F411999

General Info

Members Datasets Scaffolds Average Seq Length
334 260 668 159

Family's Representative Sequence

Representative Sequence 3300053129|Ga0500628_044021|Ga0500628_044021_53_523
Length 156
Sequence MSGQGRPAASAAPDAAGLTVGVVAAGWHAKITDQLLARALQACDDSGATATVVRVPGSLEIPVIAQALARRCDAVVALGAVIKGETAHFEYVCDSVTAGLTRISLDEETPVGNGVLTCETLDQALDRSGLPGSKEDKGYESAIAALETALLLRDLH

Samples

Sample ID Description Type Environment
1 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
143 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
237 2582580736 Prauserella sp. Am3 Isolate Unclassified
238 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
239 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
240 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
241 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
242 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
243 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
244 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
245 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
246 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
247 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
248 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
249 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
250 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
251 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
252 2891562705 Microbispora tritici MT50 Isolate Unclassified
253 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
254 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
255 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
256 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
257 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
258 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
259 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
260 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 1.2
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 4.79
Rhizosphere 81.74
Stem 0
Stem Tuber 0.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500628_044021 3300053129 Bacteria 1032
2 rootH2_10134769 3300003320 Bacteria 1156
3 JGI25405J52794_10016643 3300003911 Bacteria 1454
4 Ga0070658_10311439 3300005327 Bacteria 1343
5 Ga0070676_10584089 3300005328 Bacteria 804
6 Ga0070670_100479543 3300005331 Bacteria 1104
7 Ga0070670_101115812 3300005331 Bacteria 719
8 Ga0070677_10434196 3300005333 Bacteria 699
9 Ga0068869_100064458 3300005334 Bacteria 2695
10 Ga0070680_101301517 3300005336 Bacteria 629
11 Ga0070682_100077313 3300005337 Bacteria 2144
12 Ga0070682_100138620 3300005337 Bacteria 1655
13 Ga0070682_100369162 3300005337 Bacteria 1075
14 Ga0068868_100037086 3300005338 Bacteria 3777
15 Ga0068868_100439573 3300005338 Bacteria 1132
16 Ga0068868_100456258 3300005338 Bacteria 1112
17 Ga0068868_101080318 3300005338 Bacteria 737
18 Ga0070660_100503359 3300005339 Bacteria 1008
19 Ga0070689_100394496 3300005340 Bacteria 1169
20 Ga0070687_100198660 3300005343 Bacteria 1213
21 Ga0070661_100174911 3300005344 Bacteria 1631
22 Ga0070692_10027582 3300005345 Bacteria 2816
23 Ga0070668_100002709 3300005347 Bacteria 13041
24 Ga0070668_100102379 3300005347 Bacteria 2270
25 Ga0070669_101279890 3300005353 Bacteria 635
26 Ga0070675_101566664 3300005354 Bacteria 608
