F411975

General Info

Members Datasets Scaffolds Average Seq Length
334 147 328 99

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_1269129|Ga0501036_1269129_62_409
Length 115
Sequence MSTGLLVQYVVVGLIVLVSALVAFRKLAPQLTNRWFAAASIRLGQPGRSRLARALSRRLQPKQATGNCADGCATCGACGPKKPAAATPMPRRRSDSSGQARVAEPMPLHFRPRSH

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2884411467 Dyella sp. AD56 Isolate Rhizosphere
4 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
5 2928963466 Dyella japonica 1073 Isolate Unclassified
6 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
61 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.3
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.86
Nodule 0
Rhizoplane 1.5
Rhizosphere 71.26
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10171110 3300001989 Bacteria 640
2 JGI24737J22298_10080966 3300001990 Bacteria 966
3 JGI24735J21928_10017179 3300002067 Bacteria 2238
4 JGI25156J39149_1003131 3300002705 Bacteria 5573
5 JGI25162J39368_1000859 3300002737 Bacteria 19993
6 JGI25162J39368_1002652 3300002737 Bacteria 6599
7 JGI25162J39368_1002802 3300002737 Bacteria 6134
8 JGI25162J39368_1023663 3300002737 Bacteria 557
9 JGI25154J39366_1003304 3300002738 Bacteria 3481
10 JGI25157J39369_1001037 3300002741 Bacteria 12751
11 JGI25157J39369_1001307 3300002741 Bacteria 9942
12 JGI25157J39369_1002822 3300002741 Bacteria 3940
13 JGI25164J39214_1000045 3300002772 Bacteria 125909
14 JGI25164J39214_1001246 3300002772 Bacteria 6767
15 JGI25164J39214_1001331 3300002772 Bacteria 6126
16 JGI25165J46597_1000072 3300003214 Bacteria 192184
17 JGI25165J46597_1002406 3300003214 Bacteria 6134
18 JGI25165J46597_1003986 3300003214 Bacteria 3370
19 JGI25165J46597_1010492 3300003214 Bacteria 1349
20 rootH1_10092329 3300003316 Bacteria 1424
21 rootH1_10213741 3300003323 Bacteria 1173
22 Ga0055539_1001681 3300003752 Bacteria 3919
23 Ga0055533_1003517 3300003756 Bacteria 3116
24 Ga0055525_1000027 3300003759 Bacteria 340506
25 Ga0055527_1000199 3300003760 Bacteria 39633
26 Ga0055527_1000212 3300003760 Bacteria 37749
27 Ga0055527_1003581 3300003760 Bacteria 2271
28 Ga0055535_1000585 3300003761 Bacteria 30486
29 Ga0055535_1001486 3300003761 Bacteria 11703
30 Ga0055535_1001521 3300003761 Bacteria 11438
31 Ga0055535_1001790 3300003761 Bacteria 9441
32 Ga0055542_1000242 3300003762 Bacteria 62798
33 Ga0055542_1000497 3300003762 Bacteria 36142
34 Ga0055542_1001722 3300003762 Bacteria 9441
35 Ga0055542_1001732 3300003762 Bacteria 9374
36 Ga0055529_1000204 3300003763 Bacteria 78293
37 Ga0055529_1000846 3300003763 Bacteria 17865
38 Ga0055529_1001254 3300003763 Bacteria 9378
39 Ga0055529_1010377 3300003763 Bacteria 1211
40 Ga0070682_100024050 3300005337 Bacteria 3622
41 Ga0070682_100786727 3300005337 Bacteria 771
42 Ga0070660_101668803 3300005339 Bacteria 542
43 Ga0070692_10016799 3300005345 Bacteria 3486
44 Ga0070688_100081713 3300005365 Bacteria 2093
45 Ga0070659_100006031 3300005366 Bacteria 8739
46 Ga0070659_101490720 3300005366 Bacteria 602
47 Ga0070714_100000149 3300005435 Bacteria 55827
48 Ga0070714_100021926 3300005435 Bacteria 5230
49 Ga0070714_101660957 3300005435 Bacteria 624
50 Ga0070713_100445465 3300005436 Bacteria 1215
51 Ga0070711_101023937 3300005439 Bacteria 709
52 Ga0070663_100089635 3300005455 Bacteria 2276
53 Ga0070662_100118515 3300005457 Bacteria 2026
54 Ga0070681_10037468 3300005458 Bacteria 4865
55 Ga0070681_10079625 3300005458 Bacteria 3233
56 Ga0070679_100027791 3300005530 Bacteria 5571
57 Ga0070679_100638957 3300005530 Bacteria 1007
58 Ga0070679_100644741 3300005530 Bacteria 1002
59 Ga0068853_100201472 3300005539 Bacteria 1811
60 Ga0068853_101190866 3300005539 Bacteria 735
61 Ga0070696_100023857 3300005546 Bacteria 4157
62 Ga0070693_100036848 3300005547 Bacteria 2722
63 Ga0070693_100113663 3300005547 Bacteria 1669
64 Ga0068855_100161016 3300005563 Bacteria 2547
65 Ga0068855_101001964 3300005563 Bacteria 878
66 Ga0068855_102147789 3300005563 Bacteria 561
67 Ga0070664_100160317 3300005564 Bacteria 1990
68 Ga0068857_100410246 3300005577 Bacteria 1261
69 Ga0068854_100233900 3300005578 Bacteria 1460
70 Ga0068854_101905239 3300005578 Bacteria 546
71 Ga0068856_100000053 3300005614 Bacteria 106241
72 Ga0068856_100006710 3300005614 Bacteria 11280
73 Ga0068856_100047778 3300005614 Bacteria 4217
74 Ga0068856_101490052 3300005614 Bacteria 690
75 Ga0070712_100618935 3300006175 Bacteria 918
76 Ga0105240_10171194 3300009093 Bacteria 2572
77 Ga0105240_10715702 3300009093 Bacteria 1091
78 Ga0105241_11392938 3300009174 Bacteria 671
