F411975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 147 | 328 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_1269129|Ga0501036_1269129_62_409 |
| Length | 115 |
| Sequence | MSTGLLVQYVVVGLIVLVSALVAFRKLAPQLTNRWFAAASIRLGQPGRSRLARALSRRLQPKQATGNCADGCATCGACGPKKPAAATPMPRRRSDSSGQARVAEPMPLHFRPRSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 2 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 3 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 4 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 5 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 6 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 61 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 107 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 108 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 114 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 115 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 124 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 125 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 126 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 127 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 128 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.9 |
| Metatranscriptomes | 0.3 |
| Isolates | 1.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.86 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 71.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10171110 | 3300001989 | Bacteria | 640 |
| 2 | JGI24737J22298_10080966 | 3300001990 | Bacteria | 966 |
| 3 | JGI24735J21928_10017179 | 3300002067 | Bacteria | 2238 |
| 4 | JGI25156J39149_1003131 | 3300002705 | Bacteria | 5573 |
| 5 | JGI25162J39368_1000859 | 3300002737 | Bacteria | 19993 |
| 6 | JGI25162J39368_1002652 | 3300002737 | Bacteria | 6599 |
| 7 | JGI25162J39368_1002802 | 3300002737 | Bacteria | 6134 |
| 8 | JGI25162J39368_1023663 | 3300002737 | Bacteria | 557 |
| 9 | JGI25154J39366_1003304 | 3300002738 | Bacteria | 3481 |
| 10 | JGI25157J39369_1001037 | 3300002741 | Bacteria | 12751 |
| 11 | JGI25157J39369_1001307 | 3300002741 | Bacteria | 9942 |
| 12 | JGI25157J39369_1002822 | 3300002741 | Bacteria | 3940 |
| 13 | JGI25164J39214_1000045 | 3300002772 | Bacteria | 125909 |
| 14 | JGI25164J39214_1001246 | 3300002772 | Bacteria | 6767 |
| 15 | JGI25164J39214_1001331 | 3300002772 | Bacteria | 6126 |
| 16 | JGI25165J46597_1000072 | 3300003214 | Bacteria | 192184 |
| 17 | JGI25165J46597_1002406 | 3300003214 | Bacteria | 6134 |
| 18 | JGI25165J46597_1003986 | 3300003214 | Bacteria | 3370 |
| 19 | JGI25165J46597_1010492 | 3300003214 | Bacteria | 1349 |
| 20 | rootH1_10092329 | 3300003316 | Bacteria | 1424 |
| 21 | rootH1_10213741 | 3300003323 | Bacteria | 1173 |
| 22 | Ga0055539_1001681 | 3300003752 | Bacteria | 3919 |
| 23 | Ga0055533_1003517 | 3300003756 | Bacteria | 3116 |
| 24 | Ga0055525_1000027 | 3300003759 | Bacteria | 340506 |
| 25 | Ga0055527_1000199 | 3300003760 | Bacteria | 39633 |
| 26 | Ga0055527_1000212 | 3300003760 | Bacteria | 37749 |
| 27 | Ga0055527_1003581 | 3300003760 | Bacteria | 2271 |
| 28 | Ga0055535_1000585 | 3300003761 | Bacteria | 30486 |
| 29 | Ga0055535_1001486 | 3300003761 | Bacteria | 11703 |
| 30 | Ga0055535_1001521 | 3300003761 | Bacteria | 11438 |
| 31 | Ga0055535_1001790 | 3300003761 | Bacteria | 9441 |
| 32 | Ga0055542_1000242 | 3300003762 | Bacteria | 62798 |
| 33 | Ga0055542_1000497 | 3300003762 | Bacteria | 36142 |
| 34 | Ga0055542_1001722 | 3300003762 | Bacteria | 9441 |
| 35 | Ga0055542_1001732 | 3300003762 | Bacteria | 9374 |
| 36 | Ga0055529_1000204 | 3300003763 | Bacteria | 78293 |
| 37 | Ga0055529_1000846 | 3300003763 | Bacteria | 17865 |
| 38 | Ga0055529_1001254 | 3300003763 | Bacteria | 9378 |
| 39 | Ga0055529_1010377 | 3300003763 | Bacteria | 1211 |
| 40 | Ga0070682_100024050 | 3300005337 | Bacteria | 3622 |
| 41 | Ga0070682_100786727 | 3300005337 | Bacteria | 771 |
| 42 | Ga0070660_101668803 | 3300005339 | Bacteria | 542 |
| 43 | Ga0070692_10016799 | 3300005345 | Bacteria | 3486 |
| 44 | Ga0070688_100081713 | 3300005365 | Bacteria | 2093 |
| 45 | Ga0070659_100006031 | 3300005366 | Bacteria | 8739 |
| 46 | Ga0070659_101490720 | 3300005366 | Bacteria | 602 |
| 47 | Ga0070714_100000149 | 3300005435 | Bacteria | 55827 |
| 48 | Ga0070714_100021926 | 3300005435 | Bacteria | 5230 |
| 49 | Ga0070714_101660957 | 3300005435 | Bacteria | 624 |
| 50 | Ga0070713_100445465 | 3300005436 | Bacteria | 1215 |
| 51 | Ga0070711_101023937 | 3300005439 | Bacteria | 709 |
| 52 | Ga0070663_100089635 | 3300005455 | Bacteria | 2276 |
| 53 | Ga0070662_100118515 | 3300005457 | Bacteria | 2026 |
| 54 | Ga0070681_10037468 | 3300005458 | Bacteria | 4865 |
| 55 | Ga0070681_10079625 | 3300005458 | Bacteria | 3233 |
| 56 | Ga0070679_100027791 | 3300005530 | Bacteria | 5571 |
| 57 | Ga0070679_100638957 | 3300005530 | Bacteria | 1007 |
| 58 | Ga0070679_100644741 | 3300005530 | Bacteria | 1002 |
| 59 | Ga0068853_100201472 | 3300005539 | Bacteria | 1811 |
| 60 | Ga0068853_101190866 | 3300005539 | Bacteria | 735 |
| 61 | Ga0070696_100023857 | 3300005546 | Bacteria | 4157 |
| 62 | Ga0070693_100036848 | 3300005547 | Bacteria | 2722 |
| 63 | Ga0070693_100113663 | 3300005547 | Bacteria | 1669 |
| 64 | Ga0068855_100161016 | 3300005563 | Bacteria | 2547 |
| 65 | Ga0068855_101001964 | 3300005563 | Bacteria | 878 |
| 66 | Ga0068855_102147789 | 3300005563 | Bacteria | 561 |
| 67 | Ga0070664_100160317 | 3300005564 | Bacteria | 1990 |
| 68 | Ga0068857_100410246 | 3300005577 | Bacteria | 1261 |
| 69 | Ga0068854_100233900 | 3300005578 | Bacteria | 1460 |
