F411945

General Info

Members Datasets Scaffolds Average Seq Length
334 187 668 227

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0021237|Ga0495669_0021237_1145_1945
Length 266
Sequence MGAETDFPLGAQPIPLIFDSASLFADIPSERQGTAKGAPMTSEAVAIAVAVDVVSSNESKIASIQEYIARAIDDLLASLRDPGLLSAEERRGIIARYATVLEGNFIYWMTGAYISVRSDEARAKIMDNLREEVRDCHPGMMRRFARAARAIPTDADAEAVHRNLMNVRLFIGRLSAVPIVVTMAFFEGFIQRFMPYLAELAQRQGSAEMEYTDVHGVCDVTHTQELFRALEAEMVLAPPRPEEELLEGVELLRTLIQSIVVNTNVQ

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.92
Metatranscriptomes 8.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 34.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0021237 3300046684 Bacteria 2816
2 Ga0058863_11526517 3300004799 Unclassified 2347
3 Ga0058861_10054782 3300004800 Bacteria 2647
4 Ga0058861_10110251 3300004800 Unclassified 2178
5 Ga0058861_10952786 3300004800 Unclassified 1118
6 Ga0058862_10012634 3300004803 Bacteria 3435
7 Ga0058862_10040656 3300004803 Bacteria 2539
8 Ga0058862_10106455 3300004803 Unclassified 755
9 Ga0058862_10114449 3300004803 Unclassified 3804
10 Ga0058862_12201351 3300004803 Bacteria 3327
11 Ga0058862_12888755 3300004803 Unclassified 4302
12 Ga0065715_10005264 3300005293 Bacteria 3208
13 Ga0065715_10009465 3300005293 Bacteria 2597
14 Ga0065707_10363587 3300005295 Unclassified 888
15 Ga0070658_10063416 3300005327 Unclassified 3013
16 Ga0070658_10709309 3300005327 Unclassified 873
17 Ga0070683_100006206 3300005329 Bacteria 10020
18 Ga0070683_100199698 3300005329 Unclassified 1899
19 Ga0070690_100107537 3300005330 Unclassified 1857
20 Ga0070690_100385326 3300005330 Unclassified 1026
21 Ga0070680_100016108 3300005336 Bacteria 5874
22 Ga0068868_100519086 3300005338 Bacteria 1046
23 Ga0070660_100173344 3300005339 Unclassified 1743
24 Ga0070691_10004435 3300005341 Bacteria 6379
25 Ga0070661_100100759 3300005344 Unclassified 2148
26 Ga0070692_10155411 3300005345 Bacteria 1306
27 Ga0070668_100007983 3300005347 Bacteria 7862
28 Ga0070669_100230653 3300005353 Bacteria 1467
29 Ga0070659_100175172 3300005366 Unclassified 1759
30 Ga0070714_100011024 3300005435 Bacteria 7159
31 Ga0070713_100006649 3300005436 Bacteria 8043
32 Ga0070713_100054462 3300005436 Bacteria 3319
33 Ga0070713_100066044 3300005436 Bacteria 3041
34 Ga0070713_100200208 3300005436 Bacteria 1803
35 Ga0070713_100248456 3300005436 Unclassified 1622
36 Ga0070711_100053944 3300005439 Unclassified 2772
37 Ga0070711_100970936 3300005439 Unclassified 728
38 Ga0070705_100203259 3300005440 Unclassified 1360
39 Ga0070705_100529269 3300005440 Unclassified 900
40 Ga0070700_100334736 3300005441 Unclassified 1117
41 Ga0070694_100385705 3300005444 Bacteria 1094
42 Ga0070663_100419877 3300005455 Bacteria 1097
43 Ga0070663_100770304 3300005455 Bacteria 823
44 Ga0070681_10000815 3300005458 Bacteria 26058
45 Ga0070681_10091968 3300005458 Bacteria 2983
46 Ga0070681_10180476 3300005458 Unclassified 2032
47 Ga0070681_10514830 3300005458 Unclassified 1110
48 Ga0068867_100019976 3300005459 Bacteria 4774
49 Ga0068867_100134645 3300005459 Bacteria 1924
50 Ga0070706_100098237 3300005467 Bacteria 2720
51 Ga0070707_100077343 3300005468 Bacteria 3210
52 Ga0070707_100271164 3300005468 Bacteria 1650
53 Ga0070698_100401094 3300005471 Bacteria 1305
54 Ga0070698_100468487 3300005471 Unclassified 1196