79 Ga0105237_10000007 3300009545 Bacteria 367690
80 Ga0105237_10370742 3300009545 Bacteria 1436
81 Ga0105238_10140357 3300009551 Bacteria 2393
82 Ga0105238_10709580 3300009551 Bacteria 1018
83 Ga0105239_10215717 3300010375 Bacteria 2151
84 Ga0157373_10160339 3300013100 Bacteria 1583
85 Ga0157373_10253472 3300013100 Bacteria 1245
86 Ga0157373_10390848 3300013100 Bacteria 996
87 Ga0157373_10810682 3300013100 Bacteria 691
88 Ga0157373_10950617 3300013100 Bacteria 639
89 Ga0157373_11140443 3300013100 Bacteria 586
90 Ga0157371_10859692 3300013102 Bacteria 686
91 Ga0157371_11413632 3300013102 Bacteria 541
92 Ga0157370_10054161 3300013104 Bacteria 3824
93 Ga0157370_10070270 3300013104 Bacteria 3305
94 Ga0157370_10096768 3300013104 Bacteria 2769
95 Ga0157369_10016000 3300013105 Bacteria 8441
96 Ga0157369_10338715 3300013105 Bacteria 1562
97 Ga0157369_10564653 3300013105 Bacteria 1176
98 Ga0157369_10814722 3300013105 Bacteria 959
99 Ga0157372_10013585 3300013307 Bacteria 8704
100 Ga0157372_10018106 3300013307 Bacteria 7571
101 Ga0157372_10694608 3300013307 Bacteria 1184
102 Ga0157372_11259540 3300013307 Bacteria 854
103 Ga0157372_12052132 3300013307 Bacteria 657
104 Ga0182008_10144949 3300014497 Bacteria 1189
105 Ga0182008_10176001 3300014497 Bacteria 1081
106 Ga0182008_10185401 3300014497 Bacteria 1054
107 Ga0157376_13039865 3300014969 Bacteria 508
108 Ga0182006_1085461 3300015261 Bacteria 1144
109 Ga0182006_1222818 3300015261 Bacteria 621
110 Ga0182006_1236851 3300015261 Bacteria 600
111 Ga0182006_1268853 3300015261 Bacteria 559
112 Ga0182007_10031158 3300015262 Bacteria 1819
113 Ga0182007_10058840 3300015262 Bacteria 1260
114 Ga0182007_10068760 3300015262 Bacteria 1160
115 Ga0182007_10106157 3300015262 Bacteria 932
116 Ga0182007_10198766 3300015262 Bacteria 700
117 Ga0182007_10410746 3300015262 Bacteria 517
118 Ga0183369_1008 3300015685 Bacteria 346514
119 Ga0183368_1002 3300015687 Bacteria 1865598
120 Ga0206353_10868182 3300020082 Bacteria 2038
121 Ga0209674_100043 3300025226 Bacteria 369728
122 Ga0209674_100086 3300025226 Bacteria 187776
123 Ga0209674_101483 3300025226 Bacteria 6119
124 Ga0209674_108175 3300025226 Bacteria 1257
125 Ga0209672_100005 3300025228 Bacteria 1069303
126 Ga0209672_100029 3300025228 Bacteria 339298
127 Ga0209672_100142 3300025228 Bacteria 67156
128 Ga0209563_100023 3300025230 Bacteria 636844
129 Ga0207427_100055 3300025231 Bacteria 209093
130 Ga0207427_100244 3300025231 Bacteria 43765
131 Ga0207427_100248 3300025231 Bacteria 42623
132 Ga0209437_100020 3300025233 Bacteria 656374
133 Ga0209437_100079 3300025233 Bacteria 275948
134 Ga0209437_100161 3300025233 Bacteria 148264
135 Ga0209258_100006 3300025242 Bacteria 1069303
136 Ga0209258_100053 3300025242 Bacteria 339233
137 Ga0209258_100064 3300025242 Bacteria 293837
138 Ga0209258_100186 3300025242 Bacteria 132381
139 Ga0209258_100481 3300025242 Bacteria 41699
140 Ga0209258_121897 3300025242 Bacteria 658
141 Ga0209646_1001520 3300025246 Bacteria 6147
142 Ga0209646_1002370 3300025246 Bacteria 4223
143 Ga0209026_1000037 3300025250 Bacteria 282562
144 Ga0209026_1000493 3300025250 Bacteria 28912
145 Ga0209026_1001155 3300025250 Bacteria 12356
146 Ga0209026_1001161 3300025250 Bacteria 12266
147 Ga0209677_100603 3300025253 Bacteria 19450
148 Ga0209148_1000009 3300025254 Bacteria 1395625
149 Ga0209148_1000012 3300025254 Bacteria 1069303
150 Ga0209148_1000073 3300025254 Bacteria 320851
151 Ga0209148_1000142 3300025254 Bacteria 163404
152 Ga0209759_1000103 3300025256 Bacteria 153195
153 Ga0209759_1000725 3300025256 Bacteria 28902
154 Ga0209759_1008558 3300025256 Bacteria 3177
155 Ga0209759_1014075 3300025256 Bacteria 2134
156 Ga0209233_1000020 3300025261 Bacteria 798224
157 Ga0209233_1000063 3300025261 Bacteria 395810
158 Ga0209233_1000147 3300025261 Bacteria 186517
159 Ga0209455_1000008 3300025272 Bacteria 1069303
160 Ga0209455_1000060 3300025272 Bacteria 339298
161 Ga0209455_1000177 3300025272 Bacteria 106026
162 Ga0209455_1000271 3300025272 Bacteria 57704
163 Ga0209455_1018885 3300025272 Bacteria 1405
164 Ga0209758_1094136 3300025297 Bacteria 869
165 Ga0207647_10051464 3300025904 Bacteria 2545
166 Ga0207647_10670486 3300025904 Bacteria 567
167 Ga0207705_10002488 3300025909 Bacteria 14195
168 Ga0207654_10153566 3300025911 Bacteria 1480
169 Ga0207707_10025218 3300025912 Bacteria 5201
170 Ga0207707_10047527 3300025912 Bacteria 3737
171 Ga0207707_10111681 3300025912 Bacteria 2390
172 Ga0207695_10197583 3300025913 Bacteria 1927
173 Ga0207671_10003358 3300025914 Bacteria 16056