| 70 | Ga0068854_101905239 | 3300005578 | Bacteria | 546 |
| 71 | Ga0068856_100000053 | 3300005614 | Bacteria | 106241 |
| 72 | Ga0068856_100006710 | 3300005614 | Bacteria | 11280 |
| 73 | Ga0068856_100047778 | 3300005614 | Bacteria | 4217 |
| 74 | Ga0068856_101490052 | 3300005614 | Bacteria | 690 |
| 75 | Ga0070712_100618935 | 3300006175 | Bacteria | 918 |
| 76 | Ga0105240_10171194 | 3300009093 | Bacteria | 2572 |
| 77 | Ga0105240_10715702 | 3300009093 | Bacteria | 1091 |
| 78 | Ga0105241_11392938 | 3300009174 | Bacteria | 671 |
| 79 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 80 | Ga0105237_10370742 | 3300009545 | Bacteria | 1436 |
| 81 | Ga0105238_10140357 | 3300009551 | Bacteria | 2393 |
| 82 | Ga0105238_10709580 | 3300009551 | Bacteria | 1018 |
| 83 | Ga0105239_10215717 | 3300010375 | Bacteria | 2151 |
| 84 | Ga0157373_10160339 | 3300013100 | Bacteria | 1583 |
| 85 | Ga0157373_10253472 | 3300013100 | Bacteria | 1245 |
| 86 | Ga0157373_10390848 | 3300013100 | Bacteria | 996 |
| 87 | Ga0157373_10810682 | 3300013100 | Bacteria | 691 |
| 88 | Ga0157373_10950617 | 3300013100 | Bacteria | 639 |
| 89 | Ga0157373_11140443 | 3300013100 | Bacteria | 586 |
| 90 | Ga0157371_10859692 | 3300013102 | Bacteria | 686 |
| 91 | Ga0157371_11413632 | 3300013102 | Bacteria | 541 |
| 92 | Ga0157370_10054161 | 3300013104 | Bacteria | 3824 |
| 93 | Ga0157370_10070270 | 3300013104 | Bacteria | 3305 |
| 94 | Ga0157370_10096768 | 3300013104 | Bacteria | 2769 |
| 95 | Ga0157369_10016000 | 3300013105 | Bacteria | 8441 |
| 96 | Ga0157369_10338715 | 3300013105 | Bacteria | 1562 |
| 97 | Ga0157369_10564653 | 3300013105 | Bacteria | 1176 |
| 98 | Ga0157369_10814722 | 3300013105 | Bacteria | 959 |
| 99 | Ga0157372_10013585 | 3300013307 | Bacteria | 8704 |
| 100 | Ga0157372_10018106 | 3300013307 | Bacteria | 7571 |
| 101 | Ga0157372_10694608 | 3300013307 | Bacteria | 1184 |
| 102 | Ga0157372_11259540 | 3300013307 | Bacteria | 854 |
| 103 | Ga0157372_12052132 | 3300013307 | Bacteria | 657 |
| 104 | Ga0182008_10144949 | 3300014497 | Bacteria | 1189 |
| 105 | Ga0182008_10176001 | 3300014497 | Bacteria | 1081 |
| 106 | Ga0182008_10185401 | 3300014497 | Bacteria | 1054 |
| 107 | Ga0157376_13039865 | 3300014969 | Bacteria | 508 |
| 108 | Ga0182006_1085461 | 3300015261 | Bacteria | 1144 |
| 109 | Ga0182006_1222818 | 3300015261 | Bacteria | 621 |
| 110 | Ga0182006_1236851 | 3300015261 | Bacteria | 600 |
| 111 | Ga0182006_1268853 | 3300015261 | Bacteria | 559 |
| 112 | Ga0182007_10031158 | 3300015262 | Bacteria | 1819 |
| 113 | Ga0182007_10058840 | 3300015262 | Bacteria | 1260 |
| 114 | Ga0182007_10068760 | 3300015262 | Bacteria | 1160 |
| 115 | Ga0182007_10106157 | 3300015262 | Bacteria | 932 |
| 116 | Ga0182007_10198766 | 3300015262 | Bacteria | 700 |
| 117 | Ga0182007_10410746 | 3300015262 | Bacteria | 517 |
| 118 | Ga0183369_1008 | 3300015685 | Bacteria | 346514 |
| 119 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 120 | Ga0206353_10868182 | 3300020082 | Bacteria | 2038 |
| 121 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 122 | Ga0209674_100086 | 3300025226 | Bacteria | 187776 |
| 123 | Ga0209674_101483 | 3300025226 | Bacteria | 6119 |
| 124 | Ga0209674_108175 | 3300025226 | Bacteria | 1257 |
| 125 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 126 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 127 | Ga0209672_100142 | 3300025228 | Bacteria | 67156 |
| 128 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 129 | Ga0207427_100055 | 3300025231 | Bacteria | 209093 |
| 130 | Ga0207427_100244 | 3300025231 | Bacteria | 43765 |
| 131 | Ga0207427_100248 | 3300025231 | Bacteria | 42623 |
| 132 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 133 | Ga0209437_100079 | 3300025233 | Bacteria | 275948 |
| 134 | Ga0209437_100161 | 3300025233 | Bacteria | 148264 |
| 135 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 136 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 137 | Ga0209258_100064 | 3300025242 | Bacteria | 293837 |
| 138 | Ga0209258_100186 | 3300025242 | Bacteria | 132381 |
| 139 | Ga0209258_100481 | 3300025242 | Bacteria | 41699 |
| 140 | Ga0209258_121897 | 3300025242 | Bacteria | 658 |
| 141 | Ga0209646_1001520 | 3300025246 | Bacteria | 6147 |
| 142 | Ga0209646_1002370 | 3300025246 | Bacteria | 4223 |
| 143 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 144 | Ga0209026_1000493 | 3300025250 | Bacteria | 28912 |
| 145 | Ga0209026_1001155 | 3300025250 | Bacteria | 12356 |
| 146 | Ga0209026_1001161 | 3300025250 | Bacteria | 12266 |
| 147 | Ga0209677_100603 | 3300025253 | Bacteria | 19450 |
| 148 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 149 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 150 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 151 | Ga0209148_1000142 | 3300025254 | Bacteria | 163404 |
| 152 | Ga0209759_1000103 | 3300025256 | Bacteria | 153195 |
| 153 | Ga0209759_1000725 | 3300025256 | Bacteria | 28902 |
| 154 | Ga0209759_1008558 | 3300025256 | Bacteria | 3177 |
| 155 | Ga0209759_1014075 | 3300025256 | Bacteria | 2134 |
| 156 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 157 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 158 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 159 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 160 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 161 | Ga0209455_1000177 | 3300025272 | Bacteria | 106026 |
| 162 | Ga0209455_1000271 | 3300025272 | Bacteria | 57704 |
| 163 | Ga0209455_1018885 | 3300025272 | Bacteria | 1405 |
| 164 | Ga0209758_1094136 | 3300025297 | Bacteria | 869 |
