F411952

General Info

Members Datasets Scaffolds Average Seq Length
334 145 668 201

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0036951|Ga0496102_0036951_1946_2632
Length 228
Sequence VGRRRHDRLQLLTKRGESDAKFTNRRHVMAVDIEIDVDLLKSEIKKTYAAVSEEPEREFIFPTGRAWAEDLGYPPELANVPDTAVESFAGVANPGRLGRLEPGERVLDLGSGAGTDSLVAAQMVGESGRVTGIDMTPEMLSKSRAAAAEMGVRNVEFLEAEAERLSFPDATFDVVISNGVIDLIPDKDAVFAELFRVLRPGGRLQIADVTIQNPVSEEGRRNIDLWTG

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 2.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.89
Rhizosphere 93.11
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0036951 3300048905 Bacteria 4403
2 Ga0058863_11969170 3300004799 Bacteria 1088
3 Ga0058862_12785444 3300004803 Bacteria 1404
4 Ga0070683_100360908 3300005329 Bacteria 1384
5 Ga0070683_100624097 3300005329 Bacteria 1032
6 Ga0070680_100039696 3300005336 Bacteria 3808
7 Ga0070682_100094064 3300005337 Bacteria 1966
8 Ga0070682_100287736 3300005337 Bacteria 1201
9 Ga0070660_100644580 3300005339 Bacteria 887
10 Ga0070659_100067489 3300005366 Bacteria 2837
11 Ga0070709_10414220 3300005434 Bacteria 1008
12 Ga0070714_100003759 3300005435 Bacteria 11387
13 Ga0070714_100015438 3300005435 Bacteria 6146
14 Ga0070714_100086176 3300005435 Bacteria 2745
15 Ga0070714_100347986 3300005435 Unclassified 1391
16 Ga0070714_100816332 3300005435 Bacteria 904
17 Ga0070713_100530807 3300005436 Bacteria 1113
18 Ga0070711_100191066 3300005439 Bacteria 1574
19 Ga0070708_100075086 3300005445 Bacteria 3050
20 Ga0070708_100286008 3300005445 Unclassified 1552
21 Ga0070708_100349922 3300005445 Bacteria 1392
22 Ga0070681_10163367 3300005458 Bacteria 2150
23 Ga0070681_10170615 3300005458 Bacteria 2097
24 Ga0070681_10175385 3300005458 Bacteria 2065
25 Ga0070681_10509507 3300005458 Bacteria 1117
26 Ga0070706_100022833 3300005467 Bacteria 5761
27 Ga0070706_100169730 3300005467 Unclassified 2037
28 Ga0070707_100001787 3300005468 Bacteria 20707
29 Ga0070707_100017174 3300005468 Bacteria 6800
30 Ga0070707_100117955 3300005468 Bacteria 2576
31 Ga0070707_100515422 3300005468 Bacteria 1158
32 Ga0070707_100755522 3300005468 Bacteria 936
33 Ga0070698_100022572 3300005471 Bacteria 6582
34 Ga0070698_100088905 3300005471 Bacteria 3073
35 Ga0070698_100091214 3300005471 Bacteria 3030
36 Ga0070698_100517508 3300005471 Bacteria 1131
37 Ga0070699_100067800 3300005518 Bacteria 3099
38 Ga0070679_100162369 3300005530 Bacteria 2208
39 Ga0070684_100326054 3300005535 Unclassified 1411
40 Ga0070684_100884367 3300005535 Bacteria 837
41 Ga0070697_100073637 3300005536 Bacteria 2805
42 Ga0070697_100185533 3300005536 Bacteria 1764
43 Ga0070697_100301026 3300005536 Unclassified 1378
44 Ga0070696_100843594 3300005546 Bacteria 757
45 Ga0070693_100131152 3300005547 Bacteria 1567
46 Ga0068855_100227750 3300005563 Bacteria 2088
47 Ga0068855_100866954 3300005563 Unclassified 956
48 Ga0068856_100221169 3300005614 Bacteria 1909
49 Ga0068852_100044491 3300005616 Bacteria 3771
50 Ga0081539_10008698 3300005985 Bacteria 8731
51 Ga0070717_10032683 3300006028 Bacteria 4194
52 Ga0070717_10119655 3300006028 Bacteria 2255
53 Ga0070717_10300073 3300006028 Bacteria 1428
54 Ga0070715_10510496 3300006163 Bacteria 690
55 Ga0070716_100049958 3300006173 Unclassified 2371
56 Ga0070712_100180703 3300006175 Unclassified 1644
57 Ga0070712_100331642 3300006175 Bacteria 1240
58 Ga0075428_100016643 3300006844 Bacteria 8121
59 Ga0075428_100160210 3300006844 Bacteria 2443