174 Ga0207663_11198011 3300025916 Bacteria 611
175 Ga0207657_10452392 3300025919 Bacteria 1007
176 Ga0207657_10814014 3300025919 Bacteria 722
177 Ga0207649_10190783 3300025920 Bacteria 1441
178 Ga0207694_10091899 3300025924 Bacteria 2395
179 Ga0207694_10298633 3300025924 Bacteria 1326
180 Ga0207700_10049378 3300025928 Bacteria 3129
181 Ga0207664_10000093 3300025929 Bacteria 81829
182 Ga0207664_10001554 3300025929 Bacteria 15056
183 Ga0207664_10026051 3300025929 Bacteria 4415
184 Ga0207664_11197950 3300025929 Bacteria 677
185 Ga0207690_10008812 3300025932 Bacteria 5988
186 Ga0207690_10011237 3300025932 Bacteria 5347
187 Ga0207690_10023661 3300025932 Bacteria 3836
188 Ga0207690_10277957 3300025932 Bacteria 1303
189 Ga0207690_11072162 3300025932 Bacteria 671
190 Ga0207706_10023010 3300025933 Bacteria 5596
191 Ga0207679_11191009 3300025945 Bacteria 699
192 Ga0207667_10222369 3300025949 Bacteria 1934
193 Ga0207667_10595551 3300025949 Bacteria 1115
194 Ga0207667_10755298 3300025949 Bacteria 971
195 Ga0207640_10022187 3300025981 Bacteria 3795
196 Ga0207640_10198663 3300025981 Bacteria 1518
197 Ga0207640_10842489 3300025981 Bacteria 797
198 Ga0207639_10543854 3300026041 Bacteria 1066
199 Ga0207639_10618853 3300026041 Bacteria 1000
200 Ga0207639_10973898 3300026041 Bacteria 794
201 Ga0207678_10020550 3300026067 Bacteria 5788
202 Ga0207702_10001010 3300026078 Bacteria 28892
203 Ga0207702_10013058 3300026078 Bacteria 6907
204 Ga0207702_10030863 3300026078 Bacteria 4465
205 Ga0207674_10056186 3300026116 Bacteria 3998
206 Ga0207674_11010078 3300026116 Bacteria 801
207 Ga0207683_10924741 3300026121 Bacteria 810
208 Ga0265332_10134816 3300031238 Bacteria 1035
209 Ga0307507_10704355 3300033179 Bacteria 504
210 Ga0395899_0000108 3300037312 Bacteria 142347
211 Ga0395899_0003614 3300037312 Bacteria 12231
212 Ga0395899_0013691 3300037312 Bacteria 6201
213 Ga0395899_0071469 3300037312 Bacteria 2539
214 Ga0395899_0594657 3300037312 Bacteria 705
215 Ga0395899_0849176 3300037312 Bacteria 560
216 Ga0395900_0000755 3300037418 Bacteria 42995
217 Ga0395900_0005765 3300037418 Bacteria 12941
218 Ga0395900_0006415 3300037418 Bacteria 12257
219 Ga0395900_0496969 3300037418 Bacteria 1170
220 Ga0395900_1379810 3300037418 Bacteria 618
221 Ga0395898_0000018 3300037466 Bacteria 418600
222 Ga0395898_0000049 3300037466 Bacteria 284792
223 Ga0395898_0001843 3300037466 Bacteria 27253
224 Ga0395898_0006742 3300037466 Bacteria 12237
225 Ga0395898_0073871 3300037466 Bacteria 3294
226 Ga0395905_0848914 3300037471 Bacteria 816
227 Ga0395905_1129596 3300037471 Bacteria 687
228 Ga0395901_0021152 3300038443 Bacteria 6664
229 Ga0395901_0022286 3300038443 Bacteria 6490
230 Ga0395901_0057321 3300038443 Bacteria 4051
231 Ga0395901_0057886 3300038443 Bacteria 4031
232 Ga0395901_0130299 3300038443 Bacteria 2643
233 Ga0395901_0321280 3300038443 Bacteria 1601
234 Ga0395901_0327130 3300038443 Bacteria 1585
235 Ga0466988_0170269 3300044536 Bacteria 1259
236 Ga0466969_0017091 3300044656 Bacteria 3791
237 Ga0466969_0031034 3300044656 Bacteria 2721
238 Ga0466969_0097065 3300044656 Bacteria 1390
239 Ga0466975_0681567 3300044661 Bacteria 550
240 Ga0466966_0003688 3300044684 Bacteria 10107
241 Ga0466966_0045356 3300044684 Bacteria 2810
242 Ga0466966_0168289 3300044684 Bacteria 1332
243 Ga0466961_0002304 3300044693 Bacteria 11868
244 Ga0466961_0007229 3300044693 Bacteria 7065
245 Ga0466961_0011723 3300044693 Bacteria 5602
246 Ga0466961_0054455 3300044693 Bacteria 2551
247 Ga0466963_0988202 3300044694 Bacteria 593
248 Ga0466964_0245250 3300044706 Bacteria 881
249 Ga0466971_0703258 3300044719 Bacteria 508
250 Ga0466968_0360184 3300044735 Bacteria 708
251 Ga0466970_0041449 3300044765 Bacteria 2446
252 Ga0466957_0022645 3300044842 Bacteria 3708
253 Ga0466957_0610956 3300044842 Bacteria 764
254 Ga0466959_0000347 3300045049 Bacteria 27371
255 Ga0466959_0258315 3300045049 Bacteria 1199
256 Ga0466958_0015903 3300045836 Bacteria 4324
257 Ga0466958_0692645 3300045836 Bacteria 664
258 Ga0466967_1470837 3300045976 Bacteria 679
259 Ga0495606_0001309 3300046507 Bacteria 34265
260 Ga0495625_0776070 3300046660 Bacteria 559
261 Ga0495649_0007578 3300046694 Bacteria 6600
262 Ga0496113_0101589 3300048916 Bacteria 2229
263 Ga0496114_0492751 3300048917 Bacteria 1084
264 Ga0496115_0000115 3300048918 Bacteria 73259
265 Ga0496115_0003178 3300048918 Bacteria 11802
266 Ga0496115_0027679 3300048918 Bacteria 4436
267 Ga0496124_0407914 3300048927 Bacteria 941
268 Ga0496126_0033433 3300048929 Bacteria 4838
269 Ga0496126_0192711 3300048929 Bacteria 1725