27 Ga0070671_100756283 3300005355 Bacteria 845
28 Ga0070674_100063870 3300005356 Bacteria 2578
29 Ga0070674_100162883 3300005356 Bacteria 1694
30 Ga0070673_100880342 3300005364 Bacteria 830
31 Ga0070688_100044569 3300005365 Bacteria 2737
32 Ga0070659_100195698 3300005366 Bacteria 1663
33 Ga0070667_100107492 3300005367 Bacteria 2416
34 Ga0070709_10001619 3300005434 Bacteria 12163
35 Ga0070714_100018411 3300005435 Bacteria 5673
36 Ga0070714_101232619 3300005435 Bacteria 730
37 Ga0070713_100006825 3300005436 Bacteria 7955
38 Ga0070713_100453511 3300005436 Bacteria 1205
39 Ga0070710_10000341 3300005437 Bacteria 22161
40 Ga0070710_10631491 3300005437 Bacteria 749
41 Ga0070701_10016126 3300005438 Bacteria 3466
42 Ga0070711_100004874 3300005439 Bacteria 7967
43 Ga0070705_100348319 3300005440 Bacteria 1079
44 Ga0070700_100034995 3300005441 Bacteria 3036
45 Ga0070700_100195565 3300005441 Bacteria 1417
46 Ga0070663_100006213 3300005455 Bacteria 7160
47 Ga0070663_100185948 3300005455 Bacteria 1614
48 Ga0070663_100466240 3300005455 Bacteria 1043
49 Ga0070678_100073848 3300005456 Bacteria 2561
50 Ga0070678_100477523 3300005456 Bacteria 1096
51 Ga0070662_101338351 3300005457 Bacteria 617
52 Ga0068867_101258191 3300005459 Bacteria 682
53 Ga0070685_10071133 3300005466 Bacteria 2061
54 Ga0070707_100043694 3300005468 Bacteria 4288
55 Ga0070684_100311668 3300005535 Bacteria 1445
56 Ga0070684_101032645 3300005535 Bacteria 772
57 Ga0070672_100484074 3300005543 Bacteria 1069
58 Ga0070693_100626410 3300005547 Bacteria 779
59 Ga0070665_100345067 3300005548 Bacteria 1494
60 Ga0070665_100490540 3300005548 Bacteria 1239
61 Ga0070704_100531400 3300005549 Bacteria 1025
62 Ga0068855_100583908 3300005563 Bacteria 1207
63 Ga0070664_100445298 3300005564 Bacteria 1188
64 Ga0070664_101012204 3300005564 Bacteria 781
65 Ga0070664_101563117 3300005564 Bacteria 625
66 Ga0068857_100300402 3300005577 Bacteria 1480
67 Ga0068857_100540955 3300005577 Bacteria 1096
68 Ga0068854_100046104 3300005578 Bacteria 3103
69 Ga0068854_100230545 3300005578 Bacteria 1469
70 Ga0068854_100400787 3300005578 Bacteria 1135
71 Ga0068856_100361415 3300005614 Bacteria 1470
72 Ga0068859_100536608 3300005617 Bacteria 1264
73 Ga0068859_101251495 3300005617 Bacteria 817
74 Ga0068864_100153003 3300005618 Bacteria 2091
75 Ga0068864_100932219 3300005618 Bacteria 859
76 Ga0068851_10017347 3300005834 Bacteria 3456
77 Ga0068870_10762449 3300005840 Bacteria 673
78 Ga0068863_100024256 3300005841 Bacteria 5785
79 Ga0068863_100300370 3300005841 Bacteria 1557
80 Ga0068858_101025878 3300005842 Bacteria 809
81 Ga0068862_100046159 3300005844 Bacteria 3717
82 Ga0081455_10003821 3300005937 Bacteria 17186
83 Ga0070717_10018685 3300006028 Bacteria 5420
84 Ga0075364_10297903 3300006051 Bacteria 1098
85 Ga0070715_10036381 3300006163 Bacteria 2030
86 Ga0070716_100001565 3300006173 Bacteria 10276
87 Ga0068871_101309418 3300006358 Bacteria 682
88 Ga0075429_100098214 3300006880 Bacteria 2555
89 Ga0075429_100532785 3300006880 Bacteria 1029
90 Ga0068865_100359029 3300006881 Bacteria 1182
91 Ga0097620_100536594 3300006931 Bacteria 1264
92 Ga0097620_101251464 3300006931 Bacteria 817
93 Ga0111539_10450925 3300009094 Bacteria 1498
94 Ga0105245_10183920 3300009098 Bacteria 1998
95 Ga0105245_10569938 3300009098 Bacteria 1156
96 Ga0114129_12749094 3300009147 Bacteria 586