55 Ga0070699_100013260 3300005518 Bacteria 7107
56 Ga0070699_100085816 3300005518 Bacteria 2747
57 Ga0070679_100261382 3300005530 Bacteria 1686
58 Ga0070679_100464859 3300005530 Unclassified 1210
59 Ga0070684_100018433 3300005535 Bacteria 5750
60 Ga0070684_100051670 3300005535 Bacteria 3571
61 Ga0070684_100065867 3300005535 Bacteria 3181
62 Ga0070697_100161504 3300005536 Bacteria 1893
63 Ga0070697_100247988 3300005536 Bacteria 1522
64 Ga0068853_100094027 3300005539 Bacteria 2640
65 Ga0068853_100164950 3300005539 Unclassified 2001
66 Ga0070695_100362176 3300005545 Bacteria 1089
67 Ga0070693_100080013 3300005547 Unclassified 1946
68 Ga0070665_100002540 3300005548 Bacteria 20052
69 Ga0070704_100266598 3300005549 Bacteria 1413
70 Ga0068855_100055878 3300005563 Unclassified 4634
71 Ga0068855_100487330 3300005563 Bacteria 1341
72 Ga0070664_100340988 3300005564 Bacteria 1361
73 Ga0068857_100000183 3300005577 Bacteria 40198
74 Ga0068857_100004506 3300005577 Bacteria 11778
75 Ga0068857_100295044 3300005577 Unclassified 1494
76 Ga0068857_100324347 3300005577 Bacteria 1423
77 Ga0068854_100160611 3300005578 Unclassified 1740
78 Ga0068854_100409483 3300005578 Bacteria 1124
79 Ga0068856_100007830 3300005614 Bacteria 10434
80 Ga0068856_100123916 3300005614 Bacteria 2587
81 Ga0068856_100172808 3300005614 Bacteria 2173
82 Ga0068856_100514016 3300005614 Bacteria 1219
83 Ga0070702_100118489 3300005615 Bacteria 1653
84 Ga0068852_100014262 3300005616 Bacteria 6110
85 Ga0068852_100136615 3300005616 Bacteria 2264
86 Ga0068852_100179540 3300005616 Unclassified 1990
87 Ga0068859_100277852 3300005617 Unclassified 1767
88 Ga0068866_10373394 3300005718 Unclassified 913
89 Ga0068861_100009555 3300005719 Bacteria 6700
90 Ga0068858_100330922 3300005842 Bacteria 1457
91 Ga0068858_101002001 3300005842 Unclassified 819
92 Ga0068862_100338473 3300005844 Bacteria 1393
93 Ga0070716_100142334 3300006173 Bacteria 1531
94 Ga0070716_100195839 3300006173 Bacteria 1339
95 Ga0070716_100499453 3300006173 Bacteria 897
96 Ga0070712_100229643 3300006175 Unclassified 1473
97 Ga0097621_100040907 3300006237 Bacteria 3728
98 Ga0097621_100047182 3300006237 Bacteria 3490
99 Ga0097621_100398784 3300006237 Unclassified 1231
100 Ga0097621_100439819 3300006237 Unclassified 1173
101 Ga0097621_100904830 3300006237 Unclassified 822
102 Ga0068871_100009736 3300006358 Bacteria 6975
103 Ga0068871_100236161 3300006358 Unclassified 1588
104 Ga0075431_100031590 3300006847 Bacteria 5454
105 Ga0075431_100128353 3300006847 Bacteria 2616
106 Ga0075433_10061367 3300006852 Unclassified 3293
107 Ga0075433_10143933 3300006852 Bacteria 2119
108 Ga0075433_10743515 3300006852 Bacteria 858
109 Ga0075434_100055551 3300006871 Bacteria 3935
110 Ga0075434_100173031 3300006871 Bacteria 2179
111 Ga0075434_100950242 3300006871 Unclassified 874
112 Ga0075429_100087678 3300006880 Unclassified 2712
113 Ga0068865_100046873 3300006881 Bacteria 2968
114 Ga0075436_100205922 3300006914 Bacteria 1394
115 Ga0075436_100505790 3300006914 Unclassified 884
116 Ga0097620_100277864 3300006931 Unclassified 1767
117 Ga0075435_100043824 3300007076 Bacteria 3583
118 Ga0075435_100175943 3300007076 Unclassified 1807
119 Ga0075435_100198568 3300007076 Bacteria 1699
120 Ga0075435_100234754 3300007076 Unclassified 1558