270 Ga0495682_0068782 3300049460 Bacteria 1275
271 Ga0501031_0153038 3300049568 Bacteria 1507
272 Ga0501031_0203615 3300049568 Bacteria 1291
273 Ga0501032_0011458 3300049569 Bacteria 6370
274 Ga0501032_0049799 3300049569 Bacteria 2826
275 Ga0501032_0288956 3300049569 Bacteria 1061
276 Ga0501033_0003177 3300049570 Bacteria 13626
277 Ga0501033_0027424 3300049570 Bacteria 4282
278 Ga0501033_0163911 3300049570 Bacteria 1599
279 Ga0501033_0264462 3300049570 Bacteria 1217
280 Ga0501034_0276766 3300049571 Bacteria 1618
281 Ga0501034_0624578 3300049571 Bacteria 981
282 Ga0501034_1013131 3300049571 Bacteria 714
283 Ga0501036_0947880 3300049572 Bacteria 705
284 Ga0501036_1269129 3300049572 Bacteria 599
285 Ga0501037_0035784 3300049573 Bacteria 3659
286 Ga0501037_0041823 3300049573 Bacteria 3369
287 Ga0501037_0250212 3300049573 Bacteria 1240
288 Ga0501038_0099412 3300049574 Bacteria 2425
289 Ga0501039_0246990 3300049575 Bacteria 1403
290 Ga0501042_0201251 3300049578 Bacteria 1436
291 Ga0501043_0015054 3300049579 Bacteria 6057
292 Ga0501043_0101562 3300049579 Bacteria 2260
293 Ga0501043_0204498 3300049579 Bacteria 1531
294 Ga0501046_0008482 3300049580 Bacteria 8950
295 Ga0501046_0039440 3300049580 Bacteria 3782
296 Ga0501046_0100828 3300049580 Bacteria 2215
297 Ga0501046_0477515 3300049580 Bacteria 895
298 Ga0501047_0056314 3300049581 Bacteria 3801
299 Ga0501047_0179714 3300049581 Bacteria 1982
300 Ga0501047_0260255 3300049581 Bacteria 1583
301 Ga0501047_0306226 3300049581 Bacteria 1430
302 Ga0501047_0365964 3300049581 Bacteria 1277
303 Ga0501047_0505154 3300049581 Bacteria 1035
304 Ga0501047_0918142 3300049581 Bacteria 689
305 Ga0501047_1313486 3300049581 Bacteria 537
306 Ga0501048_0033093 3300049582 Bacteria 3736
307 Ga0501048_0105087 3300049582 Bacteria 1993
308 Ga0501048_1279664 3300049582 Bacteria 527
309 Ga0501070_0210888 3300049586 Bacteria 1594
310 Ga0501080_0368887 3300049742 Bacteria 1294
311 Ga0501035_0042905 3300049822 Bacteria 4077
312 Ga0501035_0048478 3300049822 Bacteria 3809
313 Ga0501035_0282385 3300049822 Bacteria 1403
314 Ga0501035_0584852 3300049822 Bacteria 911
315 Ga0501035_0751871 3300049822 Bacteria 782
316 Ga0501035_1120117 3300049822 Bacteria 614
317 Ga0501044_0034517 3300049823 Bacteria 5303
318 Ga0501044_0080586 3300049823 Bacteria 3297
319 Ga0501044_0128302 3300049823 Bacteria 2532
320 Ga0501044_0133178 3300049823 Bacteria 2478
321 Ga0501044_0263755 3300049823 Bacteria 1660
322 Ga0501044_0389542 3300049823 Bacteria 1307
323 Ga0501044_1274888 3300049823 Bacteria 602
324 Ga0501044_1423852 3300049823 Bacteria 558
325 Ga0501044_1610949 3300049823 Bacteria 514
326 Ga0501045_0373734 3300049824 Bacteria 1061
327 Ga0466962_0046425 3300061719 Bacteria 2075
328 Ga0466962_0093879 3300061719 Bacteria 1438

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002705 JGI25156J39149_1003131 JGI25156J39149_10031312 84
2 3300002741 JGI25157J39369_1002822 JGI25157J39369_10028222 84
3 3300005455 Ga0070663_100089635 Ga0070663_1000896352 84
4 3300005547 Ga0070693_100036848 Ga0070693_1000368482 84
5 3300005563 Ga0068855_100161016 Ga0068855_1001610162 84
6 3300005578 Ga0068854_101905239 Ga0068854_1019052392 84
7 3300009545 Ga0105237_10000007 Ga0105237_1000000787 84
8 3300013104 Ga0157370_10096768 Ga0157370_100967682 84
9 3300020082 Ga0206353_10868182 Ga0206353_108681822 84
10 3300025246 Ga0209646_1001520 Ga0209646_10015202 84
11 3300025250 Ga0209026_1001155 Ga0209026_10011555 84
12 3300025256 Ga0209759_1008558 Ga0209759_10085582 84
13 3300025904 Ga0207647_10670486 Ga0207647_106704861 84
14 3300025913 Ga0207695_10197583 Ga0207695_101975832 84
15 3300025914 Ga0207671_10003358 Ga0207671_1000335816 84
16 3300025981 Ga0207640_10842489 Ga0207640_108424892 84
17 3300026067 Ga0207678_10020550 Ga0207678_100205502 84
18 3300003763 Ga0055529_1010377 Ga0055529_10103771 85
19 3300009093 Ga0105240_10171194 Ga0105240_101711942 85
20 3300013105 Ga0157369_10564653 Ga0157369_105646532 85
21 3300025272 Ga0209455_1000271 Ga0209455_100027122 85
22 3300025949 Ga0207667_10595551 Ga0207667_105955512 85
23 3300049568 Ga0501031_0153038 Ga0501031_0153038_1048_1392 85
24 3300049570 Ga0501033_0163911 Ga0501033_0163911_109_453 85
25 3300049571 Ga0501034_1013131 Ga0501034_1013131_209_556 85
26 3300049573 Ga0501037_0035784 Ga0501037_0035784_44_388 85
27 3300049574 Ga0501038_0099412 Ga0501038_0099412_1940_2284 85
28 3300049579 Ga0501043_0015054 Ga0501043_0015054_3625_3969 85
29 3300049580 Ga0501046_0039440 Ga0501046_0039440_2033_2377 85
30 3300049580 Ga0501046_0100828 Ga0501046_0100828_87_431 85
31 3300049581 Ga0501047_0056314 Ga0501047_0056314_233_577 85
32 3300049581 Ga0501047_0179714 Ga0501047_0179714_1226_1570 85
33 3300049582 Ga0501048_0105087 Ga0501048_0105087_1514_1858 85
34 3300049582 Ga0501048_1279664 Ga0501048_1279664_76_420 85
35 3300049822 Ga0501035_0042905 Ga0501035_0042905_3564_3908 85
36 3300049823 Ga0501044_0034517 Ga0501044_0034517_3224_3568 85
37 3300049823 Ga0501044_0133178 Ga0501044_0133178_113_457 85
38 3300005614 Ga0068856_100000053 Ga0068856_1000000532 88
39 3300009093 Ga0105240_10715702 Ga0105240_107157021 88
40 3300013105 Ga0157369_10016000 Ga0157369_100160003 88
41 3300026078 Ga0207702_10001010 Ga0207702_100010103 88
42 3300014497 Ga0182008_10144949 Ga0182008_101449492 89
43 3300015262 Ga0182007_10106157 Ga0182007_101061572 89
44 3300046507 Ga0495606_0001309 Ga0495606_0001309_12324_12623 89
45 3300046694 Ga0495649_0007578 Ga0495649_0007578_5065_5364 89
46 3300048918 Ga0496115_0003178 Ga0496115_0003178_5329_5628 89
47 3300048929 Ga0496126_0033433 Ga0496126_0033433_882_1181 89
48 3300049460 Ga0495682_0068782 Ga0495682_0068782_53_352 89
49 3300005366 Ga0070659_101490720 Ga0070659_1014907202 90
50 3300005458 Ga0070681_10079625 Ga0070681_100796252 90
51 3300005539 Ga0068853_100201472 Ga0068853_1002014723 90
52 3300025912 Ga0207707_10047527 Ga0207707_100475274 90
53 3300025932 Ga0207690_11072162 Ga0207690_110721622 90
54 3300026041 Ga0207639_10618853 Ga0207639_106188532 90
55 3300005365 Ga0070688_100081713 Ga0070688_1000817132 91
56 3300013100 Ga0157373_10160339 Ga0157373_101603392 91
57 3300013102 Ga0157371_10859692 Ga0157371_108596921 91
58 3300013307 Ga0157372_10018106 Ga0157372_100181068 91
59 3300013307 Ga0157372_11259540 Ga0157372_112595402 91
60 3300015685 Ga0183369_1008 Ga0183369_1008246 91
61 3300025272 Ga0209455_1018885 Ga0209455_10188852 91
62 3300048918 Ga0496115_0027679 Ga0496115_0027679_2532_2831 91
63 3300048927 Ga0496124_0407914 Ga0496124_0407914_171_470 91
64 3300048929 Ga0496126_0192711 Ga0496126_0192711_140_439 91
65 3300049580 Ga0501046_0477515 Ga0501046_0477515_51_362 91
66 3300049581 Ga0501047_0918142 Ga0501047_0918142_108_419 91
67 3300049586 Ga0501070_0210888 Ga0501070_0210888_104_448 91
68 3300049822 Ga0501035_0751871 Ga0501035_0751871_355_669 91
69 3300049823 Ga0501044_1274888 Ga0501044_1274888_171_482 91
70 3300013105 Ga0157369_10338715 Ga0157369_103387152 92
71 3300026121 Ga0207683_10924741 Ga0207683_109247412 92
72 3300048917 Ga0496114_0492751 Ga0496114_0492751_193_492 92
73 3300049822 Ga0501035_0584852 Ga0501035_0584852_560_871 92
74 3300049823 Ga0501044_0263755 Ga0501044_0263755_1155_1508 92
75 3300049823 Ga0501044_1610949 Ga0501044_1610949_82_393 92
76 iso_pu_bacteria 2643221577 2643894877 92
77 iso_pu_bacteria 2643221685 2644477036 92
78 3300005337 Ga0070682_100786727 Ga0070682_1007867271 93
79 3300005339 Ga0070660_101668803 Ga0070660_1016688031 93
80 3300005345 Ga0070692_10016799 Ga0070692_100167993 93
81 3300005435 Ga0070714_100000149 Ga0070714_10000014925 93
82 3300005457 Ga0070662_100118515 Ga0070662_1001185153 93
83 3300005530 Ga0070679_100027791 Ga0070679_1000277913 93
84 3300005539 Ga0068853_101190866 Ga0068853_1011908662 93
85 3300005546 Ga0070696_100023857 Ga0070696_1000238574 93
86 3300005547 Ga0070693_100113663 Ga0070693_1001136632 93
87 3300005563 Ga0068855_102147789 Ga0068855_1021477891 93
88 3300005564 Ga0070664_100160317 Ga0070664_1001603173 93
89 3300005577 Ga0068857_100410246 Ga0068857_1004102463 93
90 3300005614 Ga0068856_100006710 Ga0068856_1000067103 93
91 3300005614 Ga0068856_101490052 Ga0068856_1014900522 93
92 3300006175 Ga0070712_100618935 Ga0070712_1006189351 93
93 3300009174 Ga0105241_11392938 Ga0105241_113929381 93
94 3300009545 Ga0105237_10370742 Ga0105237_103707422 93
95 3300009551 Ga0105238_10709580 Ga0105238_107095801 93
96 3300010375 Ga0105239_10215717 Ga0105239_102157173 93
97 3300013100 Ga0157373_10253472 Ga0157373_102534722 93
98 3300013100 Ga0157373_10390848 Ga0157373_103908482 93
99 3300013100 Ga0157373_10810682 Ga0157373_108106821 93
100 3300013100 Ga0157373_10950617 Ga0157373_109506172 93
101 3300013100 Ga0157373_11140443 Ga0157373_111404431 93
102 3300013102 Ga0157371_11413632 Ga0157371_114136321 93
103 3300013105 Ga0157369_10814722 Ga0157369_108147222 93
104 3300013307 Ga0157372_10694608 Ga0157372_106946083 93
105 3300013307 Ga0157372_12052132 Ga0157372_120521322 93
106 3300014969 Ga0157376_13039865 Ga0157376_130398651 93
107 3300015261 Ga0182006_1222818 Ga0182006_12228181 93
108 3300015261 Ga0182006_1236851 Ga0182006_12368511 93
109 3300015261 Ga0182006_1268853 Ga0182006_12688531 93
110 3300015262 Ga0182007_10198766 Ga0182007_101987662 93
111 3300025904 Ga0207647_10051464 Ga0207647_100514642 93
112 3300025909 Ga0207705_10002488 Ga0207705_100024885 93
113 3300025911 Ga0207654_10153566 Ga0207654_101535661 93
114 3300025919 Ga0207657_10452392 Ga0207657_104523922 93
115 3300025919 Ga0207657_10814014 Ga0207657_108140142 93
116 3300025920 Ga0207649_10190783 Ga0207649_101907833 93
117 3300025924 Ga0207694_10091899 Ga0207694_100918992 93
118 3300025929 Ga0207664_10000093 Ga0207664_1000009343 93
119 3300025932 Ga0207690_10008812 Ga0207690_100088125 93
120 3300025932 Ga0207690_10011237 Ga0207690_100112372 93
121 3300025932 Ga0207690_10277957 Ga0207690_102779572 93
122 3300025933 Ga0207706_10023010 Ga0207706_100230105 93
123 3300025945 Ga0207679_11191009 Ga0207679_111910091 93
124 3300025949 Ga0207667_10222369 Ga0207667_102223692 93
125 3300025981 Ga0207640_10022187 Ga0207640_100221873 93
126 3300026041 Ga0207639_10973898 Ga0207639_109738981 93
127 3300026078 Ga0207702_10013058 Ga0207702_100130585 93
128 3300026116 Ga0207674_10056186 Ga0207674_100561864 93
129 3300026116 Ga0207674_11010078 Ga0207674_110100782 93
130 3300049568 Ga0501031_0203615 Ga0501031_0203615_496_780 93
131 3300049569 Ga0501032_0011458 Ga0501032_0011458_3701_3985 93
132 3300049570 Ga0501033_0264462 Ga0501033_0264462_29_313 93
133 3300049571 Ga0501034_0276766 Ga0501034_0276766_329_613 93
134 3300049573 Ga0501037_0041823 Ga0501037_0041823_2253_2537 93
135 3300049579 Ga0501043_0204498 Ga0501043_0204498_959_1243 93
136 3300049580 Ga0501046_0008482 Ga0501046_0008482_5147_5431 93
137 3300049581 Ga0501047_0260255 Ga0501047_0260255_501_785 93
138 3300049581 Ga0501047_0306226 Ga0501047_0306226_799_1098 93
139 3300049822 Ga0501035_0282385 Ga0501035_0282385_509_793 93
140 3300049823 Ga0501044_0128302 Ga0501044_0128302_1750_2034 93
141 3300003323 rootH1_10213741 rootH1_102137412 94
142 iso_pu_bacteria 2895395659 2895397712 94
143 iso_pu_bacteria 2939611941 2939612476 94
144 3300044536 Ga0466988_0170269 Ga0466988_0170269_533_823 95
145 3300061719 Ga0466962_0046425 Ga0466962_0046425_487_777 95
146 iso_pu_bacteria 2884411467 2884412087 95
147 iso_pu_bacteria 2928963466 2928967753 95
148 3300049822 Ga0501035_1120117 Ga0501035_1120117_143_436 96
149 3300003752 Ga0055539_1001681 Ga0055539_10016813 97
150 3300037312 Ga0395899_0000108 Ga0395899_0000108_36014_36310 97
151 3300037466 Ga0395898_0000018 Ga0395898_0000018_378300_378596 97
152 3300038443 Ga0395901_0321280 Ga0395901_0321280_1173_1469 97
153 3300002737 JGI25162J39368_1002652 JGI25162J39368_10026522 98
154 3300002737 JGI25162J39368_1002802 JGI25162J39368_10028022 98
155 3300002737 JGI25162J39368_1023663 JGI25162J39368_10236631 98
156 3300002741 JGI25157J39369_1001037 JGI25157J39369_10010376 98
157 3300002772 JGI25164J39214_1001246 JGI25164J39214_10012467 98
158 3300002772 JGI25164J39214_1001331 JGI25164J39214_10013312 98
159 3300003214 JGI25165J46597_1002406 JGI25165J46597_10024062 98
160 3300003214 JGI25165J46597_1003986 JGI25165J46597_10039864 98
161 3300003214 JGI25165J46597_1010492 JGI25165J46597_10104922 98
162 3300003316 rootH1_10092329 rootH1_100923292 98
163 3300005337 Ga0070682_100024050 Ga0070682_1000240504 98
164 3300005366 Ga0070659_100006031 Ga0070659_1000060317 98
165 3300005435 Ga0070714_100021926 Ga0070714_1000219261 98
166 3300005436 Ga0070713_100445465 Ga0070713_1004454652 98
167 3300005439 Ga0070711_101023937 Ga0070711_1010239371 98
168 3300005458 Ga0070681_10037468 Ga0070681_100374684 98
169 3300005530 Ga0070679_100638957 Ga0070679_1006389571 98
170 3300005530 Ga0070679_100644741 Ga0070679_1006447412 98
171 3300005563 Ga0068855_101001964 Ga0068855_1010019642 98
172 3300005578 Ga0068854_100233900 Ga0068854_1002339003 98
173 3300009551 Ga0105238_10140357 Ga0105238_101403572 98
174 3300013104 Ga0157370_10054161 Ga0157370_100541615 98
175 3300013104 Ga0157370_10070270 Ga0157370_100702704 98
176 3300013307 Ga0157372_10013585 Ga0157372_100135853 98
177 3300014497 Ga0182008_10176001 Ga0182008_101760012 98
178 3300014497 Ga0182008_10185401 Ga0182008_101854012 98
179 3300015261 Ga0182006_1085461 Ga0182006_10854612 98
180 3300015262 Ga0182007_10031158 Ga0182007_100311582 98
181 3300015262 Ga0182007_10058840 Ga0182007_100588402 98
182 3300015262 Ga0182007_10068760 Ga0182007_100687601 98
183 3300015262 Ga0182007_10410746 Ga0182007_104107461 98
184 3300025226 Ga0209674_108175 Ga0209674_1081752 98
185 3300025231 Ga0207427_100244 Ga0207427_1002442 98
186 3300025231 Ga0207427_100248 Ga0207427_1002482 98
187 3300025233 Ga0209437_100020 Ga0209437_100020361 98
188 3300025233 Ga0209437_100079 Ga0209437_10007942 98
189 3300025242 Ga0209258_121897 Ga0209258_1218972 98
190 3300025250 Ga0209026_1000037 Ga0209026_100003782 98
191 3300025256 Ga0209759_1014075 Ga0209759_10140753 98
192 3300025261 Ga0209233_1000020 Ga0209233_1000020264 98
193 3300025261 Ga0209233_1000147 Ga0209233_10001472 98
194 3300025297 Ga0209758_1094136 Ga0209758_10941362 98
195 3300025912 Ga0207707_10025218 Ga0207707_100252184 98
196 3300025912 Ga0207707_10111681 Ga0207707_101116812 98
197 3300025916 Ga0207663_11198011 Ga0207663_111980111 98
198 3300025924 Ga0207694_10298633 Ga0207694_102986332 98
199 3300025928 Ga0207700_10049378 Ga0207700_100493783 98
200 3300025929 Ga0207664_10001554 Ga0207664_1000155414 98
201 3300025929 Ga0207664_10026051 Ga0207664_100260512 98
202 3300025932 Ga0207690_10023661 Ga0207690_100236614 98
203 3300025949 Ga0207667_10755298 Ga0207667_107552981 98
204 3300025981 Ga0207640_10198663 Ga0207640_101986632 98
205 3300026041 Ga0207639_10543854 Ga0207639_105438542 98
206 3300031238 Ga0265332_10134816 Ga0265332_101348161 98
207 3300033179 Ga0307507_10704355 Ga0307507_107043552 98
208 3300037418 Ga0395900_1379810 Ga0395900_1379810_256_558 98
209 3300038443 Ga0395901_0327130 Ga0395901_0327130_262_564 98
210 3300046660 Ga0495625_0776070 Ga0495625_0776070_46_345 98
211 3300049569 Ga0501032_0288956 Ga0501032_0288956_115_459 98
212 3300049570 Ga0501033_0003177 Ga0501033_0003177_5063_5362 98
213 3300049570 Ga0501033_0027424 Ga0501033_0027424_104_445 98
214 3300049571 Ga0501034_0624578 Ga0501034_0624578_606_947 98
215 3300049572 Ga0501036_0947880 Ga0501036_0947880_137_478 98
216 3300049578 Ga0501042_0201251 Ga0501042_0201251_1048_1389 98
217 3300049579 Ga0501043_0101562 Ga0501043_0101562_753_1094 98
218 3300049581 Ga0501047_0365964 Ga0501047_0365964_328_672 98
219 3300049581 Ga0501047_0505154 Ga0501047_0505154_112_453 98
220 3300049582 Ga0501048_0033093 Ga0501048_0033093_3175_3516 98
221 3300049742 Ga0501080_0368887 Ga0501080_0368887_323_664 98
222 3300049822 Ga0501035_0048478 Ga0501035_0048478_2197_2541 98
223 3300049823 Ga0501044_0080586 Ga0501044_0080586_1787_2131 98
224 3300049823 Ga0501044_0389542 Ga0501044_0389542_854_1195 98
225 3300001989 JGI24739J22299_10171110 JGI24739J22299_101711102 99
226 3300001990 JGI24737J22298_10080966 JGI24737J22298_100809662 99
227 3300002067 JGI24735J21928_10017179 JGI24735J21928_100171793 99
228 3300002737 JGI25162J39368_1000859 JGI25162J39368_10008595 99
229 3300002738 JGI25154J39366_1003304 JGI25154J39366_10033044 99
230 3300002741 JGI25157J39369_1001307 JGI25157J39369_100130712 99
231 3300002772 JGI25164J39214_1000045 JGI25164J39214_100004545 99
232 3300003214 JGI25165J46597_1000072 JGI25165J46597_100007245 99
233 3300003756 Ga0055533_1003517 Ga0055533_10035172 99
234 3300003759 Ga0055525_1000027 Ga0055525_1000027221 99
235 3300003760 Ga0055527_1000199 Ga0055527_10001993 99
236 3300003760 Ga0055527_1000212 Ga0055527_10002123 99
237 3300003760 Ga0055527_1003581 Ga0055527_10035813 99
238 3300003761 Ga0055535_1000585 Ga0055535_100058528 99
239 3300003761 Ga0055535_1001486 Ga0055535_10014865 99
240 3300003761 Ga0055535_1001521 Ga0055535_10015216 99
241 3300003761 Ga0055535_1001790 Ga0055535_10017906 99
242 3300003762 Ga0055542_1000242 Ga0055542_100024232 99
243 3300003762 Ga0055542_1000497 Ga0055542_100049731 99
244 3300003762 Ga0055542_1001722 Ga0055542_10017226 99
245 3300003762 Ga0055542_1001732 Ga0055542_10017326 99
246 3300003763 Ga0055529_1000204 Ga0055529_100020448 99
247 3300003763 Ga0055529_1000846 Ga0055529_10008463 99
248 3300003763 Ga0055529_1001254 Ga0055529_10012546 99
249 3300005435 Ga0070714_101660957 Ga0070714_1016609571 99
250 3300005614 Ga0068856_100047778 Ga0068856_1000477781 99
251 3300015687 Ga0183368_1002 Ga0183368_1002273 99
252 3300025226 Ga0209674_100043 Ga0209674_100043240 99
253 3300025226 Ga0209674_100086 Ga0209674_100086114 99
254 3300025226 Ga0209674_101483 Ga0209674_1014835 99
255 3300025228 Ga0209672_100005 Ga0209672_100005722 99
256 3300025228 Ga0209672_100029 Ga0209672_100029226 99
257 3300025228 Ga0209672_100142 Ga0209672_1001422 99
258 3300025230 Ga0209563_100023 Ga0209563_100023381 99
259 3300025231 Ga0207427_100055 Ga0207427_100055166 99
260 3300025233 Ga0209437_100161 Ga0209437_10016164 99
261 3300025242 Ga0209258_100006 Ga0209258_100006722 99
262 3300025242 Ga0209258_100053 Ga0209258_100053104 99
263 3300025242 Ga0209258_100064 Ga0209258_100064251 99
264 3300025242 Ga0209258_100186 Ga0209258_10018680 99
265 3300025242 Ga0209258_100481 Ga0209258_1004815 99
266 3300025246 Ga0209646_1002370 Ga0209646_10023702 99
267 3300025250 Ga0209026_1000493 Ga0209026_10004931 99
268 3300025250 Ga0209026_1001161 Ga0209026_10011612 99
269 3300025253 Ga0209677_100603 Ga0209677_1006038 99
270 3300025254 Ga0209148_1000009 Ga0209148_1000009226 99
271 3300025254 Ga0209148_1000012 Ga0209148_1000012722 99
272 3300025254 Ga0209148_1000073 Ga0209148_100007361 99
273 3300025254 Ga0209148_1000142 Ga0209148_100014236 99
274 3300025256 Ga0209759_1000103 Ga0209759_100010365 99
275 3300025256 Ga0209759_1000725 Ga0209759_10007251 99
276 3300025261 Ga0209233_1000063 Ga0209233_1000063316 99
277 3300025272 Ga0209455_1000008 Ga0209455_1000008722 99
278 3300025272 Ga0209455_1000060 Ga0209455_1000060226 99
279 3300025272 Ga0209455_1000177 Ga0209455_100017781 99
280 3300025929 Ga0207664_11197950 Ga0207664_111979502 99
281 3300026078 Ga0207702_10030863 Ga0207702_100308635 99
282 3300037312 Ga0395899_0003614 Ga0395899_0003614_442_753 99
283 3300037312 Ga0395899_0013691 Ga0395899_0013691_637_939 99
284 3300037312 Ga0395899_0071469 Ga0395899_0071469_1105_1416 99
285 3300037312 Ga0395899_0594657 Ga0395899_0594657_337_675 99
286 3300037312 Ga0395899_0849176 Ga0395899_0849176_31_369 99
287 3300037418 Ga0395900_0000755 Ga0395900_0000755_3836_4138 99
288 3300037418 Ga0395900_0005765 Ga0395900_0005765_1973_2284 99
289 3300037418 Ga0395900_0006415 Ga0395900_0006415_1585_1923 99
290 3300037418 Ga0395900_0496969 Ga0395900_0496969_62_373 99
291 3300037466 Ga0395898_0000049 Ga0395898_0000049_236289_236591 99
292 3300037466 Ga0395898_0001843 Ga0395898_0001843_16229_16567 99
293 3300037466 Ga0395898_0006742 Ga0395898_0006742_10685_10996 99
294 3300037466 Ga0395898_0073871 Ga0395898_0073871_1759_2070 99
295 3300037471 Ga0395905_0848914 Ga0395905_0848914_288_599 99
296 3300037471 Ga0395905_1129596 Ga0395905_1129596_49_387 99
297 3300038443 Ga0395901_0021152 Ga0395901_0021152_5298_5600 99
298 3300038443 Ga0395901_0022286 Ga0395901_0022286_4568_4906 99
299 3300038443 Ga0395901_0057321 Ga0395901_0057321_62_373 99
300 3300038443 Ga0395901_0057886 Ga0395901_0057886_1822_2133 99
301 3300038443 Ga0395901_0130299 Ga0395901_0130299_1022_1324 99
302 3300044656 Ga0466969_0017091 Ga0466969_0017091_2084_2386 99
303 3300044656 Ga0466969_0031034 Ga0466969_0031034_1413_1715 99
304 3300044656 Ga0466969_0097065 Ga0466969_0097065_1007_1309 99
305 3300044661 Ga0466975_0681567 Ga0466975_0681567_53_355 99
306 3300044684 Ga0466966_0003688 Ga0466966_0003688_2732_3034 99
307 3300044684 Ga0466966_0045356 Ga0466966_0045356_402_704 99
308 3300044684 Ga0466966_0168289 Ga0466966_0168289_110_412 99
309 3300044693 Ga0466961_0002304 Ga0466961_0002304_5194_5496 99
310 3300044693 Ga0466961_0007229 Ga0466961_0007229_6277_6579 99
311 3300044693 Ga0466961_0011723 Ga0466961_0011723_5126_5428 99
312 3300044693 Ga0466961_0054455 Ga0466961_0054455_2107_2409 99
313 3300044694 Ga0466963_0988202 Ga0466963_0988202_202_504 99
314 3300044706 Ga0466964_0245250 Ga0466964_0245250_36_338 99
315 3300044719 Ga0466971_0703258 Ga0466971_0703258_50_352 99
316 3300044735 Ga0466968_0360184 Ga0466968_0360184_168_470 99
317 3300044765 Ga0466970_0041449 Ga0466970_0041449_2077_2379 99
318 3300044842 Ga0466957_0022645 Ga0466957_0022645_22_324 99
319 3300044842 Ga0466957_0610956 Ga0466957_0610956_170_472 99
320 3300045049 Ga0466959_0000347 Ga0466959_0000347_2107_2409 99
321 3300045049 Ga0466959_0258315 Ga0466959_0258315_522_824 99
322 3300045836 Ga0466958_0015903 Ga0466958_0015903_2272_2574 99
323 3300045836 Ga0466958_0692645 Ga0466958_0692645_163_465 99
324 3300045976 Ga0466967_1470837 Ga0466967_1470837_93_392 99
325 3300048916 Ga0496113_0101589 Ga0496113_0101589_24_323 99
326 3300048918 Ga0496115_0000115 Ga0496115_0000115_45830_46129 99
327 3300049569 Ga0501032_0049799 Ga0501032_0049799_850_1194 99
328 3300049572 Ga0501036_1269129 Ga0501036_1269129_62_409 99
329 3300049573 Ga0501037_0250212 Ga0501037_0250212_536_880 99
330 3300049575 Ga0501039_0246990 Ga0501039_0246990_494_838 99
331 3300049581 Ga0501047_1313486 Ga0501047_1313486_145_489 99
332 3300049823 Ga0501044_1423852 Ga0501044_1423852_53_400 99
333 3300049824 Ga0501045_0373734 Ga0501045_0373734_361_705 99
334 3300061719 Ga0466962_0093879 Ga0466962_0093879_85_387 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20228

DUF6587

Family of unknown function (DUF6587)

1

82

0.99

Feature Viewer

pLDDT pTM Quality
64.5 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map