60 Ga0075430_100004070 3300006846 Bacteria 12337
61 Ga0075430_100242667 3300006846 Bacteria 1493
62 Ga0075431_100008781 3300006847 Bacteria 10126
63 Ga0075433_10332275 3300006852 Bacteria 1344
64 Ga0075434_100803587 3300006871 Bacteria 957
65 Ga0075429_100007611 3300006880 Bacteria 9405
66 Ga0075436_100195170 3300006914 Bacteria 1433
67 Ga0111539_10023399 3300009094 Bacteria 7590
68 Ga0105245_10353975 3300009098 Bacteria 1456
69 Ga0114129_10029880 3300009147 Bacteria 7717
70 Ga0114129_10518591 3300009147 Archaea 1554
71 Ga0105241_10387098 3300009174 Bacteria 1223
72 Ga0105237_10535938 3300009545 Bacteria 1177
73 Ga0105239_10203384 3300010375 Bacteria 2219
74 Ga0157373_10020389 3300013100 Bacteria 4818
75 Ga0157370_10056683 3300013104 Bacteria 3729
76 Ga0157370_10068163 3300013104 Bacteria 3363
77 Ga0157370_10457333 3300013104 Bacteria 1173
78 Ga0157369_10228804 3300013105 Unclassified 1944
79 Ga0157369_10328169 3300013105 Bacteria 1590
80 Ga0157372_10175113 3300013307 Bacteria 2483
81 Ga0157372_10216606 3300013307 Bacteria 2219
82 Ga0157372_10668628 3300013307 Bacteria 1209
83 Ga0157372_10720226 3300013307 Bacteria 1161
84 Ga0157375_10322835 3300013308 Bacteria 1708
85 Ga0197907_10056557 3300020069 Bacteria 1573
86 Ga0206356_10739420 3300020070 Bacteria 1035
87 Ga0206354_11290060 3300020081 Bacteria 749
88 Ga0206353_11892053 3300020082 Bacteria 988
89 Ga0206353_11893241 3300020082 Bacteria 751
90 Ga0207685_10258074 3300025905 Unclassified 846
91 Ga0207699_10195156 3300025906 Bacteria 1368
92 Ga0207684_10429962 3300025910 Bacteria 1134
93 Ga0207707_10191471 3300025912 Bacteria 1784
94 Ga0207707_10193481 3300025912 Bacteria 1774
95 Ga0207707_10201267 3300025912 Bacteria 1736
96 Ga0207695_10739982 3300025913 Bacteria 864
97 Ga0207693_10323105 3300025915 Unclassified 1208
98 Ga0207663_10198208 3300025916 Bacteria 1446
99 Ga0207663_10902422 3300025916 Unclassified 707
100 Ga0207660_10436611 3300025917 Bacteria 1058
101 Ga0207657_10095206 3300025919 Bacteria 2478
102 Ga0207657_10310227 3300025919 Bacteria 1249
103 Ga0207652_10028796 3300025921 Bacteria 4637
104 Ga0207652_10524817 3300025921 Bacteria 1065
105 Ga0207652_10527846 3300025921 Bacteria 1062
106 Ga0207646_10013674 3300025922 Bacteria 7751
107 Ga0207646_10067034 3300025922 Bacteria 3204
108 Ga0207646_10098997 3300025922 Bacteria 2613
109 Ga0207646_10440957 3300025922 Bacteria 1175
110 Ga0207659_10701382 3300025926 Bacteria 867
111 Ga0207687_10230134 3300025927 Bacteria 1464
112 Ga0207700_10018268 3300025928 Bacteria 4707
113 Ga0207700_10447536 3300025928 Bacteria 1138
114 Ga0207664_10009761 3300025929 Bacteria 6752
115 Ga0207664_10092127 3300025929 Bacteria 2487
116 Ga0207664_10160409 3300025929 Unclassified 1918
117 Ga0207664_10236175 3300025929 Bacteria 1590
118 Ga0207690_10279125 3300025932 Bacteria 1300
119 Ga0207709_10871042 3300025935 Bacteria 731
120 Ga0207661_10151137 3300025944 Bacteria 2007
121 Ga0207661_10340323 3300025944 Bacteria 1352
122 Ga0207661_10473626 3300025944 Bacteria 1143
123 Ga0207667_10182111 3300025949 Bacteria 2157
124 Ga0207667_10585304 3300025949 Bacteria 1126
125 Ga0207640_10787051 3300025981 Bacteria 823
126 Ga0207639_10846750 3300026041 Bacteria 853
127 Ga0207702_10674272 3300026078 Bacteria 1018
128 Ga0207675_100659017 3300026118 Bacteria 1053
129 Ga0207698_10079161 3300026142 Bacteria 2642
130 Ga0207428_10003249 3300027907 Bacteria 15838
131 Ga0316583_10204480 3300032133 Bacteria 685
132 Ga0373960_0074258 3300035121 Unclassified 1058