97 Ga0105243_10528922 3300009148 Bacteria 1123
98 Ga0105243_10955631 3300009148 Bacteria 856
99 Ga0105241_11102756 3300009174 Bacteria 747
100 Ga0105242_10547265 3300009176 Bacteria 1109
101 Ga0105248_10706243 3300009177 Bacteria 1138
102 Ga0105249_11200701 3300009553 Bacteria 830
103 Ga0105239_10412528 3300010375 Bacteria 1529
104 Ga0105239_10610021 3300010375 Bacteria 1245
105 Ga0105246_10603810 3300011119 Bacteria 949
106 Ga0157371_10500418 3300013102 Bacteria 897
107 Ga0157370_10215835 3300013104 Bacteria 1777
108 Ga0157370_10324106 3300013104 Bacteria 1421
109 Ga0157369_10528443 3300013105 Bacteria 1220
110 Ga0157369_10583681 3300013105 Bacteria 1154
111 Ga0157369_11552294 3300013105 Bacteria 673
112 Ga0157374_11041576 3300013296 Bacteria 838
113 Ga0157378_10930244 3300013297 Bacteria 901
114 Ga0163162_11035976 3300013306 Bacteria 928
115 Ga0157372_11163635 3300013307 Bacteria 892
116 Ga0163163_10630072 3300014325 Bacteria 1136
117 Ga0163163_10834876 3300014325 Bacteria 985
118 Ga0157380_10589696 3300014326 Bacteria 1098
119 Ga0157380_10755222 3300014326 Bacteria 984
120 Ga0157379_10016816 3300014968 Bacteria 6438
121 Ga0157379_10271729 3300014968 Bacteria 1542
122 Ga0157379_10308093 3300014968 Bacteria 1444
123 Ga0157376_10102838 3300014969 Bacteria 2500
124 Ga0157376_11678721 3300014969 Bacteria 670
125 Ga0197907_10817274 3300020069 Bacteria 1038
126 Ga0206353_11325953 3300020082 Bacteria 1092
127 Ga0213875_10004374 3300021388 Bacteria 7772
128 Ga0224712_10459176 3300022467 Bacteria 612
129 Ga0207656_10032164 3300025321 Bacteria 2178
130 Ga0207656_10471076 3300025321 Bacteria 636
131 Ga0207692_10000892 3300025898 Bacteria 10787
132 Ga0207642_10032636 3300025899 Bacteria 2195
133 Ga0207688_10045408 3300025901 Bacteria 2451
134 Ga0207685_10004873 3300025905 Bacteria 3470
135 Ga0207699_10000261 3300025906 Bacteria 28952
136 Ga0207645_10019935 3300025907 Bacteria 4390
137 Ga0207643_10027881 3300025908 Bacteria 3134
138 Ga0207643_10662288 3300025908 Bacteria 674
139 Ga0207705_10238880 3300025909 Bacteria 1383
140 Ga0207684_10008113 3300025910 Bacteria 9362
141 Ga0207693_10001993 3300025915 Bacteria 17917
142 Ga0207663_10014151 3300025916 Bacteria 4361
143 Ga0207662_10429985 3300025918 Bacteria 900
144 Ga0207657_10415016 3300025919 Bacteria 1058
145 Ga0207646_10003994 3300025922 Bacteria 16334
146 Ga0207646_10013558 3300025922 Bacteria 7788
147 Ga0207681_10455084 3300025923 Bacteria 1042
148 Ga0207694_10502423 3300025924 Bacteria 1015
149 Ga0207650_10101904 3300025925 Bacteria 2211
150 Ga0207650_10575464 3300025925 Bacteria 945
151 Ga0207659_10829612 3300025926 Bacteria 795
152 Ga0207687_10126006 3300025927 Bacteria 1923
153 Ga0207700_10000510 3300025928 Bacteria 22795
154 Ga0207700_10225412 3300025928 Bacteria 1591
155 Ga0207700_10327252 3300025928 Bacteria 1329
156 Ga0207664_10000311 3300025929 Bacteria 36120
157 Ga0207664_10068349 3300025929 Bacteria 2854
158 Ga0207664_10085199 3300025929 Bacteria 2579
159 Ga0207664_10089341 3300025929 Bacteria 2523
160 Ga0207644_10979800 3300025931 Bacteria 709
161 Ga0207690_10498920 3300025932 Bacteria 984
162 Ga0207706_10045868 3300025933 Bacteria 3871
163 Ga0207670_10716696 3300025936 Bacteria 829
164 Ga0207669_10106868 3300025937 Bacteria 1865
165 Ga0207704_10293351 3300025938 Bacteria 1242
166 Ga0207665_10007041 3300025939 Bacteria 7450