| 165 | Ga0207647_10051464 | 3300025904 | Bacteria | 2545 |
| 166 | Ga0207647_10670486 | 3300025904 | Bacteria | 567 |
| 167 | Ga0207705_10002488 | 3300025909 | Bacteria | 14195 |
| 168 | Ga0207654_10153566 | 3300025911 | Bacteria | 1480 |
| 169 | Ga0207707_10025218 | 3300025912 | Bacteria | 5201 |
| 170 | Ga0207707_10047527 | 3300025912 | Bacteria | 3737 |
| 171 | Ga0207707_10111681 | 3300025912 | Bacteria | 2390 |
| 172 | Ga0207695_10197583 | 3300025913 | Bacteria | 1927 |
| 173 | Ga0207671_10003358 | 3300025914 | Bacteria | 16056 |
| 174 | Ga0207663_11198011 | 3300025916 | Bacteria | 611 |
| 175 | Ga0207657_10452392 | 3300025919 | Bacteria | 1007 |
| 176 | Ga0207657_10814014 | 3300025919 | Bacteria | 722 |
| 177 | Ga0207649_10190783 | 3300025920 | Bacteria | 1441 |
| 178 | Ga0207694_10091899 | 3300025924 | Bacteria | 2395 |
| 179 | Ga0207694_10298633 | 3300025924 | Bacteria | 1326 |
| 180 | Ga0207700_10049378 | 3300025928 | Bacteria | 3129 |
| 181 | Ga0207664_10000093 | 3300025929 | Bacteria | 81829 |
| 182 | Ga0207664_10001554 | 3300025929 | Bacteria | 15056 |
| 183 | Ga0207664_10026051 | 3300025929 | Bacteria | 4415 |
| 184 | Ga0207664_11197950 | 3300025929 | Bacteria | 677 |
| 185 | Ga0207690_10008812 | 3300025932 | Bacteria | 5988 |
| 186 | Ga0207690_10011237 | 3300025932 | Bacteria | 5347 |
| 187 | Ga0207690_10023661 | 3300025932 | Bacteria | 3836 |
| 188 | Ga0207690_10277957 | 3300025932 | Bacteria | 1303 |
| 189 | Ga0207690_11072162 | 3300025932 | Bacteria | 671 |
| 190 | Ga0207706_10023010 | 3300025933 | Bacteria | 5596 |
| 191 | Ga0207679_11191009 | 3300025945 | Bacteria | 699 |
| 192 | Ga0207667_10222369 | 3300025949 | Bacteria | 1934 |
| 193 | Ga0207667_10595551 | 3300025949 | Bacteria | 1115 |
| 194 | Ga0207667_10755298 | 3300025949 | Bacteria | 971 |
| 195 | Ga0207640_10022187 | 3300025981 | Bacteria | 3795 |
| 196 | Ga0207640_10198663 | 3300025981 | Bacteria | 1518 |
| 197 | Ga0207640_10842489 | 3300025981 | Bacteria | 797 |
| 198 | Ga0207639_10543854 | 3300026041 | Bacteria | 1066 |
| 199 | Ga0207639_10618853 | 3300026041 | Bacteria | 1000 |
| 200 | Ga0207639_10973898 | 3300026041 | Bacteria | 794 |
| 201 | Ga0207678_10020550 | 3300026067 | Bacteria | 5788 |
| 202 | Ga0207702_10001010 | 3300026078 | Bacteria | 28892 |
| 203 | Ga0207702_10013058 | 3300026078 | Bacteria | 6907 |
| 204 | Ga0207702_10030863 | 3300026078 | Bacteria | 4465 |
| 205 | Ga0207674_10056186 | 3300026116 | Bacteria | 3998 |
| 206 | Ga0207674_11010078 | 3300026116 | Bacteria | 801 |
| 207 | Ga0207683_10924741 | 3300026121 | Bacteria | 810 |
| 208 | Ga0265332_10134816 | 3300031238 | Bacteria | 1035 |
| 209 | Ga0307507_10704355 | 3300033179 | Bacteria | 504 |
| 210 | Ga0395899_0000108 | 3300037312 | Bacteria | 142347 |
| 211 | Ga0395899_0003614 | 3300037312 | Bacteria | 12231 |
| 212 | Ga0395899_0013691 | 3300037312 | Bacteria | 6201 |
| 213 | Ga0395899_0071469 | 3300037312 | Bacteria | 2539 |
| 214 | Ga0395899_0594657 | 3300037312 | Bacteria | 705 |
| 215 | Ga0395899_0849176 | 3300037312 | Bacteria | 560 |
| 216 | Ga0395900_0000755 | 3300037418 | Bacteria | 42995 |
| 217 | Ga0395900_0005765 | 3300037418 | Bacteria | 12941 |
| 218 | Ga0395900_0006415 | 3300037418 | Bacteria | 12257 |
| 219 | Ga0395900_0496969 | 3300037418 | Bacteria | 1170 |
| 220 | Ga0395900_1379810 | 3300037418 | Bacteria | 618 |
| 221 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 222 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 223 | Ga0395898_0001843 | 3300037466 | Bacteria | 27253 |
| 224 | Ga0395898_0006742 | 3300037466 | Bacteria | 12237 |
| 225 | Ga0395898_0073871 | 3300037466 | Bacteria | 3294 |
| 226 | Ga0395905_0848914 | 3300037471 | Bacteria | 816 |
| 227 | Ga0395905_1129596 | 3300037471 | Bacteria | 687 |
| 228 | Ga0395901_0021152 | 3300038443 | Bacteria | 6664 |
| 229 | Ga0395901_0022286 | 3300038443 | Bacteria | 6490 |
| 230 | Ga0395901_0057321 | 3300038443 | Bacteria | 4051 |
| 231 | Ga0395901_0057886 | 3300038443 | Bacteria | 4031 |
| 232 | Ga0395901_0130299 | 3300038443 | Bacteria | 2643 |
| 233 | Ga0395901_0321280 | 3300038443 | Bacteria | 1601 |
| 234 | Ga0395901_0327130 | 3300038443 | Bacteria | 1585 |
| 235 | Ga0466988_0170269 | 3300044536 | Bacteria | 1259 |
| 236 | Ga0466969_0017091 | 3300044656 | Bacteria | 3791 |
| 237 | Ga0466969_0031034 | 3300044656 | Bacteria | 2721 |
| 238 | Ga0466969_0097065 | 3300044656 | Bacteria | 1390 |
| 239 | Ga0466975_0681567 | 3300044661 | Bacteria | 550 |
| 240 | Ga0466966_0003688 | 3300044684 | Bacteria | 10107 |
| 241 | Ga0466966_0045356 | 3300044684 | Bacteria | 2810 |
| 242 | Ga0466966_0168289 | 3300044684 | Bacteria | 1332 |
| 243 | Ga0466961_0002304 | 3300044693 | Bacteria | 11868 |
| 244 | Ga0466961_0007229 | 3300044693 | Bacteria | 7065 |
| 245 | Ga0466961_0011723 | 3300044693 | Bacteria | 5602 |
| 246 | Ga0466961_0054455 | 3300044693 | Bacteria | 2551 |
| 247 | Ga0466963_0988202 | 3300044694 | Bacteria | 593 |
| 248 | Ga0466964_0245250 | 3300044706 | Bacteria | 881 |
| 249 | Ga0466971_0703258 | 3300044719 | Bacteria | 508 |
| 250 | Ga0466968_0360184 | 3300044735 | Bacteria | 708 |
| 251 | Ga0466970_0041449 | 3300044765 | Bacteria | 2446 |
| 252 | Ga0466957_0022645 | 3300044842 | Bacteria | 3708 |
| 253 | Ga0466957_0610956 | 3300044842 | Bacteria | 764 |
| 254 | Ga0466959_0000347 | 3300045049 | Bacteria | 27371 |
| 255 | Ga0466959_0258315 | 3300045049 | Bacteria | 1199 |
| 256 | Ga0466958_0015903 | 3300045836 | Bacteria | 4324 |
| 257 | Ga0466958_0692645 | 3300045836 | Bacteria | 664 |
| 258 | Ga0466967_1470837 | 3300045976 | Bacteria | 679 |