133 Ga0373931_0280932 3300035691 Bacteria 1022
134 Ga0395899_0009999 3300037312 Bacteria 7275
135 Ga0395899_0033694 3300037312 Bacteria 3846
136 Ga0395899_0208734 3300037312 Bacteria 1358
137 Ga0395900_0011165 3300037418 Bacteria 9184
138 Ga0395900_0021035 3300037418 Bacteria 6667
139 Ga0395900_0027753 3300037418 Bacteria 5800
140 Ga0395900_0033665 3300037418 Bacteria 5273
141 Ga0395900_0079113 3300037418 Bacteria 3378
142 Ga0395900_0090008 3300037418 Bacteria 3154
143 Ga0395900_0126341 3300037418 Bacteria 2623
144 Ga0395900_0177154 3300037418 Bacteria 2168
145 Ga0395900_0448972 3300037418 Bacteria 1246
146 Ga0395900_0525783 3300037418 Bacteria 1130
147 Ga0395900_0712278 3300037418 Bacteria 937
148 Ga0395898_0005567 3300037466 Bacteria 13581
149 Ga0395898_0025004 3300037466 Bacteria 6020
150 Ga0395898_0025159 3300037466 Bacteria 6002
151 Ga0395898_0066855 3300037466 Bacteria 3481
152 Ga0395898_0119250 3300037466 Bacteria 2527
153 Ga0395898_0291427 3300037466 Bacteria 1557
154 Ga0395898_0766284 3300037466 Bacteria 906
155 Ga0395905_0005691 3300037471 Bacteria 12666
156 Ga0395905_0010239 3300037471 Bacteria 9137
157 Ga0395905_0019552 3300037471 Bacteria 6419
158 Ga0395905_0070133 3300037471 Bacteria 3284
159 Ga0395905_0092609 3300037471 Bacteria 2834
160 Ga0395905_0165952 3300037471 Bacteria 2075
161 Ga0395905_0204536 3300037471 Bacteria 1851
162 Ga0395905_0284517 3300037471 Bacteria 1540
163 Ga0395901_0002002 3300038443 Bacteria 20963
164 Ga0395901_0004911 3300038443 Bacteria 13495
165 Ga0395901_0019188 3300038443 Bacteria 6991
166 Ga0395901_0021695 3300038443 Bacteria 6580
167 Ga0395901_0032800 3300038443 Bacteria 5358
168 Ga0395901_0049320 3300038443 Bacteria 4374
169 Ga0395901_0102762 3300038443 Bacteria 2999
170 Ga0395901_0147624 3300038443 Bacteria 2471
171 Ga0395901_0264314 3300038443 Bacteria 1790
172 Ga0395901_0507883 3300038443 Bacteria 1226
173 Ga0395901_0536592 3300038443 Bacteria 1187
174 Ga0466963_0000216 3300044694 Bacteria 24575
175 Ga0466963_0005211 3300044694 Bacteria 7591
176 Ga0466968_0005278 3300044735 Bacteria 4841
177 Ga0466968_0006691 3300044735 Bacteria 4355
178 Ga0466970_0194764 3300044765 Bacteria 1127
179 Ga0466958_0003623 3300045836 Bacteria 8053
180 Ga0466958_0008814 3300045836 Archaea 5603
181 Ga0466967_0001297 3300045976 Bacteria 14253
182 Ga0466967_0020815 3300045976 Bacteria 5312
183 Ga0466967_0060617 3300045976 Bacteria 3354
184 Ga0466967_0217773 3300045976 Unclassified 1813
185 Ga0466967_0893504 3300045976 Bacteria 883
186 Ga0495653_0446981 3300046463 Unclassified 814
187 Ga0495680_0320936 3300047322 Unclassified 1084
188 Ga0496102_0332519 3300048905 Bacteria 1431
189 Ga0496102_0843300 3300048905 Unclassified 839
190 Ga0496103_0004399 3300048906 Bacteria 8548
191 Ga0496104_0128916 3300048907 Unclassified 2429
192 Ga0496104_0142652 3300048907 Bacteria 2301
193 Ga0496104_0397760 3300048907 Bacteria 1290
194 Ga0496105_0260273 3300048908 Bacteria 1403
195 Ga0496105_0416331 3300048908 Archaea 1064
196 Ga0496105_0709102 3300048908 Bacteria 772
197 Ga0496108_0158169 3300048911 Unclassified 1957
198 Ga0496108_0281067 3300048911 Bacteria 1449
199 Ga0496109_0012380 3300048912 Bacteria 7365
200 Ga0496109_0065057 3300048912 Unclassified 3338
201 Ga0496109_0460992 3300048912 Bacteria 1200
202 Ga0496109_0772579 3300048912 Bacteria 899
203 Ga0496110_0158428 3300048913 Bacteria 2052
204 Ga0496110_0637658 3300048913 Bacteria 965