121 Ga0105240_10003671 3300009093 Bacteria 23744
122 Ga0105240_10025773 3300009093 Bacteria 7722
123 Ga0105240_10236189 3300009093 Bacteria 2121
124 Ga0105245_10009818 3300009098 Bacteria 8341
125 Ga0105245_10292263 3300009098 Bacteria 1596
126 Ga0114129_10009417 3300009147 Bacteria 13923
127 Ga0114129_10023155 3300009147 Bacteria 8811
128 Ga0114129_10306304 3300009147 Bacteria 2116
129 Ga0105243_10001689 3300009148 Bacteria 19021
130 Ga0105241_10005615 3300009174 Bacteria 9258
131 Ga0105241_10026896 3300009174 Bacteria 4282
132 Ga0105241_10502656 3300009174 Bacteria 1081
133 Ga0105242_10000511 3300009176 Bacteria 30533
134 Ga0105242_10226673 3300009176 Bacteria 1673
135 Ga0105242_10510186 3300009176 Bacteria 1145
136 Ga0105242_11219670 3300009176 Bacteria 772
137 Ga0105248_10000398 3300009177 Bacteria 50347
138 Ga0105248_10054422 3300009177 Bacteria 4488
139 Ga0105248_10212739 3300009177 Bacteria 2178
140 Ga0105237_10000976 3300009545 Bacteria 38397
141 Ga0105237_10437976 3300009545 Unclassified 1313
142 Ga0105238_10005118 3300009551 Bacteria 12962
143 Ga0105238_10010284 3300009551 Bacteria 9385
144 Ga0105238_10012037 3300009551 Bacteria 8714
145 Ga0105249_10028038 3300009553 Bacteria 5083
146 Ga0105249_10154642 3300009553 Bacteria 2211
147 Ga0105239_10001080 3300010375 Bacteria 37816
148 Ga0105239_10004927 3300010375 Bacteria 15763
149 Ga0154012_173195 3300013059 Unclassified 1071
150 Ga0157373_10111044 3300013100 Unclassified 1927
151 Ga0157371_10437557 3300013102 Bacteria 960
152 Ga0157370_10012522 3300013104 Bacteria 8793
153 Ga0157370_10016252 3300013104 Bacteria 7540
154 Ga0157370_10098838 3300013104 Unclassified 2736
155 Ga0157369_10053239 3300013105 Bacteria 4376
156 Ga0157369_10266140 3300013105 Bacteria 1787
157 Ga0157378_10026257 3300013297 Bacteria 5134
158 Ga0157378_10221537 3300013297 Bacteria 1799
159 Ga0157378_10262624 3300013297 Unclassified 1657
160 Ga0157372_10011210 3300013307 Bacteria 9538
161 Ga0157372_10073363 3300013307 Bacteria 3858
162 Ga0157375_10964788 3300013308 Bacteria 994
163 Ga0163163_10905097 3300014325 Unclassified 946
164 Ga0157376_10025002 3300014969 Bacteria 4698
165 Ga0157376_10073238 3300014969 Bacteria 2916
166 Ga0184598_109883 3300019182 Unclassified 1042
167 Ga0197907_11233840 3300020069 Unclassified 3812
168 Ga0206349_1107585 3300020075 Bacteria 2194
169 Ga0206355_1071547 3300020076 Bacteria 6876
170 Ga0206351_10026020 3300020077 Unclassified 2246
171 Ga0206351_10055816 3300020077 Unclassified 4864
172 Ga0206352_11307056 3300020078 Unclassified 1266
173 Ga0206350_11140227 3300020080 Unclassified 3158
174 Ga0154015_1243103 3300020610 Unclassified 1241
175 Ga0154015_1518137 3300020610 Unclassified 4032
176 Ga0224712_10132237 3300022467 Unclassified 1091
177 Ga0207653_10040388 3300025885 Bacteria 1529
178 Ga0207642_10088229 3300025899 Bacteria 1525
179 Ga0207642_10102312 3300025899 Unclassified 1441
180 Ga0207705_10293907 3300025909 Unclassified 1245
181 Ga0207705_10437627 3300025909 Unclassified 1013
182 Ga0207684_10055511 3300025910 Bacteria 3360
183 Ga0207654_10003271 3300025911 Bacteria 8192
184 Ga0207654_10104808 3300025911 Bacteria 1749
185 Ga0207654_10126922 3300025911 Unclassified 1610
186 Ga0207654_10276334 3300025911 Bacteria 1135
187 Ga0207707_10002046 3300025912 Bacteria 18310