| 259 | Ga0495606_0001309 | 3300046507 | Bacteria | 34265 |
| 260 | Ga0495625_0776070 | 3300046660 | Bacteria | 559 |
| 261 | Ga0495649_0007578 | 3300046694 | Bacteria | 6600 |
| 262 | Ga0496113_0101589 | 3300048916 | Bacteria | 2229 |
| 263 | Ga0496114_0492751 | 3300048917 | Bacteria | 1084 |
| 264 | Ga0496115_0000115 | 3300048918 | Bacteria | 73259 |
| 265 | Ga0496115_0003178 | 3300048918 | Bacteria | 11802 |
| 266 | Ga0496115_0027679 | 3300048918 | Bacteria | 4436 |
| 267 | Ga0496124_0407914 | 3300048927 | Bacteria | 941 |
| 268 | Ga0496126_0033433 | 3300048929 | Bacteria | 4838 |
| 269 | Ga0496126_0192711 | 3300048929 | Bacteria | 1725 |
| 270 | Ga0495682_0068782 | 3300049460 | Bacteria | 1275 |
| 271 | Ga0501031_0153038 | 3300049568 | Bacteria | 1507 |
| 272 | Ga0501031_0203615 | 3300049568 | Bacteria | 1291 |
| 273 | Ga0501032_0011458 | 3300049569 | Bacteria | 6370 |
| 274 | Ga0501032_0049799 | 3300049569 | Bacteria | 2826 |
| 275 | Ga0501032_0288956 | 3300049569 | Bacteria | 1061 |
| 276 | Ga0501033_0003177 | 3300049570 | Bacteria | 13626 |
| 277 | Ga0501033_0027424 | 3300049570 | Bacteria | 4282 |
| 278 | Ga0501033_0163911 | 3300049570 | Bacteria | 1599 |
| 279 | Ga0501033_0264462 | 3300049570 | Bacteria | 1217 |
| 280 | Ga0501034_0276766 | 3300049571 | Bacteria | 1618 |
| 281 | Ga0501034_0624578 | 3300049571 | Bacteria | 981 |
| 282 | Ga0501034_1013131 | 3300049571 | Bacteria | 714 |
| 283 | Ga0501036_0947880 | 3300049572 | Bacteria | 705 |
| 284 | Ga0501036_1269129 | 3300049572 | Bacteria | 599 |
| 285 | Ga0501037_0035784 | 3300049573 | Bacteria | 3659 |
| 286 | Ga0501037_0041823 | 3300049573 | Bacteria | 3369 |
| 287 | Ga0501037_0250212 | 3300049573 | Bacteria | 1240 |
| 288 | Ga0501038_0099412 | 3300049574 | Bacteria | 2425 |
| 289 | Ga0501039_0246990 | 3300049575 | Bacteria | 1403 |
| 290 | Ga0501042_0201251 | 3300049578 | Bacteria | 1436 |
| 291 | Ga0501043_0015054 | 3300049579 | Bacteria | 6057 |
| 292 | Ga0501043_0101562 | 3300049579 | Bacteria | 2260 |
| 293 | Ga0501043_0204498 | 3300049579 | Bacteria | 1531 |
| 294 | Ga0501046_0008482 | 3300049580 | Bacteria | 8950 |
| 295 | Ga0501046_0039440 | 3300049580 | Bacteria | 3782 |
| 296 | Ga0501046_0100828 | 3300049580 | Bacteria | 2215 |
| 297 | Ga0501046_0477515 | 3300049580 | Bacteria | 895 |
| 298 | Ga0501047_0056314 | 3300049581 | Bacteria | 3801 |
| 299 | Ga0501047_0179714 | 3300049581 | Bacteria | 1982 |
| 300 | Ga0501047_0260255 | 3300049581 | Bacteria | 1583 |
| 301 | Ga0501047_0306226 | 3300049581 | Bacteria | 1430 |
| 302 | Ga0501047_0365964 | 3300049581 | Bacteria | 1277 |
| 303 | Ga0501047_0505154 | 3300049581 | Bacteria | 1035 |
| 304 | Ga0501047_0918142 | 3300049581 | Bacteria | 689 |
| 305 | Ga0501047_1313486 | 3300049581 | Bacteria | 537 |
| 306 | Ga0501048_0033093 | 3300049582 | Bacteria | 3736 |
| 307 | Ga0501048_0105087 | 3300049582 | Bacteria | 1993 |
| 308 | Ga0501048_1279664 | 3300049582 | Bacteria | 527 |
| 309 | Ga0501070_0210888 | 3300049586 | Bacteria | 1594 |
| 310 | Ga0501080_0368887 | 3300049742 | Bacteria | 1294 |
| 311 | Ga0501035_0042905 | 3300049822 | Bacteria | 4077 |
| 312 | Ga0501035_0048478 | 3300049822 | Bacteria | 3809 |
| 313 | Ga0501035_0282385 | 3300049822 | Bacteria | 1403 |
| 314 | Ga0501035_0584852 | 3300049822 | Bacteria | 911 |
| 315 | Ga0501035_0751871 | 3300049822 | Bacteria | 782 |
| 316 | Ga0501035_1120117 | 3300049822 | Bacteria | 614 |
| 317 | Ga0501044_0034517 | 3300049823 | Bacteria | 5303 |
| 318 | Ga0501044_0080586 | 3300049823 | Bacteria | 3297 |
| 319 | Ga0501044_0128302 | 3300049823 | Bacteria | 2532 |
| 320 | Ga0501044_0133178 | 3300049823 | Bacteria | 2478 |
| 321 | Ga0501044_0263755 | 3300049823 | Bacteria | 1660 |
| 322 | Ga0501044_0389542 | 3300049823 | Bacteria | 1307 |
| 323 | Ga0501044_1274888 | 3300049823 | Bacteria | 602 |
| 324 | Ga0501044_1423852 | 3300049823 | Bacteria | 558 |
| 325 | Ga0501044_1610949 | 3300049823 | Bacteria | 514 |
| 326 | Ga0501045_0373734 | 3300049824 | Bacteria | 1061 |
| 327 | Ga0466962_0046425 | 3300061719 | Bacteria | 2075 |
| 328 | Ga0466962_0093879 | 3300061719 | Bacteria | 1438 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002705 | JGI25156J39149_1003131 | JGI25156J39149_10031312 | 84 |
| 2 | 3300002741 | JGI25157J39369_1002822 | JGI25157J39369_10028222 | 84 |
| 3 | 3300005455 | Ga0070663_100089635 | Ga0070663_1000896352 | 84 |
| 4 | 3300005547 | Ga0070693_100036848 | Ga0070693_1000368482 | 84 |
| 5 | 3300005563 | Ga0068855_100161016 | Ga0068855_1001610162 | 84 |
| 6 | 3300005578 | Ga0068854_101905239 | Ga0068854_1019052392 | 84 |
| 7 | 3300009545 | Ga0105237_10000007 | Ga0105237_1000000787 | 84 |
| 8 | 3300013104 | Ga0157370_10096768 | Ga0157370_100967682 | 84 |
| 9 | 3300020082 | Ga0206353_10868182 | Ga0206353_108681822 | 84 |
| 10 | 3300025246 | Ga0209646_1001520 | Ga0209646_10015202 | 84 |
| 11 | 3300025250 | Ga0209026_1001155 | Ga0209026_10011555 | 84 |
| 12 | 3300025256 | Ga0209759_1008558 | Ga0209759_10085582 | 84 |
| 13 | 3300025904 | Ga0207647_10670486 | Ga0207647_106704861 | 84 |
| 14 | 3300025913 | Ga0207695_10197583 | Ga0207695_101975832 | 84 |
| 15 | 3300025914 | Ga0207671_10003358 | Ga0207671_1000335816 | 84 |
| 16 | 3300025981 | Ga0207640_10842489 | Ga0207640_108424892 | 84 |
| 17 | 3300026067 | Ga0207678_10020550 | Ga0207678_100205502 | 84 |
| 18 | 3300003763 | Ga0055529_1010377 | Ga0055529_10103771 | 85 |
| 19 | 3300009093 | Ga0105240_10171194 | Ga0105240_101711942 | 85 |
| 20 | 3300013105 | Ga0157369_10564653 | Ga0157369_105646532 | 85 |
| 21 | 3300025272 | Ga0209455_1000271 | Ga0209455_100027122 | 85 |