205 Ga0496110_0640099 3300048913 Bacteria 963
206 Ga0496112_0046247 3300048915 Unclassified 4268
207 Ga0496112_0178070 3300048915 Unclassified 2090
208 Ga0496112_0329817 3300048915 Bacteria 1470
209 Ga0496113_0123708 3300048916 Unclassified 2024
210 Ga0501031_0013052 3300049568 Bacteria 5419
211 Ga0501031_0017210 3300049568 Bacteria 4696
212 Ga0501031_0102286 3300049568 Bacteria 1869
213 Ga0501031_0122283 3300049568 Bacteria 1700
214 Ga0501032_0011026 3300049569 Bacteria 6497
215 Ga0501032_0014218 3300049569 Bacteria 5638
216 Ga0501033_0029877 3300049570 Bacteria 4096
217 Ga0501034_0125061 3300049571 Bacteria 2557
218 Ga0501034_0272079 3300049571 Unclassified 1635
219 Ga0501036_0001454 3300049572 Bacteria 18218
220 Ga0501036_0007366 3300049572 Bacteria 8966
221 Ga0501036_0060501 3300049572 Bacteria 3208
222 Ga0501036_0079292 3300049572 Bacteria 2777
223 Ga0501036_0255500 3300049572 Bacteria 1468
224 Ga0501036_0276786 3300049572 Bacteria 1405
225 Ga0501037_0008106 3300049573 Bacteria 7697
226 Ga0501037_0016388 3300049573 Bacteria 5454
227 Ga0501038_0008438 3300049574 Bacteria 9475
228 Ga0501038_0080342 3300049574 Bacteria 2748
229 Ga0501038_0308017 3300049574 Bacteria 1241
230 Ga0501038_0340243 3300049574 Bacteria 1170
231 Ga0501039_0001535 3300049575 Bacteria 16962
232 Ga0501039_0012764 3300049575 Bacteria 6420
233 Ga0501039_0033173 3300049575 Bacteria 3982
234 Ga0501039_0107116 3300049575 Bacteria 2183
235 Ga0501039_0682812 3300049575 Unclassified 803
236 Ga0501040_0017202 3300049576 Bacteria 4799
237 Ga0501040_0022542 3300049576 Bacteria 4215
238 Ga0501040_0032044 3300049576 Bacteria 3555
239 Ga0501040_0064502 3300049576 Bacteria 2521
240 Ga0501041_0045453 3300049577 Bacteria 2669
241 Ga0501042_0017952 3300049578 Bacteria 4892
242 Ga0501042_0022039 3300049578 Bacteria 4446
243 Ga0501042_0107770 3300049578 Bacteria 2005
244 Ga0501042_0156041 3300049578 Bacteria 1646
245 Ga0501042_0189174 3300049578 Bacteria 1485
246 Ga0501042_0277770 3300049578 Bacteria 1209
247 Ga0501042_0426229 3300049578 Bacteria 961
248 Ga0501043_0044057 3300049579 Bacteria 3507
249 Ga0501043_0217487 3300049579 Bacteria 1479
250 Ga0501046_0018143 3300049580 Bacteria 5859
251 Ga0501046_0032494 3300049580 Bacteria 4225
252 Ga0501046_0425001 3300049580 Bacteria 957
253 Ga0501047_0020032 3300049581 Bacteria 6423
254 Ga0501048_0018979 3300049582 Bacteria 5052
255 Ga0501048_0111863 3300049582 Bacteria 1928
256 Ga0501048_0297472 3300049582 Bacteria 1148
257 Ga0501067_0000359 3300049583 Bacteria 24901
258 Ga0501067_0015830 3300049583 Bacteria 4171
259 Ga0501068_0003294 3300049584 Bacteria 8654
260 Ga0501069_0003080 3300049585 Bacteria 8539
261 Ga0501069_0017912 3300049585 Bacteria 3819
262 Ga0501070_0170512 3300049586 Bacteria 1793
263 Ga0501071_0003485 3300049587 Bacteria 9826
264 Ga0501071_0008416 3300049587 Bacteria 6819
265 Ga0501072_0022976 3300049588 Bacteria 4841
266 Ga0501072_0056917 3300049588 Bacteria 3080
267 Ga0501073_0018276 3300049589 Bacteria 5065
268 Ga0501073_0232566 3300049589 Bacteria 1273
269 Ga0501074_0029352 3300049590 Bacteria 3983
270 Ga0501074_0047331 3300049590 Bacteria 3109
271 Ga0501074_0100027 3300049590 Bacteria 2075
272 Ga0501074_0311304 3300049590 Bacteria 1118
273 Ga0501075_0003211 3300049591 Bacteria 10933
274 Ga0501075_0022265 3300049591 Bacteria 4627
275 Ga0501075_0069396 3300049591 Bacteria 2663
276 Ga0501075_0782629 3300049591 Bacteria 726
277 Ga0501076_0025427 3300049592 Bacteria 4581
278 Ga0501076_0050117 3300049592 Bacteria 3303
279 Ga0501076_0144061 3300049592 Bacteria 1937
280 Ga0501076_0174502 3300049592 Bacteria 1752
281 Ga0501076_0210774 3300049592 Bacteria 1587
282 Ga0501076_0809146 3300049592 Bacteria 773
283 Ga0501077_0042106 3300049593 Bacteria 2905
284 Ga0501077_0052664 3300049593 Bacteria 2584
285 Ga0501077_0056535 3300049593 Bacteria 2490
286 Ga0501079_0006472 3300049741 Bacteria 8800
287 Ga0501079_0009346 3300049741 Bacteria 7429
288 Ga0501079_0016327 3300049741 Bacteria 5673
289 Ga0501079_0024956 3300049741 Bacteria 4586
290 Ga0501079_0049362 3300049741 Bacteria 3247
291 Ga0501079_0136045 3300049741 Bacteria 1913
292 Ga0501079_0195571 3300049741 Bacteria 1579
293 Ga0501080_0001469 3300049742 Bacteria 19844
294 Ga0501080_0070275 3300049742 Bacteria 3256
295 Ga0501080_0295348 3300049742 Bacteria 1470
296 Ga0501080_0725836 3300049742 Bacteria 875
297 Ga0501081_0023567 3300049743 Bacteria 4126
298 Ga0501081_0024270 3300049743 Bacteria 4070
299 Ga0501081_0049079 3300049743 Bacteria 2905
300 Ga0501081_0086053 3300049743 Bacteria 2206
301 Ga0501083_0049496 3300049744 Bacteria 2832
302 Ga0501083_0051217 3300049744 Bacteria 2776
303 Ga0501035_0006913 3300049822 Bacteria 10597
304 Ga0501035_0040902 3300049822 Bacteria 4186
305 Ga0501035_0055735 3300049822 Bacteria 3528
306 Ga0501035_0492433 3300049822 Bacteria 1010
307 Ga0501035_0625905 3300049822 Bacteria 875
308 Ga0501044_0026809 3300049823 Bacteria 6098
309 Ga0501044_0369777 3300049823 Bacteria 1350
310 Ga0501045_0003105 3300049824 Bacteria 11358
311 Ga0501045_0027362 3300049824 Bacteria 4108
312 Ga0501045_0027885 3300049824 Bacteria 4072
313 nmdc:mga05p37_154548_c1 3300050507 Bacteria 2805
314 nmdc:mga05p37_28004_c1 3300050507 Bacteria 6865
315 nmdc:mga05p37_461184_c1 3300050507 Archaea 1468
316 nmdc:mga09592_20192_c1 3300050508 Bacteria 5475
317 nmdc:mga0qj67_379244_c1 3300050509 Bacteria 1142
318 nmdc:mga0qj67_5424_c1 3300050509 Bacteria 9312
319 nmdc:mga06r32_8634_c1 3300050510 Bacteria 9181
320 nmdc:mga08y16_18652_c1 3300050511 Bacteria 7308
321 nmdc:mga08x19_253230_c1 3300050514 Bacteria 1216
322 nmdc:mga0a205_399681_c1 3300050515 Bacteria 1238
323 Ga0501084_0027372 3300054114 Bacteria 4763
324 Ga0501084_0030645 3300054114 Bacteria 4497
325 Ga0501084_0031514 3300054114 Bacteria 4432
326 Ga0501084_0038465 3300054114 Bacteria 3999
327 Ga0501084_0081558 3300054114 Bacteria 2713
328 Ga0501084_0141999 3300054114 Bacteria 2022
329 Ga0590075_004729 3300059424 Bacteria 3221
330 Ga0501082_0003768 3300060353 Bacteria 13245
331 Ga0501082_0013478 3300060353 Bacteria 7023
332 Ga0501082_0200687 3300060353 Bacteria 1735
333 Ga0530510_0001020 3300061734 Bacteria 18561
334 Ga0530510_0003732 3300061734 Bacteria 10483
335 Ga0496102_0036951
336 Ga0058863_11969170
337 Ga0058862_12785444
338 Ga0070683_100360908
339 Ga0070683_100624097
340 Ga0070680_100039696
341 Ga0070682_100094064
342 Ga0070682_100287736
343 Ga0070660_100644580
344 Ga0070659_100067489
345 Ga0070709_10414220
346 Ga0070714_100003759
347 Ga0070714_100015438
348 Ga0070714_100086176
349 Ga0070714_100347986
350 Ga0070714_100816332
351 Ga0070713_100530807
352 Ga0070711_100191066
353 Ga0070708_100075086
354 Ga0070708_100286008
355 Ga0070708_100349922
356 Ga0070681_10163367
357 Ga0070681_10170615
358 Ga0070681_10175385
359 Ga0070681_10509507
360 Ga0070706_100022833
361 Ga0070706_100169730
362 Ga0070707_100001787
363 Ga0070707_100017174
364 Ga0070707_100117955
365 Ga0070707_100515422
366 Ga0070707_100755522
367 Ga0070698_100022572
368 Ga0070698_100088905
369 Ga0070698_100091214
370 Ga0070698_100517508
371 Ga0070699_100067800
372 Ga0070679_100162369
373 Ga0070684_100326054
374 Ga0070684_100884367
375 Ga0070697_100073637
376 Ga0070697_100185533
377 Ga0070697_100301026
378 Ga0070696_100843594
379 Ga0070693_100131152
380 Ga0068855_100227750
381 Ga0068855_100866954
382 Ga0068856_100221169
383 Ga0068852_100044491
384 Ga0081539_10008698
385 Ga0070717_10032683
386 Ga0070717_10119655
387 Ga0070717_10300073
388 Ga0070715_10510496
389 Ga0070716_100049958
390 Ga0070712_100180703
391 Ga0070712_100331642
392 Ga0075428_100016643
393 Ga0075428_100160210
394 Ga0075430_100004070
395 Ga0075430_100242667
396 Ga0075431_100008781
397 Ga0075433_10332275
398 Ga0075434_100803587
399 Ga0075429_100007611
400 Ga0075436_100195170
401 Ga0111539_10023399
402 Ga0105245_10353975
403 Ga0114129_10029880
404 Ga0114129_10518591
405 Ga0105241_10387098
406 Ga0105237_10535938
407 Ga0105239_10203384
408 Ga0157373_10020389
409 Ga0157370_10056683
410 Ga0157370_10068163
411 Ga0157370_10457333
412 Ga0157369_10228804
413 Ga0157369_10328169
414 Ga0157372_10175113
415 Ga0157372_10216606
416 Ga0157372_10668628
417 Ga0157372_10720226
418 Ga0157375_10322835
419 Ga0197907_10056557
420 Ga0206356_10739420
421 Ga0206354_11290060
422 Ga0206353_11892053
423 Ga0206353_11893241
424 Ga0207685_10258074
425 Ga0207699_10195156
426 Ga0207684_10429962
427 Ga0207707_10191471
428 Ga0207707_10193481
429 Ga0207707_10201267
430 Ga0207695_10739982
431 Ga0207693_10323105
432 Ga0207663_10198208
433 Ga0207663_10902422
434 Ga0207660_10436611
435 Ga0207657_10095206
436 Ga0207657_10310227
437 Ga0207652_10028796
438 Ga0207652_10524817
439 Ga0207652_10527846
440 Ga0207646_10013674
441 Ga0207646_10067034
442 Ga0207646_10098997
443 Ga0207646_10440957
444 Ga0207659_10701382
445 Ga0207687_10230134
446 Ga0207700_10018268
447 Ga0207700_10447536
448 Ga0207664_10009761
449 Ga0207664_10092127
450 Ga0207664_10160409
451 Ga0207664_10236175
452 Ga0207690_10279125
453 Ga0207709_10871042
454 Ga0207661_10151137
455 Ga0207661_10340323
456 Ga0207661_10473626
457 Ga0207667_10182111
458 Ga0207667_10585304
459 Ga0207640_10787051
460 Ga0207639_10846750
461 Ga0207702_10674272
462 Ga0207675_100659017
463 Ga0207698_10079161
464 Ga0207428_10003249
465 Ga0316583_10204480
466 Ga0373960_0074258
467 Ga0373931_0280932
468 Ga0395899_0009999
469 Ga0395899_0033694
470 Ga0395899_0208734
471 Ga0395900_0011165
472 Ga0395900_0021035
473 Ga0395900_0027753
474 Ga0395900_0033665
475 Ga0395900_0079113
476 Ga0395900_0090008
477 Ga0395900_0126341
478 Ga0395900_0177154
479 Ga0395900_0448972
480 Ga0395900_0525783
481 Ga0395900_0712278
482 Ga0395898_0005567
483 Ga0395898_0025004
484 Ga0395898_0025159
485 Ga0395898_0066855
486 Ga0395898_0119250
487 Ga0395898_0291427
488 Ga0395898_0766284
489 Ga0395905_0005691
490 Ga0395905_0010239
491 Ga0395905_0019552
492 Ga0395905_0070133
493 Ga0395905_0092609
494 Ga0395905_0165952
495 Ga0395905_0204536
496 Ga0395905_0284517
497 Ga0395901_0002002
498 Ga0395901_0004911
499 Ga0395901_0019188
500 Ga0395901_0021695
501 Ga0395901_0032800
502 Ga0395901_0049320
503 Ga0395901_0102762
504 Ga0395901_0147624
505 Ga0395901_0264314
506 Ga0395901_0507883
507 Ga0395901_0536592
508 Ga0466963_0000216
509 Ga0466963_0005211
510 Ga0466968_0005278
511 Ga0466968_0006691
512 Ga0466970_0194764
513 Ga0466958_0003623
514 Ga0466958_0008814
515 Ga0466967_0001297
516 Ga0466967_0020815