167 Ga0207691_10113393 3300025940 Bacteria 2409
168 Ga0207711_10618754 3300025941 Bacteria 1010
169 Ga0207689_10073256 3300025942 Bacteria 2814
170 Ga0207689_10415844 3300025942 Bacteria 1122
171 Ga0207679_10589589 3300025945 Bacteria 1000
172 Ga0207679_10893059 3300025945 Bacteria 813
173 Ga0207668_10780627 3300025972 Bacteria 844
174 Ga0207658_10084258 3300025986 Bacteria 2446
175 Ga0207677_10083579 3300026023 Bacteria 2298
176 Ga0207677_10277554 3300026023 Bacteria 1374
177 Ga0207677_10524345 3300026023 Bacteria 1028
178 Ga0207703_10498136 3300026035 Bacteria 1143
179 Ga0207639_11058485 3300026041 Bacteria 760
180 Ga0207639_11334746 3300026041 Bacteria 673
181 Ga0207678_10001596 3300026067 Bacteria 20859
182 Ga0207678_10038506 3300026067 Bacteria 4155
183 Ga0207678_10039406 3300026067 Bacteria 4101
184 Ga0207678_10348225 3300026067 Bacteria 1277
185 Ga0207708_10045999 3300026075 Bacteria 3325
186 Ga0207708_10161293 3300026075 Bacteria 1771
187 Ga0207702_10897175 3300026078 Bacteria 878
188 Ga0207641_10017966 3300026088 Bacteria 5793
189 Ga0207641_10051756 3300026088 Bacteria 3478
190 Ga0207641_10262146 3300026088 Bacteria 1619
191 Ga0207648_10222734 3300026089 Bacteria 1677
192 Ga0207674_10209780 3300026116 Bacteria 1897
193 Ga0207674_10400006 3300026116 Bacteria 1327
194 Ga0207675_100100765 3300026118 Bacteria 2721
195 Ga0207683_10149440 3300026121 Bacteria 2108
196 Ga0207683_10206423 3300026121 Bacteria 1787
197 Ga0207698_10644787 3300026142 Bacteria 1048
198 Ga0268266_10166307 3300028379 Bacteria 1998
199 Ga0268266_10277581 3300028379 Bacteria 1557
200 Ga0268265_10120783 3300028380 Bacteria 2158
201 Ga0316176_1071628 3300030732 Bacteria 1335
202 Ga0314311_1245174 3300030733 Bacteria 1627
203 Ga0316178_1169136 3300030735 Bacteria 1059
204 Ga0265762_1076479 3300030760 Bacteria 711
205 Ga0265327_10000062 3300031251 Bacteria 234320
206 Ga0307513_10133650 3300031456 Bacteria 2421
207 Ga0307509_10242404 3300031507 Bacteria 1594
208 Ga0307509_10439003 3300031507 Bacteria 1002
209 Ga0265313_10080252 3300031595 Bacteria 1483
210 Ga0307518_10000054 3300031838 Bacteria 76765
211 Ga0307507_10008648 3300033179 Bacteria 13959
212 Ga0307510_10095188 3300033180 Bacteria 2799
213 Ga0373934_0009586 3300035086 Bacteria 3630
214 Ga0373923_0006727 3300035111 Bacteria 3996
215 Ga0373936_0114908 3300035113 Bacteria 1145
216 Ga0373945_0026145 3300035116 Bacteria 2033
217 Ga0373953_0033284 3300035117 Bacteria 2015
218 Ga0373954_0049706 3300035118 Bacteria 1966
219 Ga0373956_0000784 3300035119 Bacteria 13160
220 Ga0373956_0016950 3300035119 Bacteria 3064
221 Ga0373957_0005126 3300035120 Bacteria 4046
222 Ga0373955_0077067 3300035172 Bacteria 1876
223 Ga0373935_0058616 3300035692 Bacteria 2460
224 Ga0373933_0023526 3300035724 Bacteria 3520
225 Ga0373947_0198106 3300035725 Bacteria 1313
226 Ga0373937_0070000 3300036401 Bacteria 3235
227 Ga0436364_0712122 3300037853 Bacteria 3547
228 Ga0436364_0880639 3300037853 Bacteria 8256
229 Ga0451802_0427879 3300041460 Bacteria 948
230 Ga0439449_0009077 3300042007 Bacteria 3772
231 Ga0466969_0108750 3300044656 Bacteria 1300
232 Ga0466972_0066664 3300044658 Bacteria 1720
233 Ga0466965_0180295 3300044683 Bacteria 1114
234 Ga0466965_0393452 3300044683 Bacteria 765
235 Ga0466963_0099391 3300044694 Bacteria 1990
236 Ga0466964_0622636 3300044706 Bacteria 594
237 Ga0466968_0000243 3300044735 Bacteria 17124
238 Ga0466970_0276251 3300044765 Bacteria 944
239 Ga0466957_0239092 3300044842 Bacteria 1204
240 Ga0466960_0779512 3300044901 Bacteria 578
241 Ga0466967_0017362 3300045976 Bacteria 5711
242 Ga0495592_0010395 3300046454 Bacteria 7021
243 Ga0495629_0911824 3300046459 Bacteria 575
244 Ga0495651_0026039 3300046462 Bacteria 4554
245 Ga0495653_0011580 3300046463 Bacteria 7200
246 Ga0495662_0201831 3300046476 Bacteria 980
247 Ga0495664_0054206 3300046477 Bacteria 2384
248 Ga0495608_0010948 3300046511 Bacteria 6322
249 Ga0495618_0010062 3300046514 Bacteria 5720
250 Ga0495630_0022416 3300046517 Bacteria 4663
251 Ga0495652_0116696 3300046529 Bacteria 2136
252 Ga0495665_0047190 3300046531 Bacteria 2285
253 Ga0495665_0325339 3300046531 Bacteria 785
254 Ga0495640_0110241 3300046533 Bacteria 1799
255 Ga0495586_0018167 3300046535 Bacteria 3741
256 Ga0495586_0414442 3300046535 Bacteria 776
257 Ga0495587_0043167 3300046536 Bacteria 2686
258 Ga0495667_0009055 3300046559 Bacteria 6765
259 Ga0495634_0046038 3300046642 Bacteria 2945
260 Ga0495635_0252863 3300046663 Bacteria 1187
261 Ga0495657_0050119 3300046675 Bacteria 2808
262 Ga0495623_0078234 3300046679 Bacteria 2050
263 Ga0495646_0021273 3300046680 Bacteria 4100
264 Ga0495600_0052249 3300046809 Bacteria 2668
265 Ga0495581_0165578 3300047315 Bacteria 1293
266 Ga0495604_0030695 3300047317 Bacteria 4267
267 Ga0495674_0082881 3300047319 Bacteria 2749
268 Ga0495680_0028597 3300047322 Bacteria 4569
269 Ga0495675_0129800 3300047444 Bacteria 1567
270 Ga0495602_0021150 3300048088 Bacteria 6411
271 Ga0496100_0001844 3300048903 Bacteria 10594
272 Ga0496101_0001084 3300048904 Bacteria 16133
273 Ga0496101_0527864 3300048904 Bacteria 933
274 Ga0496102_0000046 3300048905 Bacteria 184899
275 Ga0496102_0593231 3300048905 Bacteria 1031
276 Ga0496103_0000547 3300048906 Bacteria 30035
277 Ga0496104_0015433 3300048907 Bacteria 6918
278 Ga0496104_0489114 3300048907 Bacteria 1142
279 Ga0496105_0037839 3300048908 Bacteria 3974
280 Ga0496106_0110203 3300048909 Bacteria 2143
281 Ga0496107_0123821 3300048910 Bacteria 1905
282 Ga0496110_0103111 3300048913 Bacteria 2559
283 Ga0496110_0410680 3300048913 Bacteria 1234
284 Ga0496111_0445599 3300048914 Bacteria 955
285 Ga0496113_0396560 3300048916 Bacteria 1108
286 Ga0496116_0001888 3300048919 Bacteria 22637
287 Ga0496117_0000109 3300048920 Bacteria 184635
288 Ga0496118_0000132 3300048921 Bacteria 131401
289 Ga0496119_0000964 3300048922 Bacteria 36896
290 Ga0496120_0003908 3300048923 Bacteria 13020
291 Ga0496121_0030031 3300048924 Bacteria 5003
292 Ga0496122_0250065 3300048925 Bacteria 992
293 Ga0496124_0192572 3300048927 Bacteria 1558
294 Ga0496125_0030374 3300048928 Bacteria 4835
295 Ga0496126_0002772 3300048929 Bacteria 23096
296 Ga0501067_0175414 3300049583 Bacteria 1194
297 Ga0501075_0606234 3300049591 Bacteria 835
298 nmdc:mga00v17_18553_c1 3300050491 Bacteria 3954
299 nmdc:mga00v17_202336_c1 3300050491 Bacteria 1284
300 nmdc:mga09592_808725_c1 3300050508 Bacteria 792
301 nmdc:mga08y16_574635_c1 3300050511 Bacteria 1139
302 nmdc:mga08y16_93886_c1 3300050511 Bacteria 3125
303 nmdc:mga0n895_925898_c1 3300050512 Bacteria 856
304 Ga0495601_0065958 3300053077 Bacteria 2304
305 Ga0495601_0249874 3300053077 Bacteria 1158
