ga0495665_0039663
476 Ga0495640_0049880
477 Ga0495586_0113078
478 Ga0495587_0012063
479 Ga0495609_0000536
480 Ga0495633_0003995
481 Ga0495667_0279161
482 Ga0495656_0008926
483 Ga0495668_0003840
484 Ga0495668_0013176
485 Ga0495634_0050945
486 Ga0495625_0001167
487 Ga0495625_0286112
488 Ga0495625_0480716
489 Ga0495635_0044635
490 Ga0495661_0001297
491 Ga0495661_0051777
492 Ga0495657_0030973
493 Ga0495599_0065809
494 Ga0495599_0215743
495 Ga0495646_0048663
496 Ga0495646_0115556
497 Ga0495669_0004883
498 Ga0495613_0004717
499 Ga0495624_0052610
500 Ga0495670_0136329
501 Ga0495671_0001368
502 Ga0495671_0027836
503 Ga0495671_0112815
504 Ga0495671_0155898
505 Ga0495649_0008961
506 Ga0495649_0018959
507 Ga0495649_0023529
508 Ga0495649_0033247
509 Ga0495649_0034550
510 Ga0495589_0027050
511 Ga0495589_0088524
512 Ga0495600_0019246
513 Ga0495660_0000072
514 Ga0495660_0105508
515 Ga0495604_0058748
516 Ga0495674_0140228
517 Ga0495672_0002721
518 Ga0495672_0070060
519 Ga0495672_0151515
520 Ga0495672_0157371
521 Ga0495676_0063514
522 Ga0495680_0009598
523 Ga0495680_0188713
524 Ga0495683_0008512
525 Ga0495683_0038148
526 Ga0495683_0053950
527 Ga0495687_010208
528 Ga0495677_0000905
529 Ga0495679_000074
530 Ga0495679_000758
531 Ga0495673_0003160
532 Ga0495673_0008312
533 Ga0495681_0000066
534 Ga0495593_0094639
535 Ga0495602_0027696
536 Ga0495602_0117948
537 Ga0495614_0009136
538 Ga0495626_0000992
539 Ga0495626_0038205
540 Ga0496100_0000047
541 Ga0496101_0000269
542 Ga0496102_0000138
543 Ga0496103_0014178
544 Ga0496104_0023693
545 Ga0496104_0049663
546 Ga0496105_0006743
547 Ga0496116_0154917
548 Ga0496117_0000245
549 Ga0496117_0024610
550 Ga0496118_0006975
551 Ga0496118_0020668
552 Ga0496119_0000048
553 Ga0496119_0017405
554 Ga0496120_0000133
555 Ga0496121_0010951
556 Ga0496121_0080141
557 Ga0496121_0340008
558 Ga0496121_0396551
559 Ga0496122_0017689
560 Ga0496126_0012187
561 Ga0496126_0068420
562 Ga0496126_0248864
563 Ga0495678_018300
564 Ga0495678_047565
565 Ga0495678_139058
566 Ga0495682_0000059
567 Ga0495682_0038287
568 Ga0501033_0004237
569 Ga0501047_0162878
570 nmdc:mga0yw44_36493_c1
571 nmdc:mga0sz30_89327_c1
572 Ga0500572_000449
573 Ga0500618_003614
574 Ga0500559_0001169
575 Ga0500559_0125780
576 Ga0500577_0083115
577 Ga0500616_0157260
578 Ga0500622_0024835
579 Ga0500649_183366
580 2881414972
581 2501070467
582 2501085553
583 2501409506
584 2510248601
585 2511093192
586 2511099046
587 2511108852
588 2513641314
589 2513657934
590 2513855631
591 2513919973
592 2513962098
593 2516020990
594 2517892174
595 2519461841
596 2585293812
597 2599747926
598 2599767833
599 2599887851
600 2599899458
601 2599963519
602 2599966381
603 2599977230
604 2600009326
605 2600011337
606 2600020256
607 2600044223
608 2600054747
609 2600065350
610 2600073290
611 2600209923
612 2624482199
613 2652547977
614 2671091962
615 2671120568
616 2676741351
617 2678266465
618 2719642972
619 2745007695
620 2793073351
621 2808972358
622 2809007187
623 2809014325
624 2817258707
625 2817280863
626 2817453400
627 2819636670
628 2834644411
629 2841964213
630 2842325361
631 2842349640
632 2842455122
633 2842820434
634 2842849062
635 2842855934
636 2857366132
637 2863423353
638 2870069612
639 2881368629
640 2885382691
641 2885417184
642 2903755475
643 2904571450
644 2904578575
645 2904696101
646 2906617304
647 2906642685
648 2906666138
649 2908742450
650 2922430521
651 2928178257
652 2928536854
653 2929203663
654 2945933273
655 3005480438
656 3005587843
657 642598446
658 8003404183
659 8019556513
660 8019568797
661 8020812446
662 8020954161
663 8021124557
664 8040169418
665 8040173813
666 8054288726
667 8055306032
668 8056691301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

158

230

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

26

105

0.91

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

165

234

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

36

106

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

30

111

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.975 17 222
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9612 17 222
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9585 17 219
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.945 17 219
7miq-assembly1.cif.gz_B crystal structure of a glutathione s-transferase class gtt2 of vibrio parahaemolyticus (vpgstt2) 0.8949 17 226
ID Description Score Start End Superfamily
3ibhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9764 17 97 3.40.30.10
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9695 99 216 1.20.1050.10
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9615 99 216 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9502 99 216 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9425 99 216 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7Z0I9C3-F1-model_v4 deleted 0.9785 17 231
AF-A7A0K1-F1-model_v4 Glutathione S-transferase 0.9701 15 228 GO:0005737
GO:0016740
AF-A0A316HTL9-F1-model_v4 Glutathione S-transferase-like protein 0.966 110 221 GO:0016740
AF-A0A6P1LAK6-F1-model_v4 Uncharacterized protein 0.964 17 220
AF-A0A7I9FHC9-F1-model_v4 deleted 0.9629 44 228

Map