517 Ga0466967_0060617
518 Ga0466967_0217773
519 Ga0466967_0893504
520 Ga0495653_0446981
521 Ga0495680_0320936
522 Ga0496102_0332519
523 Ga0496102_0843300
524 Ga0496103_0004399
525 Ga0496104_0128916
526 Ga0496104_0142652
527 Ga0496104_0397760
528 Ga0496105_0260273
529 Ga0496105_0416331
530 Ga0496105_0709102
531 Ga0496108_0158169
532 Ga0496108_0281067
533 Ga0496109_0012380
534 Ga0496109_0065057
535 Ga0496109_0460992
536 Ga0496109_0772579
537 Ga0496110_0158428
538 Ga0496110_0637658
539 Ga0496110_0640099
540 Ga0496112_0046247
541 Ga0496112_0178070
542 Ga0496112_0329817
543 Ga0496113_0123708
544 Ga0501031_0013052
545 Ga0501031_0017210
546 Ga0501031_0102286
547 Ga0501031_0122283
548 Ga0501032_0011026
549 Ga0501032_0014218
550 Ga0501033_0029877
551 Ga0501034_0125061
552 Ga0501034_0272079
553 Ga0501036_0001454
554 Ga0501036_0007366
555 Ga0501036_0060501
556 Ga0501036_0079292
557 Ga0501036_0255500
558 Ga0501036_0276786
559 Ga0501037_0008106
560 Ga0501037_0016388
561 Ga0501038_0008438
562 Ga0501038_0080342
563 Ga0501038_0308017
564 Ga0501038_0340243
565 Ga0501039_0001535
566 Ga0501039_0012764
567 Ga0501039_0033173
568 Ga0501039_0107116
569 Ga0501039_0682812
570 Ga0501040_0017202
571 Ga0501040_0022542
572 Ga0501040_0032044
573 Ga0501040_0064502
574 Ga0501041_0045453
575 Ga0501042_0017952
576 Ga0501042_0022039
577 Ga0501042_0107770
578 Ga0501042_0156041
579 Ga0501042_0189174
580 Ga0501042_0277770
581 Ga0501042_0426229
582 Ga0501043_0044057
583 Ga0501043_0217487
584 Ga0501046_0018143
585 Ga0501046_0032494
586 Ga0501046_0425001
587 Ga0501047_0020032
588 Ga0501048_0018979
589 Ga0501048_0111863
590 Ga0501048_0297472
591 Ga0501067_0000359
592 Ga0501067_0015830
593 Ga0501068_0003294
594 Ga0501069_0003080
595 Ga0501069_0017912
596 Ga0501070_0170512
597 Ga0501071_0003485
598 Ga0501071_0008416
599 Ga0501072_0022976
600 Ga0501072_0056917
601 Ga0501073_0018276
602 Ga0501073_0232566
603 Ga0501074_0029352
604 Ga0501074_0047331
605 Ga0501074_0100027
606 Ga0501074_0311304
607 Ga0501075_0003211
608 Ga0501075_0022265
609 Ga0501075_0069396
610 Ga0501075_0782629
611 Ga0501076_0025427
612 Ga0501076_0050117
613 Ga0501076_0144061
614 Ga0501076_0174502
615 Ga0501076_0210774
616 Ga0501076_0809146
617 Ga0501077_0042106
618 Ga0501077_0052664
619 Ga0501077_0056535
620 Ga0501079_0006472
621 Ga0501079_0009346
622 Ga0501079_0016327
623 Ga0501079_0024956
624 Ga0501079_0049362
625 Ga0501079_0136045
626 Ga0501079_0195571
627 Ga0501080_0001469
628 Ga0501080_0070275
629 Ga0501080_0295348
630 Ga0501080_0725836
631 Ga0501081_0023567
632 Ga0501081_0024270
633 Ga0501081_0049079
634 Ga0501081_0086053
635 Ga0501083_0049496
636 Ga0501083_0051217
637 Ga0501035_0006913
638 Ga0501035_0040902
639 Ga0501035_0055735
640 Ga0501035_0492433
641 Ga0501035_0625905
642 Ga0501044_0026809
643 Ga0501044_0369777
644 Ga0501045_0003105
645 Ga0501045_0027362
646 Ga0501045_0027885
647 nmdc:mga05p37_154548_c1
648 nmdc:mga05p37_28004_c1
649 nmdc:mga05p37_461184_c1
650 nmdc:mga09592_20192_c1
651 nmdc:mga0qj67_379244_c1
652 nmdc:mga0qj67_5424_c1
653 nmdc:mga06r32_8634_c1
654 nmdc:mga08y16_18652_c1
655 nmdc:mga08x19_253230_c1
656 nmdc:mga0a205_399681_c1
657 Ga0501084_0027372
658 Ga0501084_0030645
659 Ga0501084_0031514
660 Ga0501084_0038465
661 Ga0501084_0081558
662 Ga0501084_0141999
663 Ga0590075_004729
664 Ga0501082_0003768
665 Ga0501082_0013478
666 Ga0501082_0200687
667 Ga0530510_0001020
668 Ga0530510_0003732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

106

202

0.97

PF08241

Methyltransf_11

Methyltransferase domain

107

206

0.97

PF08242

Methyltransf_12

Methyltransferase domain

107

204

0.95

PF13847

Methyltransf_31

Methyltransferase domain

100

226

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

95

225

0.92

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

85

222

0.89

PF13489

Methyltransf_23

Methyltransferase domain

89

227

0.85

PF05175

MTS

Methyltransferase small domain

97

214

0.82

PF02353

CMAS

Mycolic acid cyclopropane synthetase

95

226

0.82

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

96

210

0.79

PF01728

FtsJ

FtsJ-like methyltransferase

95

207

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bkw-assembly1.cif.gz_B crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.9243 79 183
6ecv-assembly1.cif.gz_B stid o-mt residues 976-1266 0.9215 79 185
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.9195 76 183
5dnk-assembly1.cif.gz_A the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.9171 80 179
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.9171 80 179
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.973 79 142 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9554 77 142 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.945 76 144 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9428 79 135 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9418 78 183 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0H4AE29-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9828 77 180 GO:0008168
GO:0032259
AF-A0A0H4A0R3-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9804 77 180 GO:0008168
GO:0032259
AF-A0A0H4AD74-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.979 77 180 GO:0008168
GO:0032259
AF-A0A0H3ZYD5-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9775 77 180 GO:0008168
GO:0032259
AF-A0A0H4A5S9-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9775 77 180 GO:0008168
GO:0032259

Map