| 22 | 3300025949 | Ga0207667_10595551 | Ga0207667_105955512 | 85 |
| 23 | 3300049568 | Ga0501031_0153038 | Ga0501031_0153038_1048_1392 | 85 |
| 24 | 3300049570 | Ga0501033_0163911 | Ga0501033_0163911_109_453 | 85 |
| 25 | 3300049571 | Ga0501034_1013131 | Ga0501034_1013131_209_556 | 85 |
| 26 | 3300049573 | Ga0501037_0035784 | Ga0501037_0035784_44_388 | 85 |
| 27 | 3300049574 | Ga0501038_0099412 | Ga0501038_0099412_1940_2284 | 85 |
| 28 | 3300049579 | Ga0501043_0015054 | Ga0501043_0015054_3625_3969 | 85 |
| 29 | 3300049580 | Ga0501046_0039440 | Ga0501046_0039440_2033_2377 | 85 |
| 30 | 3300049580 | Ga0501046_0100828 | Ga0501046_0100828_87_431 | 85 |
| 31 | 3300049581 | Ga0501047_0056314 | Ga0501047_0056314_233_577 | 85 |
| 32 | 3300049581 | Ga0501047_0179714 | Ga0501047_0179714_1226_1570 | 85 |
| 33 | 3300049582 | Ga0501048_0105087 | Ga0501048_0105087_1514_1858 | 85 |
| 34 | 3300049582 | Ga0501048_1279664 | Ga0501048_1279664_76_420 | 85 |
| 35 | 3300049822 | Ga0501035_0042905 | Ga0501035_0042905_3564_3908 | 85 |
| 36 | 3300049823 | Ga0501044_0034517 | Ga0501044_0034517_3224_3568 | 85 |
| 37 | 3300049823 | Ga0501044_0133178 | Ga0501044_0133178_113_457 | 85 |
| 38 | 3300005614 | Ga0068856_100000053 | Ga0068856_1000000532 | 88 |
| 39 | 3300009093 | Ga0105240_10715702 | Ga0105240_107157021 | 88 |
| 40 | 3300013105 | Ga0157369_10016000 | Ga0157369_100160003 | 88 |
| 41 | 3300026078 | Ga0207702_10001010 | Ga0207702_100010103 | 88 |
| 42 | 3300014497 | Ga0182008_10144949 | Ga0182008_101449492 | 89 |
| 43 | 3300015262 | Ga0182007_10106157 | Ga0182007_101061572 | 89 |
| 44 | 3300046507 | Ga0495606_0001309 | Ga0495606_0001309_12324_12623 | 89 |
| 45 | 3300046694 | Ga0495649_0007578 | Ga0495649_0007578_5065_5364 | 89 |
| 46 | 3300048918 | Ga0496115_0003178 | Ga0496115_0003178_5329_5628 | 89 |
| 47 | 3300048929 | Ga0496126_0033433 | Ga0496126_0033433_882_1181 | 89 |
| 48 | 3300049460 | Ga0495682_0068782 | Ga0495682_0068782_53_352 | 89 |
| 49 | 3300005366 | Ga0070659_101490720 | Ga0070659_1014907202 | 90 |
| 50 | 3300005458 | Ga0070681_10079625 | Ga0070681_100796252 | 90 |
| 51 | 3300005539 | Ga0068853_100201472 | Ga0068853_1002014723 | 90 |
| 52 | 3300025912 | Ga0207707_10047527 | Ga0207707_100475274 | 90 |
| 53 | 3300025932 | Ga0207690_11072162 | Ga0207690_110721622 | 90 |
| 54 | 3300026041 | Ga0207639_10618853 | Ga0207639_106188532 | 90 |
| 55 | 3300005365 | Ga0070688_100081713 | Ga0070688_1000817132 | 91 |
| 56 | 3300013100 | Ga0157373_10160339 | Ga0157373_101603392 | 91 |
| 57 | 3300013102 | Ga0157371_10859692 | Ga0157371_108596921 | 91 |
| 58 | 3300013307 | Ga0157372_10018106 | Ga0157372_100181068 | 91 |
| 59 | 3300013307 | Ga0157372_11259540 | Ga0157372_112595402 | 91 |
| 60 | 3300015685 | Ga0183369_1008 | Ga0183369_1008246 | 91 |
| 61 | 3300025272 | Ga0209455_1018885 | Ga0209455_10188852 | 91 |
| 62 | 3300048918 | Ga0496115_0027679 | Ga0496115_0027679_2532_2831 | 91 |
| 63 | 3300048927 | Ga0496124_0407914 | Ga0496124_0407914_171_470 | 91 |
| 64 | 3300048929 | Ga0496126_0192711 | Ga0496126_0192711_140_439 | 91 |
| 65 | 3300049580 | Ga0501046_0477515 | Ga0501046_0477515_51_362 | 91 |
| 66 | 3300049581 | Ga0501047_0918142 | Ga0501047_0918142_108_419 | 91 |
| 67 | 3300049586 | Ga0501070_0210888 | Ga0501070_0210888_104_448 | 91 |
| 68 | 3300049822 | Ga0501035_0751871 | Ga0501035_0751871_355_669 | 91 |
| 69 | 3300049823 | Ga0501044_1274888 | Ga0501044_1274888_171_482 | 91 |
| 70 | 3300013105 | Ga0157369_10338715 | Ga0157369_103387152 | 92 |
| 71 | 3300026121 | Ga0207683_10924741 | Ga0207683_109247412 | 92 |
| 72 | 3300048917 | Ga0496114_0492751 | Ga0496114_0492751_193_492 | 92 |
| 73 | 3300049822 | Ga0501035_0584852 | Ga0501035_0584852_560_871 | 92 |
| 74 | 3300049823 | Ga0501044_0263755 | Ga0501044_0263755_1155_1508 | 92 |
| 75 | 3300049823 | Ga0501044_1610949 | Ga0501044_1610949_82_393 | 92 |
| 76 | iso_pu_bacteria | 2643221577 | 2643894877 | 92 |
| 77 | iso_pu_bacteria | 2643221685 | 2644477036 | 92 |
| 78 | 3300005337 | Ga0070682_100786727 | Ga0070682_1007867271 | 93 |
| 79 | 3300005339 | Ga0070660_101668803 | Ga0070660_1016688031 | 93 |
| 80 | 3300005345 | Ga0070692_10016799 | Ga0070692_100167993 | 93 |
| 81 | 3300005435 | Ga0070714_100000149 | Ga0070714_10000014925 | 93 |
| 82 | 3300005457 | Ga0070662_100118515 | Ga0070662_1001185153 | 93 |
| 83 | 3300005530 | Ga0070679_100027791 | Ga0070679_1000277913 | 93 |
| 84 | 3300005539 | Ga0068853_101190866 | Ga0068853_1011908662 | 93 |
| 85 | 3300005546 | Ga0070696_100023857 | Ga0070696_1000238574 | 93 |
| 86 | 3300005547 | Ga0070693_100113663 | Ga0070693_1001136632 | 93 |
| 87 | 3300005563 | Ga0068855_102147789 | Ga0068855_1021477891 | 93 |
| 88 | 3300005564 | Ga0070664_100160317 | Ga0070664_1001603173 | 93 |
| 89 | 3300005577 | Ga0068857_100410246 | Ga0068857_1004102463 | 93 |
| 90 | 3300005614 | Ga0068856_100006710 | Ga0068856_1000067103 | 93 |
| 91 | 3300005614 | Ga0068856_101490052 | Ga0068856_1014900522 | 93 |
| 92 | 3300006175 | Ga0070712_100618935 | Ga0070712_1006189351 | 93 |
| 93 | 3300009174 | Ga0105241_11392938 | Ga0105241_113929381 | 93 |
| 94 | 3300009545 | Ga0105237_10370742 | Ga0105237_103707422 | 93 |
| 95 | 3300009551 | Ga0105238_10709580 | Ga0105238_107095801 | 93 |
| 96 | 3300010375 | Ga0105239_10215717 | Ga0105239_102157173 | 93 |
| 97 | 3300013100 | Ga0157373_10253472 | Ga0157373_102534722 | 93 |
| 98 | 3300013100 | Ga0157373_10390848 | Ga0157373_103908482 | 93 |
| 99 | 3300013100 | Ga0157373_10810682 | Ga0157373_108106821 | 93 |
| 100 | 3300013100 | Ga0157373_10950617 | Ga0157373_109506172 | 93 |