188 Ga0207707_10164644 3300025912 Bacteria 1938
189 Ga0207707_10168414 3300025912 Unclassified 1914
190 Ga0207695_10001577 3300025913 Bacteria 37148
191 Ga0207695_10006387 3300025913 Bacteria 15330
192 Ga0207695_10010018 3300025913 Unclassified 11641
193 Ga0207695_10031603 3300025913 Bacteria 5803
194 Ga0207695_10573578 3300025913 Bacteria 1010
195 Ga0207671_10013058 3300025914 Bacteria 6639
196 Ga0207671_10295639 3300025914 Bacteria 1279
197 Ga0207663_10149715 3300025916 Bacteria 1636
198 Ga0207663_10851615 3300025916 Unclassified 728
199 Ga0207660_10013965 3300025917 Bacteria 5271
200 Ga0207660_10095652 3300025917 Bacteria 2210
201 Ga0207657_10174090 3300025919 Unclassified 1743
202 Ga0207649_10048203 3300025920 Unclassified 2627
203 Ga0207652_10001815 3300025921 Bacteria 18492
204 Ga0207652_10201155 3300025921 Unclassified 1792
205 Ga0207646_10129268 3300025922 Unclassified 2273
206 Ga0207646_10176164 3300025922 Bacteria 1932
207 Ga0207646_10177149 3300025922 Bacteria 1926
208 Ga0207681_10280616 3300025923 Unclassified 1311
209 Ga0207694_10000327 3300025924 Bacteria 44750
210 Ga0207694_10066952 3300025924 Unclassified 2803
211 Ga0207694_10137227 3300025924 Unclassified 1965
212 Ga0207694_10197851 3300025924 Bacteria 1634
213 Ga0207687_10040807 3300025927 Bacteria 3183
214 Ga0207700_10096402 3300025928 Bacteria 2348
215 Ga0207700_10219588 3300025928 Unclassified 1611
216 Ga0207700_10259223 3300025928 Bacteria 1488
217 Ga0207700_10262076 3300025928 Bacteria 1481
218 Ga0207700_10402526 3300025928 Unclassified 1200
219 Ga0207690_10247890 3300025932 Unclassified 1374
220 Ga0207690_10405866 3300025932 Unclassified 1087
221 Ga0207686_10015674 3300025934 Unclassified 4243
222 Ga0207709_10185630 3300025935 Bacteria 1472
223 Ga0207670_10551173 3300025936 Unclassified 942
224 Ga0207711_10006692 3300025941 Bacteria 9700
225 Ga0207711_10017347 3300025941 Bacteria 5981
226 Ga0207711_10240807 3300025941 Bacteria 1659
227 Ga0207711_10845813 3300025941 Unclassified 851
228 Ga0207661_10009093 3300025944 Bacteria 7119
229 Ga0207661_10037692 3300025944 Bacteria 3783
230 Ga0207661_10074573 3300025944 Bacteria 2781
231 Ga0207661_10168535 3300025944 Unclassified 1905
232 Ga0207679_10028554 3300025945 Bacteria 3873
233 Ga0207679_10225175 3300025945 Bacteria 1580
234 Ga0207667_10000898 3300025949 Bacteria 37937
235 Ga0207667_10018832 3300025949 Bacteria 7730
236 Ga0207667_10054133 3300025949 Unclassified 4221
237 Ga0207667_10078415 3300025949 Unclassified 3424
238 Ga0207651_10003797 3300025960 Bacteria 7482
239 Ga0207651_10820204 3300025960 Unclassified 825
240 Ga0207712_10065008 3300025961 Bacteria 2602
241 Ga0207668_10019559 3300025972 Bacteria 4285
242 Ga0207703_10319718 3300026035 Unclassified 1421
243 Ga0207703_10359310 3300026035 Bacteria 1343
244 Ga0207703_10558354 3300026035 Unclassified 1080
245 Ga0207639_10029371 3300026041 Unclassified 4024
246 Ga0207639_10122894 3300026041 Unclassified 2136
247 Ga0207678_10465730 3300026067 Bacteria 1100
248 Ga0207708_10491306 3300026075 Unclassified 1027
249 Ga0207702_10058223 3300026078 Unclassified 3288
250 Ga0207702_10146476 3300026078 Bacteria 2143
251 Ga0207702_10442140 3300026078 Unclassified 1260
252 Ga0207648_10057575 3300026089 Unclassified 3391
253 Ga0207648_10368027 3300026089 Bacteria 1298