306 Ga0495595_0008199 3300053084 Bacteria 4288
307 Ga0495619_0122636 3300053085 Bacteria 1782
308 Ga0500643_000352 3300053087 Bacteria 36502
309 Ga0500644_0071880 3300053088 Bacteria 1249
310 2523386760 2523231044 Bacteria 6434991
311 2583151156 2582580736 Bacteria 5325865
312 2586062313 2585427649 Bacteria 9053857
313 2739205174 2738543005 Bacteria 5278128
314 2753034985 2751185725 Bacteria 5740550
315 2753073953 2751185734 Bacteria 8863695
316 2753323502 2751185792 Bacteria 5739090
317 2791909941 2791354901 Bacteria 8322202
318 2795782699 2795385470 Bacteria 8317180
319 2795797807 2795385472 Bacteria 6627535
320 2809588516 2808606522 Bacteria 9488490
321 2856744327 2856741275 Bacteria 8096094
322 2866614525 2866612099 Bacteria 7543886
323 2873320814 2873314349 Bacteria 8512634
324 2891403101 2891395885 Bacteria 9251614
325 2891554580 2891554331 Bacteria 8812224
326 2891564644 2891562705 Bacteria 8039471
327 2899365313 2899359706 Bacteria 10940472
328 2899372917 2899370129 Bacteria 6781179
329 2915770337 2915768154 Bacteria 8424322
330 2917739506 2917736166 Bacteria 9690793
331 8003323904 8003314358 Bacteria 10575343
332 8047716871 8047710418 Bacteria 11023148
333 8055067345 8055066027 Bacteria 9479577
334 8055179758 8055172936 Bacteria 9305943
335 Ga0500628_044021
336 rootH2_10134769
337 JGI25405J52794_10016643
338 Ga0070658_10311439
339 Ga0070676_10584089
340 Ga0070670_100479543
341 Ga0070670_101115812
342 Ga0070677_10434196
343 Ga0068869_100064458
344 Ga0070680_101301517
345 Ga0070682_100077313
346 Ga0070682_100138620
347 Ga0070682_100369162
348 Ga0068868_100037086
349 Ga0068868_100439573
350 Ga0068868_100456258
351 Ga0068868_101080318
352 Ga0070660_100503359
353 Ga0070689_100394496
354 Ga0070687_100198660
355 Ga0070661_100174911
356 Ga0070692_10027582
357 Ga0070668_100002709
358 Ga0070668_100102379
359 Ga0070669_101279890
360 Ga0070675_101566664
361 Ga0070671_100756283
362 Ga0070674_100063870
363 Ga0070674_100162883
364 Ga0070673_100880342
365 Ga0070688_100044569
366 Ga0070659_100195698
367 Ga0070667_100107492
368 Ga0070709_10001619
369 Ga0070714_100018411
370 Ga0070714_101232619
371 Ga0070713_100006825
372 Ga0070713_100453511
373 Ga0070710_10000341
374 Ga0070710_10631491
375 Ga0070701_10016126
376 Ga0070711_100004874
377 Ga0070705_100348319
378 Ga0070700_100034995
379 Ga0070700_100195565
380 Ga0070663_100006213
381 Ga0070663_100185948
382 Ga0070663_100466240
383 Ga0070678_100073848
384 Ga0070678_100477523
385 Ga0070662_101338351
386 Ga0068867_101258191
387 Ga0070685_10071133
388 Ga0070707_100043694
389 Ga0070684_100311668
390 Ga0070684_101032645
391 Ga0070672_100484074
392 Ga0070693_100626410
393 Ga0070665_100345067
394 Ga0070665_100490540
395 Ga0070704_100531400
396 Ga0068855_100583908
397 Ga0070664_100445298
398 Ga0070664_101012204
399 Ga0070664_101563117
400 Ga0068857_100300402
401 Ga0068857_100540955
402 Ga0068854_100046104
403 Ga0068854_100230545
404 Ga0068854_100400787
405 Ga0068856_100361415
406 Ga0068859_100536608
407 Ga0068859_101251495
408 Ga0068864_100153003
409 Ga0068864_100932219
410 Ga0068851_10017347
411 Ga0068870_10762449
412 Ga0068863_100024256
413 Ga0068863_100300370
414 Ga0068858_101025878
415 Ga0068862_100046159
416 Ga0081455_10003821
417 Ga0070717_10018685
418 Ga0075364_10297903
419 Ga0070715_10036381
420 Ga0070716_100001565
421 Ga0068871_101309418
422 Ga0075429_100098214
423 Ga0075429_100532785
424 Ga0068865_100359029
425 Ga0097620_100536594
426 Ga0097620_101251464
427 Ga0111539_10450925
428 Ga0105245_10183920
429 Ga0105245_10569938
430 Ga0114129_12749094
431 Ga0105243_10528922
432 Ga0105243_10955631
433 Ga0105241_11102756
434 Ga0105242_10547265
435 Ga0105248_10706243
436 Ga0105249_11200701
437 Ga0105239_10412528
438 Ga0105239_10610021
439 Ga0105246_10603810
440 Ga0157371_10500418
441 Ga0157370_10215835
442 Ga0157370_10324106
443 Ga0157369_10528443
444 Ga0157369_10583681
445 Ga0157369_11552294
446 Ga0157374_11041576
447 Ga0157378_10930244
448 Ga0163162_11035976
449 Ga0157372_11163635
450 Ga0163163_10630072
451 Ga0163163_10834876
452 Ga0157380_10589696
453 Ga0157380_10755222
454 Ga0157379_10016816
455 Ga0157379_10271729
456 Ga0157379_10308093
457 Ga0157376_10102838
458 Ga0157376_11678721
459 Ga0197907_10817274
460 Ga0206353_11325953
461 Ga0213875_10004374
462 Ga0224712_10459176
463 Ga0207656_10032164
464 Ga0207656_10471076
465 Ga0207692_10000892
466 Ga0207642_10032636
467 Ga0207688_10045408
468 Ga0207685_10004873
469 Ga0207699_10000261
470 Ga0207645_10019935
471 Ga0207643_10027881
472 Ga0207643_10662288
473 Ga0207705_10238880
474 Ga0207684_10008113
475 Ga0207693_10001993
476 Ga0207663_10014151
477 Ga0207662_10429985
478 Ga0207657_10415016
479 Ga0207646_10003994
480 Ga0207646_10013558
481 Ga0207681_10455084
482 Ga0207694_10502423
483 Ga0207650_10101904
484 Ga0207650_10575464
485 Ga0207659_10829612
486 Ga0207687_10126006
487 Ga0207700_10000510
488 Ga0207700_10225412
489 Ga0207700_10327252
490 Ga0207664_10000311
491 Ga0207664_10068349
492 Ga0207664_10085199
493 Ga0207664_10089341
494 Ga0207644_10979800
495 Ga0207690_10498920
496 Ga0207706_10045868
497 Ga0207670_10716696
498 Ga0207669_10106868
499 Ga0207704_10293351
500 Ga0207665_10007041
501 Ga0207691_10113393
502 Ga0207711_10618754
503 Ga0207689_10073256
504 Ga0207689_10415844
505 Ga0207679_10589589
506 Ga0207679_10893059
507 Ga0207668_10780627
508 Ga0207658_10084258
509 Ga0207677_10083579
510 Ga0207677_10277554
511 Ga0207677_10524345
512 Ga0207703_10498136
513 Ga0207639_11058485
514 Ga0207639_11334746
515 Ga0207678_10001596
516 Ga0207678_10038506
517 Ga0207678_10039406
518 Ga0207678_10348225
519 Ga0207708_10045999
520 Ga0207708_10161293
521 Ga0207702_10897175
522 Ga0207641_10017966
523 Ga0207641_10051756
524 Ga0207641_10262146
525 Ga0207648_10222734
526 Ga0207674_10209780
527 Ga0207674_10400006
528 Ga0207675_100100765
529 Ga0207683_10149440
530 Ga0207683_10206423
531 Ga0207698_10644787
532 Ga0268266_10166307
533 Ga0268266_10277581
534 Ga0268265_10120783
535 Ga0316176_1071628
536 Ga0314311_1245174
537 Ga0316178_1169136
538 Ga0265762_1076479
539 Ga0265327_10000062
540 Ga0307513_10133650
541 Ga0307509_10242404
542 Ga0307509_10439003
543 Ga0265313_10080252
544 Ga0307518_10000054
545 Ga0307507_10008648
546 Ga0307510_10095188
547 Ga0373934_0009586
548 Ga0373923_0006727
549 Ga0373936_0114908
550 Ga0373945_0026145
551 Ga0373953_0033284
552 Ga0373954_0049706
553 Ga0373956_0000784
554 Ga0373956_0016950
555 Ga0373957_0005126
556 Ga0373955_0077067
557 Ga0373935_0058616
558 Ga0373933_0023526
559 Ga0373947_0198106
560 Ga0373937_0070000
561 Ga0436364_0712122
562 Ga0436364_0880639
563 Ga0451802_0427879
564 Ga0439449_0009077
565 Ga0466969_0108750
566 Ga0466972_0066664
567 Ga0466965_0180295
568 Ga0466965_0393452
569 Ga0466963_0099391
570 Ga0466964_0622636
571 Ga0466968_0000243
572 Ga0466970_0276251
573 Ga0466957_0239092
574 Ga0466960_0779512
575 Ga0466967_0017362
576 Ga0495592_0010395
577 Ga0495629_0911824
578 Ga0495651_0026039
579 Ga0495653_0011580
580 Ga0495662_0201831
581 Ga0495664_0054206
582 Ga0495608_0010948
583 Ga0495618_0010062
584 Ga0495630_0022416
585 Ga0495652_0116696
586 Ga0495665_0047190
587 Ga0495665_0325339
588 Ga0495640_0110241
589 Ga0495586_0018167
590 Ga0495586_0414442
591 Ga0495587_0043167
592 Ga0495667_0009055
593 Ga0495634_0046038
594 Ga0495635_0252863
595 Ga0495657_0050119
596 Ga0495623_0078234
597 Ga0495646_0021273
598 Ga0495600_0052249
599 Ga0495581_0165578
600 Ga0495604_0030695
601 Ga0495674_0082881
602 Ga0495680_0028597
603 Ga0495675_0129800
604 Ga0495602_0021150
605 Ga0496100_0001844
606 Ga0496101_0001084
607 Ga0496101_0527864
608 Ga0496102_0000046
609 Ga0496102_0593231
610 Ga0496103_0000547
611 Ga0496104_0015433
612 Ga0496104_0489114
613 Ga0496105_0037839
614 Ga0496106_0110203
615 Ga0496107_0123821
616 Ga0496110_0103111
617 Ga0496110_0410680
618 Ga0496111_0445599
619 Ga0496113_0396560
620 Ga0496116_0001888
621 Ga0496117_0000109
622 Ga0496118_0000132
623 Ga0496119_0000964
624 Ga0496120_0003908
625 Ga0496121_0030031
626 Ga0496122_0250065
627 Ga0496124_0192572
628 Ga0496125_0030374
629 Ga0496126_0002772
630 Ga0501067_0175414
631 Ga0501075_0606234
632 nmdc:mga00v17_18553_c1
633 nmdc:mga00v17_202336_c1
634 nmdc:mga09592_808725_c1
635 nmdc:mga08y16_574635_c1
636 nmdc:mga08y16_93886_c1
637 nmdc:mga0n895_925898_c1
638 Ga0495601_0065958
639 Ga0495601_0249874
640 Ga0495595_0008199
641 Ga0495619_0122636
642 Ga0500643_000352
643 Ga0500644_0071880
644 2523386760
645 2583151156
646 2586062313
647 2739205174
648 2753034985
649 2753073953
650 2753323502
651 2791909941
652 2795782699
653 2795797807
654 2809588516
655 2856744327
656 2866614525
657 2873320814
658 2891403101
659 2891554580
660 2891564644
661 2899365313
662 2899372917
663 2915770337
664 2917739506
665 8003323904
666 8047716871
667 8055067345
668 8055179758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

17

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9682 16 162
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9599 10 161
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9554 16 162
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9536 10 161
1c2y-assembly1.cif.gz_A crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly 0.9511 12 156
ID Description Score Start End Superfamily
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.954 7 162 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9478 7 162 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9436 12 156 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9361 12 159 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9267 19 160 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9828 16 161
AF-A0A2P0ZRU7-F1-model_v4 deleted 0.9819 26 158
AF-A0A0K2RD09-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9811 34 156 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A4Y8Y6Y9-F1-model_v4 deleted 0.9799 44 156
AF-A0A399J9J1-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9796 22 152 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map