| 101 | 3300013100 | Ga0157373_11140443 | Ga0157373_111404431 | 93 |
| 102 | 3300013102 | Ga0157371_11413632 | Ga0157371_114136321 | 93 |
| 103 | 3300013105 | Ga0157369_10814722 | Ga0157369_108147222 | 93 |
| 104 | 3300013307 | Ga0157372_10694608 | Ga0157372_106946083 | 93 |
| 105 | 3300013307 | Ga0157372_12052132 | Ga0157372_120521322 | 93 |
| 106 | 3300014969 | Ga0157376_13039865 | Ga0157376_130398651 | 93 |
| 107 | 3300015261 | Ga0182006_1222818 | Ga0182006_12228181 | 93 |
| 108 | 3300015261 | Ga0182006_1236851 | Ga0182006_12368511 | 93 |
| 109 | 3300015261 | Ga0182006_1268853 | Ga0182006_12688531 | 93 |
| 110 | 3300015262 | Ga0182007_10198766 | Ga0182007_101987662 | 93 |
| 111 | 3300025904 | Ga0207647_10051464 | Ga0207647_100514642 | 93 |
| 112 | 3300025909 | Ga0207705_10002488 | Ga0207705_100024885 | 93 |
| 113 | 3300025911 | Ga0207654_10153566 | Ga0207654_101535661 | 93 |
| 114 | 3300025919 | Ga0207657_10452392 | Ga0207657_104523922 | 93 |
| 115 | 3300025919 | Ga0207657_10814014 | Ga0207657_108140142 | 93 |
| 116 | 3300025920 | Ga0207649_10190783 | Ga0207649_101907833 | 93 |
| 117 | 3300025924 | Ga0207694_10091899 | Ga0207694_100918992 | 93 |
| 118 | 3300025929 | Ga0207664_10000093 | Ga0207664_1000009343 | 93 |
| 119 | 3300025932 | Ga0207690_10008812 | Ga0207690_100088125 | 93 |
| 120 | 3300025932 | Ga0207690_10011237 | Ga0207690_100112372 | 93 |
| 121 | 3300025932 | Ga0207690_10277957 | Ga0207690_102779572 | 93 |
| 122 | 3300025933 | Ga0207706_10023010 | Ga0207706_100230105 | 93 |
| 123 | 3300025945 | Ga0207679_11191009 | Ga0207679_111910091 | 93 |
| 124 | 3300025949 | Ga0207667_10222369 | Ga0207667_102223692 | 93 |
| 125 | 3300025981 | Ga0207640_10022187 | Ga0207640_100221873 | 93 |
| 126 | 3300026041 | Ga0207639_10973898 | Ga0207639_109738981 | 93 |
| 127 | 3300026078 | Ga0207702_10013058 | Ga0207702_100130585 | 93 |
| 128 | 3300026116 | Ga0207674_10056186 | Ga0207674_100561864 | 93 |
| 129 | 3300026116 | Ga0207674_11010078 | Ga0207674_110100782 | 93 |
| 130 | 3300049568 | Ga0501031_0203615 | Ga0501031_0203615_496_780 | 93 |
| 131 | 3300049569 | Ga0501032_0011458 | Ga0501032_0011458_3701_3985 | 93 |
| 132 | 3300049570 | Ga0501033_0264462 | Ga0501033_0264462_29_313 | 93 |
| 133 | 3300049571 | Ga0501034_0276766 | Ga0501034_0276766_329_613 | 93 |
| 134 | 3300049573 | Ga0501037_0041823 | Ga0501037_0041823_2253_2537 | 93 |
| 135 | 3300049579 | Ga0501043_0204498 | Ga0501043_0204498_959_1243 | 93 |
| 136 | 3300049580 | Ga0501046_0008482 | Ga0501046_0008482_5147_5431 | 93 |
| 137 | 3300049581 | Ga0501047_0260255 | Ga0501047_0260255_501_785 | 93 |
| 138 | 3300049581 | Ga0501047_0306226 | Ga0501047_0306226_799_1098 | 93 |
| 139 | 3300049822 | Ga0501035_0282385 | Ga0501035_0282385_509_793 | 93 |
| 140 | 3300049823 | Ga0501044_0128302 | Ga0501044_0128302_1750_2034 | 93 |
| 141 | 3300003323 | rootH1_10213741 | rootH1_102137412 | 94 |
| 142 | iso_pu_bacteria | 2895395659 | 2895397712 | 94 |
| 143 | iso_pu_bacteria | 2939611941 | 2939612476 | 94 |
| 144 | 3300044536 | Ga0466988_0170269 | Ga0466988_0170269_533_823 | 95 |
| 145 | 3300061719 | Ga0466962_0046425 | Ga0466962_0046425_487_777 | 95 |
| 146 | iso_pu_bacteria | 2884411467 | 2884412087 | 95 |
| 147 | iso_pu_bacteria | 2928963466 | 2928967753 | 95 |
| 148 | 3300049822 | Ga0501035_1120117 | Ga0501035_1120117_143_436 | 96 |
| 149 | 3300003752 | Ga0055539_1001681 | Ga0055539_10016813 | 97 |
| 150 | 3300037312 | Ga0395899_0000108 | Ga0395899_0000108_36014_36310 | 97 |
| 151 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_378300_378596 | 97 |
| 152 | 3300038443 | Ga0395901_0321280 | Ga0395901_0321280_1173_1469 | 97 |
| 153 | 3300002737 | JGI25162J39368_1002652 | JGI25162J39368_10026522 | 98 |
| 154 | 3300002737 | JGI25162J39368_1002802 | JGI25162J39368_10028022 | 98 |
| 155 | 3300002737 | JGI25162J39368_1023663 | JGI25162J39368_10236631 | 98 |
| 156 | 3300002741 | JGI25157J39369_1001037 | JGI25157J39369_10010376 | 98 |
| 157 | 3300002772 | JGI25164J39214_1001246 | JGI25164J39214_10012467 | 98 |
| 158 | 3300002772 | JGI25164J39214_1001331 | JGI25164J39214_10013312 | 98 |
| 159 | 3300003214 | JGI25165J46597_1002406 | JGI25165J46597_10024062 | 98 |
| 160 | 3300003214 | JGI25165J46597_1003986 | JGI25165J46597_10039864 | 98 |
| 161 | 3300003214 | JGI25165J46597_1010492 | JGI25165J46597_10104922 | 98 |
| 162 | 3300003316 | rootH1_10092329 | rootH1_100923292 | 98 |
| 163 | 3300005337 | Ga0070682_100024050 | Ga0070682_1000240504 | 98 |
| 164 | 3300005366 | Ga0070659_100006031 | Ga0070659_1000060317 | 98 |
| 165 | 3300005435 | Ga0070714_100021926 | Ga0070714_1000219261 | 98 |
| 166 | 3300005436 | Ga0070713_100445465 | Ga0070713_1004454652 | 98 |
| 167 | 3300005439 | Ga0070711_101023937 | Ga0070711_1010239371 | 98 |
| 168 | 3300005458 | Ga0070681_10037468 | Ga0070681_100374684 | 98 |
| 169 | 3300005530 | Ga0070679_100638957 | Ga0070679_1006389571 | 98 |
| 170 | 3300005530 | Ga0070679_100644741 | Ga0070679_1006447412 | 98 |
| 171 | 3300005563 | Ga0068855_101001964 | Ga0068855_1010019642 | 98 |
| 172 | 3300005578 | Ga0068854_100233900 | Ga0068854_1002339003 | 98 |
| 173 | 3300009551 | Ga0105238_10140357 | Ga0105238_101403572 | 98 |
| 174 | 3300013104 | Ga0157370_10054161 | Ga0157370_100541615 | 98 |
| 175 | 3300013104 | Ga0157370_10070270 | Ga0157370_100702704 | 98 |
| 176 | 3300013307 | Ga0157372_10013585 | Ga0157372_100135853 | 98 |
| 177 | 3300014497 | Ga0182008_10176001 | Ga0182008_101760012 | 98 |
| 178 | 3300014497 | Ga0182008_10185401 | Ga0182008_101854012 | 98 |
| 179 | 3300015261 | Ga0182006_1085461 | Ga0182006_10854612 | 98 |