254 Ga0207676_10043596 3300026095 Unclassified 3456
255 Ga0207674_10000717 3300026116 Bacteria 43358
256 Ga0207674_10000872 3300026116 Bacteria 39452
257 Ga0207674_10173878 3300026116 Unclassified 2106
258 Ga0207674_10261053 3300026116 Bacteria 1679
259 Ga0207675_100149223 3300026118 Bacteria 2224
260 Ga0207683_10114902 3300026121 Bacteria 2412
261 Ga0207698_10047555 3300026142 Unclassified 3251
262 Ga0207698_10109870 3300026142 Bacteria 2308
263 Ga0268266_10024939 3300028379 Bacteria 5088
264 Ga0268265_10010354 3300028380 Bacteria 6296
265 Ga0265338_10001904 3300028800 Bacteria 32600
266 Ga0265762_1010960 3300030760 Unclassified 1621
267 Ga0265767_101962 3300030836 Unclassified 1060
268 Ga0265761_100224 3300030889 Bacteria 2040
269 Ga0247549_100485 3300030942 Bacteria 1136
270 Ga0265339_10046189 3300031249 Bacteria 2395
271 Ga0265316_10470889 3300031344 Bacteria 900
272 Ga0265314_10001412 3300031711 Bacteria 26918
273 Ga0373956_0208859 3300035119 Unclassified 926
274 Ga0373943_0196006 3300035170 Bacteria 1116
275 Ga0373935_0046193 3300035692 Bacteria 2750
276 Ga0373935_0192025 3300035692 Bacteria 1407
277 Ga0373935_0198420 3300035692 Bacteria 1385
278 Ga0373933_0573988 3300035724 Bacteria 740
279 Ga0373947_0018896 3300035725 Bacteria 3971
280 Ga0373947_0028619 3300035725 Unclassified 3268
281 Ga0373947_0491466 3300035725 Bacteria 833
282 Ga0373937_0004477 3300036401 Bacteria 11868
283 Ga0373937_0046683 3300036401 Bacteria 3961
284 Ga0373937_0342415 3300036401 Bacteria 1416
285 Ga0373925_0007207 3300037068 Bacteria 8129
286 Ga0395898_0384540 3300037466 Bacteria 1338
287 Ga0436361_0365832 3300039447 Unclassified 1495
288 Ga0495603_0140480 3300046455 Unclassified 1405
289 Ga0495629_0075088 3300046459 Bacteria 2361
290 Ga0495639_0064660 3300046475 Bacteria 1682
291 Ga0495639_0152674 3300046475 Bacteria 1115
292 Ga0495664_0223630 3300046477 Bacteria 1139
293 Ga0495630_0515514 3300046517 Bacteria 917
294 Ga0495652_0525724 3300046529 Bacteria 817
295 Ga0495665_0030865 3300046531 Bacteria 2867
296 Ga0495586_0146963 3300046535 Bacteria 1325
297 Ga0495587_0092988 3300046536 Bacteria 1741
298 Ga0495645_0147344 3300046543 Unclassified 1638
299 Ga0495667_0374226 3300046559 Unclassified 899
300 Ga0495635_0084056 3300046663 Bacteria 2178
301 Ga0495635_0086904 3300046663 Bacteria 2140
302 Ga0495657_0128406 3300046675 Bacteria 1590
303 Ga0495623_0020753 3300046679 Bacteria 4245
304 Ga0495646_0277592 3300046680 Bacteria 891
305 Ga0495658_0010936 3300046683 Bacteria 4550
306 Ga0495669_0010393 3300046684 Bacteria 3932
307 Ga0495613_0134934 3300046689 Unclassified 1766
308 Ga0495600_0069443 3300046809 Bacteria 2303
309 Ga0495604_0026616 3300047317 Unclassified 4604
310 Ga0495675_0063704 3300047444 Bacteria 2332
311 Ga0495684_0183995 3300047471 Bacteria 1548
312 Ga0495684_0265779 3300047471 Bacteria 1243
313 Ga0495602_0514703 3300048088 Bacteria 834
314 Ga0501031_0330040 3300049568 Unclassified 988
315 Ga0501036_0292837 3300049572 Unclassified 1362
316 Ga0501068_0281394 3300049584 Unclassified 1063
317 Ga0501074_0281486 3300049590 Bacteria 1182
318 Ga0501077_0035585 3300049593 Bacteria 3170
319 Ga0501079_0753820 3300049741 Unclassified 766
320 nmdc:mga05p37_103677_c1 3300050507 Bacteria 3500
321 nmdc:mga05p37_155648_c1 3300050507 Bacteria 2793
322 nmdc:mga05p37_16823_c1 3300050507 Bacteria 8817
323 nmdc:mga06r32_446041_c1 3300050510 Bacteria 1274
324 nmdc:mga0n895_131948_c1 3300050512 Bacteria 2523
325 nmdc:mga0n895_880286_c1 3300050512 Unclassified 882
326 nmdc:mga0rr50_1864_c1 3300050513 Bacteria 11701
327 nmdc:mga0rr50_48654_c1 3300050513 Bacteria 3135
328 nmdc:mga0rr50_66527_c1 3300050513 Unclassified 2735
329 nmdc:mga08x19_128876_c1 3300050514 Unclassified 1701
330 nmdc:mga08x19_465257_c1 3300050514 Unclassified 891
331 nmdc:mga0a205_311378_c1 3300050515 Bacteria 1446
332 nmdc:mga0a205_42289_c1 3300050515 Unclassified 3258
333 nmdc:mga0a205_51562_c1 3300050515 Bacteria 3972
334 Ga0587084_012302 3300059477 Bacteria 1157
335 Ga0495669_0021237
336 Ga0058863_11526517
337 Ga0058861_10054782
338 Ga0058861_10110251
339 Ga0058861_10952786
340 Ga0058862_10012634
341 Ga0058862_10040656
342 Ga0058862_10106455
343 Ga0058862_10114449
344 Ga0058862_12201351
345 Ga0058862_12888755
346 Ga0065715_10005264
347 Ga0065715_10009465
348 Ga0065707_10363587
349 Ga0070658_10063416
350 Ga0070658_10709309
351 Ga0070683_100006206
352 Ga0070683_100199698
353 Ga0070690_100107537
354 Ga0070690_100385326
355 Ga0070680_100016108
356 Ga0068868_100519086
357 Ga0070660_100173344
358 Ga0070691_10004435
359 Ga0070661_100100759
360 Ga0070692_10155411
361 Ga0070668_100007983
362 Ga0070669_100230653
363 Ga0070659_100175172
364 Ga0070714_100011024
365 Ga0070713_100006649
366 Ga0070713_100054462
367 Ga0070713_100066044
368 Ga0070713_100200208
369 Ga0070713_100248456
370 Ga0070711_100053944
371 Ga0070711_100970936
372 Ga0070705_100203259
373 Ga0070705_100529269
374 Ga0070700_100334736
375 Ga0070694_100385705
376 Ga0070663_100419877
377 Ga0070663_100770304
378 Ga0070681_10000815
379 Ga0070681_10091968
380 Ga0070681_10180476
381 Ga0070681_10514830
382 Ga0068867_100019976
383 Ga0068867_100134645
384 Ga0070706_100098237
385 Ga0070707_100077343
386 Ga0070707_100271164
387 Ga0070698_100401094
388 Ga0070698_100468487
389 Ga0070699_100013260
390 Ga0070699_100085816
391 Ga0070679_100261382
392 Ga0070679_100464859
393 Ga0070684_100018433
394 Ga0070684_100051670
395 Ga0070684_100065867
396 Ga0070697_100161504
397 Ga0070697_100247988
398 Ga0068853_100094027
399 Ga0068853_100164950
400 Ga0070695_100362176
401 Ga0070693_100080013
402 Ga0070665_100002540
403 Ga0070704_100266598
404 Ga0068855_100055878
405 Ga0068855_100487330
406 Ga0070664_100340988
407 Ga0068857_100000183
408 Ga0068857_100004506
409 Ga0068857_100295044
410 Ga0068857_100324347
411 Ga0068854_100160611
412 Ga0068854_100409483
413 Ga0068856_100007830
414 Ga0068856_100123916
415 Ga0068856_100172808
416 Ga0068856_100514016
417 Ga0070702_100118489
418 Ga0068852_100014262
419 Ga0068852_100136615
420 Ga0068852_100179540
421 Ga0068859_100277852
422 Ga0068866_10373394
423 Ga0068861_100009555
424 Ga0068858_100330922
425 Ga0068858_101002001
426 Ga0068862_100338473
427 Ga0070716_100142334
428 Ga0070716_100195839
429 Ga0070716_100499453
430 Ga0070712_100229643
431 Ga0097621_100040907
432 Ga0097621_100047182
433 Ga0097621_100398784
434 Ga0097621_100439819
435 Ga0097621_100904830
436 Ga0068871_100009736
437 Ga0068871_100236161
438 Ga0075431_100031590
439 Ga0075431_100128353
440 Ga0075433_10061367
441 Ga0075433_10143933
442 Ga0075433_10743515
443 Ga0075434_100055551
444 Ga0075434_100173031
445 Ga0075434_100950242
446 Ga0075429_100087678
447 Ga0068865_100046873
448 Ga0075436_100205922
449 Ga0075436_100505790
450 Ga0097620_100277864
451 Ga0075435_100043824
452 Ga0075435_100175943
453 Ga0075435_100198568
454 Ga0075435_100234754
455 Ga0105240_10003671
456 Ga0105240_10025773
457 Ga0105240_10236189
458 Ga0105245_10009818
459 Ga0105245_10292263
460 Ga0114129_10009417
461 Ga0114129_10023155
462 Ga0114129_10306304
463 Ga0105243_10001689
464 Ga0105241_10005615
465 Ga0105241_10026896
466 Ga0105241_10502656
467 Ga0105242_10000511
468 Ga0105242_10226673
469 Ga0105242_10510186
470 Ga0105242_11219670
471 Ga0105248_10000398
472 Ga0105248_10054422
473 Ga0105248_10212739
474 Ga0105237_10000976
475 Ga0105237_10437976
476 Ga0105238_10005118
477 Ga0105238_10010284
478 Ga0105238_10012037
479 Ga0105249_10028038
480 Ga0105249_10154642
481 Ga0105239_10001080
482 Ga0105239_10004927
483 Ga0154012_173195
484 Ga0157373_10111044
485 Ga0157371_10437557
486 Ga0157370_10012522
487 Ga0157370_10016252
488 Ga0157370_10098838
489 Ga0157369_10053239
490 Ga0157369_10266140
491 Ga0157378_10026257
492 Ga0157378_10221537
493 Ga0157378_10262624
494 Ga0157372_10011210
495 Ga0157372_10073363
496 Ga0157375_10964788
497 Ga0163163_10905097
498 Ga0157376_10025002
499 Ga0157376_10073238
500 Ga0184598_109883
501 Ga0197907_11233840
502 Ga0206349_1107585
503 Ga0206355_1071547
504 Ga0206351_10026020
505 Ga0206351_10055816
506 Ga0206352_11307056
507 Ga0206350_11140227
508 Ga0154015_1243103
509 Ga0154015_1518137
510 Ga0224712_10132237
511 Ga0207653_10040388
512 Ga0207642_10088229
513 Ga0207642_10102312
514 Ga0207705_10293907
515 Ga0207705_10437627
516 Ga0207684_10055511
517 Ga0207654_10003271
518 Ga0207654_10104808
519 Ga0207654_10126922
520 Ga0207654_10276334
521 Ga0207707_10002046
522 Ga0207707_10164644
523 Ga0207707_10168414
524 Ga0207695_10001577
525 Ga0207695_10006387
526 Ga0207695_10010018
527 Ga0207695_10031603
528 Ga0207695_10573578
529 Ga0207671_10013058
530 Ga0207671_10295639
531 Ga0207663_10149715
532 Ga0207663_10851615
533 Ga0207660_10013965
534 Ga0207660_10095652
535 Ga0207657_10174090
536 Ga0207649_10048203
537 Ga0207652_10001815
538 Ga0207652_10201155
539 Ga0207646_10129268
540 Ga0207646_10176164
541 Ga0207646_10177149
542 Ga0207681_10280616
543 Ga0207694_10000327
544 Ga0207694_10066952
545 Ga0207694_10137227
546 Ga0207694_10197851
547 Ga0207687_10040807
548 Ga0207700_10096402
549 Ga0207700_10219588
550 Ga0207700_10259223
551 Ga0207700_10262076
552 Ga0207700_10402526
553 Ga0207690_10247890
554 Ga0207690_10405866
555 Ga0207686_10015674
556 Ga0207709_10185630
557 Ga0207670_10551173
558 Ga0207711_10006692
559 Ga0207711_10017347
560 Ga0207711_10240807
561 Ga0207711_10845813
562 Ga0207661_10009093
563 Ga0207661_10037692
564 Ga0207661_10074573
565 Ga0207661_10168535
566 Ga0207679_10028554
567 Ga0207679_10225175
568 Ga0207667_10000898
569 Ga0207667_10018832
570 Ga0207667_10054133
571 Ga0207667_10078415
572 Ga0207651_10003797
573 Ga0207651_10820204
574 Ga0207712_10065008
575 Ga0207668_10019559
576 Ga0207703_10319718
577 Ga0207703_10359310
578 Ga0207703_10558354
579 Ga0207639_10029371
580 Ga0207639_10122894
581 Ga0207678_10465730
582 Ga0207708_10491306
583 Ga0207702_10058223
584 Ga0207702_10146476
585 Ga0207702_10442140
586 Ga0207648_10057575
587 Ga0207648_10368027
588 Ga0207676_10043596
589 Ga0207674_10000717
590 Ga0207674_10000872
591 Ga0207674_10173878
592 Ga0207674_10261053
593 Ga0207675_100149223
594 Ga0207683_10114902
595 Ga0207698_10047555
596 Ga0207698_10109870
597 Ga0268266_10024939
598 Ga0268265_10010354
599 Ga0265338_10001904
600 Ga0265762_1010960
601 Ga0265767_101962
602 Ga0265761_100224
603 Ga0247549_100485
604 Ga0265339_10046189
605 Ga0265316_10470889
606 Ga0265314_10001412
607 Ga0373956_0208859
608 Ga0373943_0196006
609 Ga0373935_0046193
610 Ga0373935_0192025
611 Ga0373935_0198420
612 Ga0373933_0573988
613 Ga0373947_0018896
614 Ga0373947_0028619
615 Ga0373947_0491466
616 Ga0373937_0004477
617 Ga0373937_0046683
618 Ga0373937_0342415
619 Ga0373925_0007207
620 Ga0395898_0384540
621 Ga0436361_0365832
622 Ga0495603_0140480
623 Ga0495629_0075088
624 Ga0495639_0064660
625 Ga0495639_0152674
626 Ga0495664_0223630
627 Ga0495630_0515514
628 Ga0495652_0525724
629 Ga0495665_0030865
630 Ga0495586_0146963
631 Ga0495587_0092988
632 Ga0495645_0147344
633 Ga0495667_0374226
634 Ga0495635_0084056
635 Ga0495635_0086904
636 Ga0495657_0128406
637 Ga0495623_0020753
638 Ga0495646_0277592
639 Ga0495658_0010936
640 Ga0495669_0010393
641 Ga0495613_0134934
642 Ga0495600_0069443
643 Ga0495604_0026616
644 Ga0495675_0063704
645 Ga0495684_0183995
646 Ga0495684_0265779
647 Ga0495602_0514703
648 Ga0501031_0330040
649 Ga0501036_0292837
650 Ga0501068_0281394
651 Ga0501074_0281486
652 Ga0501077_0035585
653 Ga0501079_0753820
654 nmdc:mga05p37_103677_c1
655 nmdc:mga05p37_155648_c1
656 nmdc:mga05p37_16823_c1
657 nmdc:mga06r32_446041_c1
658 nmdc:mga0n895_131948_c1
659 nmdc:mga0n895_880286_c1
660 nmdc:mga0rr50_1864_c1
661 nmdc:mga0rr50_48654_c1
662 nmdc:mga0rr50_66527_c1
663 nmdc:mga08x19_128876_c1
664 nmdc:mga08x19_465257_c1
665 nmdc:mga0a205_311378_c1
666 nmdc:mga0a205_42289_c1
667 nmdc:mga0a205_51562_c1
668 Ga0587084_012302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

94

255

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.7653 19 217
3ogh-assembly1.cif.gz_A crystal structure of ycie protein from e. coli cft073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins 0.7433 43 197
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.7174 19 217
3ogh-assembly1.cif.gz_A crystal structure of ycie protein from e. coli cft073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins 0.717 43 197
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.6518 34 197
ID Description Score Start End Superfamily
af_Q54PI1_1_203_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8231 16 216 1.20.910.10
af_Q54PI1_1_203_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7675 16 216 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7293 19 217 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.6954 19 217 1.20.910.10
4lqxB00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.6535 41 216 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A2V6X2N9-F1-model_v4 Heme oxygenase 1 16 188
AF-A0A2V7TRW3-F1-model_v4 Iron-containing redox enzyme family protein 0.9816 20 218
AF-A0A538REY2-F1-model_v4 Heme oxygenase 0.9786 27 219
AF-A0A2V6YLU6-F1-model_v4 Iron-containing redox enzyme family protein 0.9775 16 217
AF-A0A2V7B0P5-F1-model_v4 Iron-containing redox enzyme family protein 0.9735 18 218

Map