| 180 | 3300015262 | Ga0182007_10031158 | Ga0182007_100311582 | 98 |
| 181 | 3300015262 | Ga0182007_10058840 | Ga0182007_100588402 | 98 |
| 182 | 3300015262 | Ga0182007_10068760 | Ga0182007_100687601 | 98 |
| 183 | 3300015262 | Ga0182007_10410746 | Ga0182007_104107461 | 98 |
| 184 | 3300025226 | Ga0209674_108175 | Ga0209674_1081752 | 98 |
| 185 | 3300025231 | Ga0207427_100244 | Ga0207427_1002442 | 98 |
| 186 | 3300025231 | Ga0207427_100248 | Ga0207427_1002482 | 98 |
| 187 | 3300025233 | Ga0209437_100020 | Ga0209437_100020361 | 98 |
| 188 | 3300025233 | Ga0209437_100079 | Ga0209437_10007942 | 98 |
| 189 | 3300025242 | Ga0209258_121897 | Ga0209258_1218972 | 98 |
| 190 | 3300025250 | Ga0209026_1000037 | Ga0209026_100003782 | 98 |
| 191 | 3300025256 | Ga0209759_1014075 | Ga0209759_10140753 | 98 |
| 192 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020264 | 98 |
| 193 | 3300025261 | Ga0209233_1000147 | Ga0209233_10001472 | 98 |
| 194 | 3300025297 | Ga0209758_1094136 | Ga0209758_10941362 | 98 |
| 195 | 3300025912 | Ga0207707_10025218 | Ga0207707_100252184 | 98 |
| 196 | 3300025912 | Ga0207707_10111681 | Ga0207707_101116812 | 98 |
| 197 | 3300025916 | Ga0207663_11198011 | Ga0207663_111980111 | 98 |
| 198 | 3300025924 | Ga0207694_10298633 | Ga0207694_102986332 | 98 |
| 199 | 3300025928 | Ga0207700_10049378 | Ga0207700_100493783 | 98 |
| 200 | 3300025929 | Ga0207664_10001554 | Ga0207664_1000155414 | 98 |
| 201 | 3300025929 | Ga0207664_10026051 | Ga0207664_100260512 | 98 |
| 202 | 3300025932 | Ga0207690_10023661 | Ga0207690_100236614 | 98 |
| 203 | 3300025949 | Ga0207667_10755298 | Ga0207667_107552981 | 98 |
| 204 | 3300025981 | Ga0207640_10198663 | Ga0207640_101986632 | 98 |
| 205 | 3300026041 | Ga0207639_10543854 | Ga0207639_105438542 | 98 |
| 206 | 3300031238 | Ga0265332_10134816 | Ga0265332_101348161 | 98 |
| 207 | 3300033179 | Ga0307507_10704355 | Ga0307507_107043552 | 98 |
| 208 | 3300037418 | Ga0395900_1379810 | Ga0395900_1379810_256_558 | 98 |
| 209 | 3300038443 | Ga0395901_0327130 | Ga0395901_0327130_262_564 | 98 |
| 210 | 3300046660 | Ga0495625_0776070 | Ga0495625_0776070_46_345 | 98 |
| 211 | 3300049569 | Ga0501032_0288956 | Ga0501032_0288956_115_459 | 98 |
| 212 | 3300049570 | Ga0501033_0003177 | Ga0501033_0003177_5063_5362 | 98 |
| 213 | 3300049570 | Ga0501033_0027424 | Ga0501033_0027424_104_445 | 98 |
| 214 | 3300049571 | Ga0501034_0624578 | Ga0501034_0624578_606_947 | 98 |
| 215 | 3300049572 | Ga0501036_0947880 | Ga0501036_0947880_137_478 | 98 |
| 216 | 3300049578 | Ga0501042_0201251 | Ga0501042_0201251_1048_1389 | 98 |
| 217 | 3300049579 | Ga0501043_0101562 | Ga0501043_0101562_753_1094 | 98 |
| 218 | 3300049581 | Ga0501047_0365964 | Ga0501047_0365964_328_672 | 98 |
| 219 | 3300049581 | Ga0501047_0505154 | Ga0501047_0505154_112_453 | 98 |
| 220 | 3300049582 | Ga0501048_0033093 | Ga0501048_0033093_3175_3516 | 98 |
| 221 | 3300049742 | Ga0501080_0368887 | Ga0501080_0368887_323_664 | 98 |
| 222 | 3300049822 | Ga0501035_0048478 | Ga0501035_0048478_2197_2541 | 98 |
| 223 | 3300049823 | Ga0501044_0080586 | Ga0501044_0080586_1787_2131 | 98 |
| 224 | 3300049823 | Ga0501044_0389542 | Ga0501044_0389542_854_1195 | 98 |
| 225 | 3300001989 | JGI24739J22299_10171110 | JGI24739J22299_101711102 | 99 |
| 226 | 3300001990 | JGI24737J22298_10080966 | JGI24737J22298_100809662 | 99 |
| 227 | 3300002067 | JGI24735J21928_10017179 | JGI24735J21928_100171793 | 99 |
| 228 | 3300002737 | JGI25162J39368_1000859 | JGI25162J39368_10008595 | 99 |
| 229 | 3300002738 | JGI25154J39366_1003304 | JGI25154J39366_10033044 | 99 |
| 230 | 3300002741 | JGI25157J39369_1001307 | JGI25157J39369_100130712 | 99 |
| 231 | 3300002772 | JGI25164J39214_1000045 | JGI25164J39214_100004545 | 99 |
| 232 | 3300003214 | JGI25165J46597_1000072 | JGI25165J46597_100007245 | 99 |
| 233 | 3300003756 | Ga0055533_1003517 | Ga0055533_10035172 | 99 |
| 234 | 3300003759 | Ga0055525_1000027 | Ga0055525_1000027221 | 99 |
| 235 | 3300003760 | Ga0055527_1000199 | Ga0055527_10001993 | 99 |
| 236 | 3300003760 | Ga0055527_1000212 | Ga0055527_10002123 | 99 |
| 237 | 3300003760 | Ga0055527_1003581 | Ga0055527_10035813 | 99 |
| 238 | 3300003761 | Ga0055535_1000585 | Ga0055535_100058528 | 99 |
| 239 | 3300003761 | Ga0055535_1001486 | Ga0055535_10014865 | 99 |
| 240 | 3300003761 | Ga0055535_1001521 | Ga0055535_10015216 | 99 |
| 241 | 3300003761 | Ga0055535_1001790 | Ga0055535_10017906 | 99 |
| 242 | 3300003762 | Ga0055542_1000242 | Ga0055542_100024232 | 99 |
| 243 | 3300003762 | Ga0055542_1000497 | Ga0055542_100049731 | 99 |
| 244 | 3300003762 | Ga0055542_1001722 | Ga0055542_10017226 | 99 |
| 245 | 3300003762 | Ga0055542_1001732 | Ga0055542_10017326 | 99 |
| 246 | 3300003763 | Ga0055529_1000204 | Ga0055529_100020448 | 99 |
| 247 | 3300003763 | Ga0055529_1000846 | Ga0055529_10008463 | 99 |
| 248 | 3300003763 | Ga0055529_1001254 | Ga0055529_10012546 | 99 |
| 249 | 3300005435 | Ga0070714_101660957 | Ga0070714_1016609571 | 99 |
| 250 | 3300005614 | Ga0068856_100047778 | Ga0068856_1000477781 | 99 |
| 251 | 3300015687 | Ga0183368_1002 | Ga0183368_1002273 | 99 |
| 252 | 3300025226 | Ga0209674_100043 | Ga0209674_100043240 | 99 |
| 253 | 3300025226 | Ga0209674_100086 | Ga0209674_100086114 | 99 |
| 254 | 3300025226 | Ga0209674_101483 | Ga0209674_1014835 | 99 |
| 255 | 3300025228 | Ga0209672_100005 | Ga0209672_100005722 | 99 |
| 256 | 3300025228 | Ga0209672_100029 | Ga0209672_100029226 | 99 |
| 257 | 3300025228 | Ga0209672_100142 | Ga0209672_1001422 | 99 |
| 258 | 3300025230 | Ga0209563_100023 | Ga0209563_100023381 | 99 |
| 259 | 3300025231 | Ga0207427_100055 | Ga0207427_100055166 | 99 |
| 260 | 3300025233 | Ga0209437_100161 | Ga0209437_10016164 | 99 |
| 261 | 3300025242 | Ga0209258_100006 | Ga0209258_100006722 | 99 |
| 262 | 3300025242 | Ga0209258_100053 | Ga0209258_100053104 | 99 |
| 263 | 3300025242 | Ga0209258_100064 | Ga0209258_100064251 | 99 |
| 264 | 3300025242 | Ga0209258_100186 | Ga0209258_10018680 | 99 |
| 265 | 3300025242 | Ga0209258_100481 | Ga0209258_1004815 | 99 |
| 266 | 3300025246 | Ga0209646_1002370 | Ga0209646_10023702 | 99 |
| 267 | 3300025250 | Ga0209026_1000493 | Ga0209026_10004931 | 99 |
| 268 | 3300025250 | Ga0209026_1001161 | Ga0209026_10011612 | 99 |
| 269 | 3300025253 | Ga0209677_100603 | Ga0209677_1006038 | 99 |
| 270 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009226 | 99 |
| 271 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012722 | 99 |
| 272 | 3300025254 | Ga0209148_1000073 | Ga0209148_100007361 | 99 |
| 273 | 3300025254 | Ga0209148_1000142 | Ga0209148_100014236 | 99 |
| 274 | 3300025256 | Ga0209759_1000103 | Ga0209759_100010365 | 99 |
| 275 | 3300025256 | Ga0209759_1000725 | Ga0209759_10007251 | 99 |
| 276 | 3300025261 | Ga0209233_1000063 | Ga0209233_1000063316 | 99 |
| 277 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008722 | 99 |
| 278 | 3300025272 | Ga0209455_1000060 | Ga0209455_1000060226 | 99 |
| 279 | 3300025272 | Ga0209455_1000177 | Ga0209455_100017781 | 99 |
| 280 | 3300025929 | Ga0207664_11197950 | Ga0207664_111979502 | 99 |
| 281 | 3300026078 | Ga0207702_10030863 | Ga0207702_100308635 | 99 |
| 282 | 3300037312 | Ga0395899_0003614 | Ga0395899_0003614_442_753 | 99 |
| 283 | 3300037312 | Ga0395899_0013691 | Ga0395899_0013691_637_939 | 99 |
| 284 | 3300037312 | Ga0395899_0071469 | Ga0395899_0071469_1105_1416 | 99 |
| 285 | 3300037312 | Ga0395899_0594657 | Ga0395899_0594657_337_675 | 99 |
| 286 | 3300037312 | Ga0395899_0849176 | Ga0395899_0849176_31_369 | 99 |
| 287 | 3300037418 | Ga0395900_0000755 | Ga0395900_0000755_3836_4138 | 99 |
| 288 | 3300037418 | Ga0395900_0005765 | Ga0395900_0005765_1973_2284 | 99 |
| 289 | 3300037418 | Ga0395900_0006415 | Ga0395900_0006415_1585_1923 | 99 |
| 290 | 3300037418 | Ga0395900_0496969 | Ga0395900_0496969_62_373 | 99 |
| 291 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_236289_236591 | 99 |
| 292 | 3300037466 | Ga0395898_0001843 | Ga0395898_0001843_16229_16567 | 99 |
| 293 | 3300037466 | Ga0395898_0006742 | Ga0395898_0006742_10685_10996 | 99 |
| 294 | 3300037466 | Ga0395898_0073871 | Ga0395898_0073871_1759_2070 | 99 |
| 295 | 3300037471 | Ga0395905_0848914 | Ga0395905_0848914_288_599 | 99 |
| 296 | 3300037471 | Ga0395905_1129596 | Ga0395905_1129596_49_387 | 99 |
| 297 | 3300038443 | Ga0395901_0021152 | Ga0395901_0021152_5298_5600 | 99 |
| 298 | 3300038443 | Ga0395901_0022286 | Ga0395901_0022286_4568_4906 | 99 |
| 299 | 3300038443 | Ga0395901_0057321 | Ga0395901_0057321_62_373 | 99 |
| 300 | 3300038443 | Ga0395901_0057886 | Ga0395901_0057886_1822_2133 | 99 |
| 301 | 3300038443 | Ga0395901_0130299 | Ga0395901_0130299_1022_1324 | 99 |
| 302 | 3300044656 | Ga0466969_0017091 | Ga0466969_0017091_2084_2386 | 99 |
| 303 | 3300044656 | Ga0466969_0031034 | Ga0466969_0031034_1413_1715 | 99 |
| 304 | 3300044656 | Ga0466969_0097065 | Ga0466969_0097065_1007_1309 | 99 |
| 305 | 3300044661 | Ga0466975_0681567 | Ga0466975_0681567_53_355 | 99 |
| 306 | 3300044684 | Ga0466966_0003688 | Ga0466966_0003688_2732_3034 | 99 |
| 307 | 3300044684 | Ga0466966_0045356 | Ga0466966_0045356_402_704 | 99 |
| 308 | 3300044684 | Ga0466966_0168289 | Ga0466966_0168289_110_412 | 99 |
| 309 | 3300044693 | Ga0466961_0002304 | Ga0466961_0002304_5194_5496 | 99 |
| 310 | 3300044693 | Ga0466961_0007229 | Ga0466961_0007229_6277_6579 | 99 |
| 311 | 3300044693 | Ga0466961_0011723 | Ga0466961_0011723_5126_5428 | 99 |
| 312 | 3300044693 | Ga0466961_0054455 | Ga0466961_0054455_2107_2409 | 99 |
| 313 | 3300044694 | Ga0466963_0988202 | Ga0466963_0988202_202_504 | 99 |
| 314 | 3300044706 | Ga0466964_0245250 | Ga0466964_0245250_36_338 | 99 |
| 315 | 3300044719 | Ga0466971_0703258 | Ga0466971_0703258_50_352 | 99 |
| 316 | 3300044735 | Ga0466968_0360184 | Ga0466968_0360184_168_470 | 99 |
| 317 | 3300044765 | Ga0466970_0041449 | Ga0466970_0041449_2077_2379 | 99 |
| 318 | 3300044842 | Ga0466957_0022645 | Ga0466957_0022645_22_324 | 99 |
| 319 | 3300044842 | Ga0466957_0610956 | Ga0466957_0610956_170_472 | 99 |
| 320 | 3300045049 | Ga0466959_0000347 | Ga0466959_0000347_2107_2409 | 99 |
| 321 | 3300045049 | Ga0466959_0258315 | Ga0466959_0258315_522_824 | 99 |
| 322 | 3300045836 | Ga0466958_0015903 | Ga0466958_0015903_2272_2574 | 99 |
| 323 | 3300045836 | Ga0466958_0692645 | Ga0466958_0692645_163_465 | 99 |
| 324 | 3300045976 | Ga0466967_1470837 | Ga0466967_1470837_93_392 | 99 |
| 325 | 3300048916 | Ga0496113_0101589 | Ga0496113_0101589_24_323 | 99 |
| 326 | 3300048918 | Ga0496115_0000115 | Ga0496115_0000115_45830_46129 | 99 |
| 327 | 3300049569 | Ga0501032_0049799 | Ga0501032_0049799_850_1194 | 99 |
| 328 | 3300049572 | Ga0501036_1269129 | Ga0501036_1269129_62_409 | 99 |
| 329 | 3300049573 | Ga0501037_0250212 | Ga0501037_0250212_536_880 | 99 |
| 330 | 3300049575 | Ga0501039_0246990 | Ga0501039_0246990_494_838 | 99 |
| 331 | 3300049581 | Ga0501047_1313486 | Ga0501047_1313486_145_489 | 99 |
| 332 | 3300049823 | Ga0501044_1423852 | Ga0501044_1423852_53_400 | 99 |
| 333 | 3300049824 | Ga0501045_0373734 | Ga0501045_0373734_361_705 | 99 |
| 334 | 3300061719 | Ga0466962_0093879 | Ga0466962_0093879_85_387 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar