F411915

General Info

Members Datasets Scaffolds Average Seq Length
334 215 668 217

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0224735|Ga0466963_0224735_107_772
Length 215
Sequence MAERSSRKCRLGIYVFKDAEIVDFAAPYGVFSVAKRFDPELDAFLIADAMRPVQAQAGFTVLPNYSFNDAPIPGGYGTRQELHNRRLHAYIESLPADCLLTSVCTGSWIYGVMGLLDGIPATNRKEPDRVEASASGKVPIDRLADIAPKCRISRARVVDAGRIVTAGGICSGMEMGFHLLRRAGYDERFIDEVARVMEYRDAYAVYRDDIEYFKR

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
210 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
211 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
212 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
213 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
214 8022792930 Bacillus sp. Xin Isolate Rhizosphere
215 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 9.28
Rhizosphere 83.53
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0224735 3300044694 Bacteria 1315
2 Ga0070670_100131860 3300005331 Bacteria 2158
3 Ga0070670_100263039 3300005331 Bacteria 1504
4 Ga0068869_100224965 3300005334 Bacteria 1489
5 Ga0068868_100072496 3300005338 Bacteria 2748
6 Ga0068868_100491822 3300005338 Bacteria 1073
7 Ga0068868_100550273 3300005338 Bacteria 1017
8 Ga0070689_100074371 3300005340 Bacteria 2659
9 Ga0070692_10000405 3300005345 Bacteria 12906
10 Ga0070669_100063337 3300005353 Bacteria 2721
11 Ga0070671_100075853 3300005355 Bacteria 2809
12 Ga0070673_100055632 3300005364 Bacteria 3118
13 Ga0070673_100343504 3300005364 Bacteria 1323
14 Ga0070688_100164842 3300005365 Bacteria 1525
15 Ga0070667_100419228 3300005367 Bacteria 1220
16 Ga0070667_100460913 3300005367 Bacteria 1162
17 Ga0070714_100337246 3300005435 Bacteria 1413
18 Ga0070714_100992806 3300005435 Bacteria 817
19 Ga0070710_10185354 3300005437 Bacteria 1306
20 Ga0070711_100266504 3300005439 Bacteria 1350
21 Ga0070700_100356563 3300005441 Bacteria 1086
22 Ga0070694_100051431 3300005444 Bacteria 2781
23 Ga0070694_100407154 3300005444 Bacteria 1066
24 Ga0070708_100002892 3300005445 Bacteria 13334
25 Ga0070708_100159191 3300005445 Bacteria 2104
26 Ga0070708_100177710 3300005445 Unclassified 1989
27 Ga0070708_100237674 3300005445 Bacteria 1710
28 Ga0070663_100012500 3300005455 Bacteria 5373
29 Ga0070663_100076764 3300005455 Bacteria 2444
30 Ga0070678_100147465 3300005456 Bacteria 1891
31 Ga0070662_100946847 3300005457 Bacteria 736
32 Ga0070681_10048340 3300005458 Bacteria 4251
33 Ga0070681_10161987 3300005458 Bacteria 2161
34 Ga0070706_100019286 3300005467 Bacteria 6291
35 Ga0070706_100099463 3300005467 Bacteria 2702
36 Ga0070706_100186834 3300005467 Bacteria 1936
37 Ga0070706_100236723 3300005467 Bacteria 1705
38 Ga0070707_100131735 3300005468 Bacteria 2431
39 Ga0070707_100735977 3300005468 Unclassified 949
40 Ga0070698_100000841 3300005471 Bacteria 33601
41 Ga0070699_100009321 3300005518 Bacteria 8501
42 Ga0070699_100292010 3300005518 Bacteria 1462
43 Ga0070697_100009032 3300005536 Bacteria 7786
44 Ga0070697_100011452 3300005536 Bacteria 6933
45 Ga0070697_100025698 3300005536 Bacteria 4698
46 Ga0070672_100025671 3300005543 Bacteria 4373
47 Ga0070672_100346604 3300005543 Bacteria 1265
48 Ga0070686_100404812 3300005544 Bacteria 1039
49 Ga0070695_100023779 3300005545 Bacteria 3772
50 Ga0070695_100034598 3300005545 Bacteria 3168
51 Ga0070696_100130556 3300005546 Unclassified 1828
52 Ga0070704_100224200 3300005549 Bacteria 1530
53 Ga0068855_100034822 3300005563 Bacteria 6002
54 Ga0070664_100099607 3300005564 Bacteria 2526
55 Ga0068852_100001183 3300005616 Bacteria 17290
56 Ga0068859_100943922 3300005617 Bacteria 946
57 Ga0068864_100034333 3300005618 Bacteria 4314
58 Ga0068864_100131726 3300005618 Bacteria 2247
59 Ga0068864_100133480 3300005618 Bacteria 2233
60 Ga0068864_100240809 3300005618 Bacteria 1676
61 Ga0068861_100158078 3300005719 Bacteria 1867
62 Ga0068851_10304699 3300005834 Bacteria 917
63 Ga0068863_100033174 3300005841 Bacteria 4918
64 Ga0068863_100161119 3300005841 Bacteria 2149
65 Ga0068858_100161605 3300005842 Bacteria 2109
66 Ga0068858_100170295 3300005842 Bacteria 2053
67 Ga0068860_100138732 3300005843 Bacteria 2336
68 Ga0068862_100011024 3300005844 Bacteria 7467
69 Ga0070717_10794815 3300006028 Bacteria 861
70 Ga0070712_100158713 3300006175 Bacteria 1745
71 Ga0097621_100127370 3300006237 Bacteria 2164
72 Ga0068871_100019491 3300006358 Bacteria 5180
73 Ga0068871_100049055 3300006358 Bacteria 3411
74 Ga0075428_100171288 3300006844 Bacteria 2353
75 Ga0075428_100747791 3300006844 Bacteria 1040
76 Ga0075433_10000073 3300006852 Bacteria 45023
77 Ga0075433_10039287 3300006852 Bacteria 4091
78 Ga0075433_10358645 3300006852 Bacteria 1288
79 Ga0075434_100001311 3300006871 Bacteria 20762
80 Ga0075434_100057918 3300006871 Unclassified 3851
81 Ga0075434_100813441 3300006871 Unclassified 950
82 Ga0068865_100203814 3300006881 Bacteria 1537
83 Ga0068865_100805279 3300006881 Unclassified 811
84 Ga0075436_100000482 3300006914 Bacteria 25785
85 Ga0075436_100002175 3300006914 Bacteria 13510
86 Ga0097620_100943667 3300006931 Bacteria 946
87 Ga0075435_100000033 3300007076 Bacteria 70531
88 Ga0075435_100194646 3300007076 Bacteria 1717
89 Ga0105240_10511205 3300009093 Bacteria 1334
90 Ga0111539_10546042 3300009094 Bacteria 1350
91 Ga0105245_10713886 3300009098 Bacteria 1036
92 Ga0114129_10000359 3300009147 Bacteria 52771
93 Ga0114129_10150113 3300009147 Bacteria 3190
94 Ga0114129_11078800 3300009147 Bacteria 1007
95 Ga0105242_10395101 3300009176 Bacteria 1289
96 Ga0105248_10096084 3300009177 Bacteria 3337
97 Ga0105248_10447589 3300009177 Bacteria 1455
98 Ga0105249_10115693 3300009553 Bacteria 2541
99 Ga0105239_10709115 3300010375 Bacteria 1151
100 Ga0157373_10310877 3300013100 Bacteria 1120
101 Ga0157369_10012287 3300013105 Bacteria 9726
102 Ga0163162_10158691 3300013306 Bacteria 2383
103 Ga0157375_10997888 3300013308 Bacteria 977
104 Ga0157375_11413309 3300013308 Bacteria 820
105 Ga0163163_10021705 3300014325 Bacteria 6064
106 Ga0157380_10208074 3300014326 Bacteria 1741
107 Ga0157377_10471879 3300014745 Bacteria 871
108 Ga0157379_10590750 3300014968 Bacteria 1036
109 Ga0163161_10498751 3300017792 Bacteria 991
110 Ga0213873_10019265 3300021358 Bacteria 1581
111 Ga0213874_10008981 3300021377 Bacteria 2455
112 Ga0213874_10012164 3300021377 Bacteria 2201
113 Ga0213876_10021492 3300021384 Bacteria 3411
114 Ga0213876_10029682 3300021384 Bacteria 2882
115 Ga0213876_10122923 3300021384 Bacteria 1378
116 Ga0213875_10000071 3300021388 Bacteria 120220
117 Ga0213875_10175307 3300021388 Bacteria 1007
118 Ga0207682_10005196 3300025893 Bacteria 5329
119 Ga0207699_10161582 3300025906 Bacteria 1491
120 Ga0207684_10000281 3300025910 Bacteria 74030
121 Ga0207684_10008170 3300025910 Bacteria 9321
122 Ga0207684_10023437 3300025910 Bacteria 5270
123 Ga0207684_10435271 3300025910 Bacteria 1126
124 Ga0207707_10026234 3300025912 Bacteria 5094
125 Ga0207695_10362874 3300025913 Bacteria 1335
126 Ga0207693_10117685 3300025915 Bacteria 2086
127 Ga0207663_10718792 3300025916 Bacteria 792
128 Ga0207663_10727521 3300025916 Bacteria 787
129 Ga0207646_10001761 3300025922 Bacteria 26230
130 Ga0207646_10045882 3300025922 Bacteria 3921
131 Ga0207646_10639797 3300025922 Unclassified 953
132 Ga0207681_10122109 3300025923 Bacteria 1912
133 Ga0207650_10059391 3300025925 Unclassified 2850
134 Ga0207650_10080513 3300025925 Bacteria 2470
135 Ga0207650_10170631 3300025925 Bacteria 1729
136 Ga0207650_10271075 3300025925 Bacteria 1379
137 Ga0207659_10330427 3300025926 Bacteria 1260
138 Ga0207664_10151230 3300025929 Bacteria 1972
139 Ga0207664_10547150 3300025929 Bacteria 1038
140 Ga0207644_10091934 3300025931 Bacteria 2263
141 Ga0207706_10257417 3300025933 Bacteria 1524
142 Ga0207670_10054314 3300025936 Bacteria 2703
143 Ga0207704_10225026 3300025938 Bacteria 1391
144 Ga0207691_10085373 3300025940 Bacteria 2833
145 Ga0207691_10096336 3300025940 Bacteria 2645
146 Ga0207711_10062445 3300025941 Bacteria 3213
147 Ga0207661_10227367 3300025944 Bacteria 1651
148 Ga0207661_10328370 3300025944 Bacteria 1376
149 Ga0207661_10625797 3300025944 Bacteria 989
150 Ga0207679_10082000 3300025945 Bacteria 2468
151 Ga0207667_10464916 3300025949 Bacteria 1285
152 Ga0207651_10629990 3300025960 Bacteria 940
153 Ga0207712_10058044 3300025961 Bacteria 2733
154 Ga0207712_10090766 3300025961 Bacteria 2249
155 Ga0207677_10095695 3300026023 Bacteria 2171
156 Ga0207677_10478902 3300026023 Bacteria 1072
157 Ga0207703_10153612 3300026035 Bacteria 2009
158 Ga0207703_10161378 3300026035 Bacteria 1963
159 Ga0207678_10009401 3300026067 Bacteria 8601
160 Ga0207678_10052143 3300026067 Bacteria 3531
161 Ga0207708_10377748 3300026075 Bacteria 1168
162 Ga0207641_10047385 3300026088 Bacteria 3625
163 Ga0207676_10158029 3300026095 Bacteria 1961
164 Ga0207676_10300498 3300026095 Bacteria 1465
165 Ga0207676_10468803 3300026095 Bacteria 1190
166 Ga0207674_10765055 3300026116 Bacteria 932
167 Ga0207675_100236248 3300026118 Bacteria 1765
168 Ga0207675_100575972 3300026118 Unclassified 1127
169 Ga0207675_101256029 3300026118 Bacteria 761
170 Ga0207683_10182563 3300026121 Bacteria 1903
171 Ga0207698_10002346 3300026142 Bacteria 11222
172 Ga0209588_1028657 3300027671 Bacteria 1773
173 Ga0268264_10268088 3300028381 Bacteria 1594
174 Ga0268264_10649023 3300028381 Bacteria 1044
175 Ga0265328_10045311 3300031239 Bacteria 1617
176 Ga0265327_10000233 3300031251 Bacteria 112052
177 Ga0265316_10000708 3300031344 Bacteria 36835
178 Ga0307508_10042936 3300031616 Bacteria 4053
179 Ga0307412_10119702 3300031911 Bacteria 1894
180 Ga0307412_10289470 3300031911 Bacteria 1290
181 Ga0307409_100908300 3300031995 Unclassified 895
182 Ga0307416_100126555 3300032002 Bacteria 2290
183 Ga0307411_10123087 3300032005 Unclassified 1881
184 Ga0373954_0002524 3300035118 Bacteria 7683
185 Ga0373956_0003815 3300035119 Bacteria 6060
186 Ga0373956_0140610 3300035119 Bacteria 1133
187 Ga0373956_0326838 3300035119 Bacteria 731
188 Ga0373955_0378239 3300035172 Bacteria 859
189 Ga0373924_0230563 3300035410 Bacteria 819
190 Ga0373931_0082822 3300035691 Bacteria 1774
191 Ga0373935_0438222 3300035692 Bacteria 942
192 Ga0373927_0000991 3300035695 Bacteria 21623
193 Ga0373927_0068608 3300035695 Bacteria 2294
194 Ga0373933_0034481 3300035724 Bacteria 2950
195 Ga0373933_0113464 3300035724 Bacteria 1692
196 Ga0373933_0346067 3300035724 Bacteria 965
197 Ga0373947_0003285 3300035725 Bacteria 9579
198 Ga0373947_0147509 3300035725 Bacteria 1513
199 Ga0373937_0192161 3300036401 Bacteria 1918
200 Ga0373937_0402875 3300036401 Bacteria 1298
201 Ga0373925_0004172 3300037068 Bacteria 10967
202 Ga0373925_0063746 3300037068 Bacteria 2773
203 Ga0395900_0444831 3300037418 Bacteria 1253
204 Ga0436364_0287205 3300037853 Bacteria 1966
205 Ga0436364_0346073 3300037853 Bacteria 8903
206 Ga0436364_0619304 3300037853 Bacteria 133320
207 Ga0436365_0731231 3300039437 Bacteria 2901
208 Ga0436365_1242399 3300039437 Bacteria 2582
209 Ga0436365_1529010 3300039437 Bacteria 14229
210 Ga0436363_0416829 3300039450 Bacteria 1089
211 Ga0436363_0664067 3300039450 Bacteria 4824
212 Ga0436362_0706010 3300039453 Bacteria 2449
213 Ga0436362_1007624 3300039453 Bacteria 2567
214 Ga0436362_1081802 3300039453 Bacteria 1550
215 Ga0439439_0117720 3300041406 Bacteria 739
216 Ga0439465_0156688 3300041413 Bacteria 815
217 Ga0439431_0105526 3300041997 Bacteria 777
218 Ga0450923_006198 3300042125 Bacteria 1970
219 Ga0439434_0048576 3300042435 Bacteria 1313
220 Ga0451577_0007286 3300042876 Bacteria 10897
221 Ga0451577_0393657 3300042876 Bacteria 1257
222 Ga0466966_0352228 3300044684 Bacteria 885
223 Ga0466963_0001754 3300044694 Bacteria 11820
224 Ga0466964_0247073 3300044706 Bacteria 878
225 Ga0466964_0257390 3300044706 Bacteria 863
226 Ga0453684_0014832 3300044712 Bacteria 12402
227 Ga0453684_0231971 3300044712 Bacteria 2130
228 Ga0453684_0729107 3300044712 Bacteria 1075
229 Ga0466971_0007828 3300044719 Bacteria 4656
230 Ga0466959_0085685 3300045049 Bacteria 2267
231 Ga0466959_0211541 3300045049 Bacteria 1347
232 Ga0466959_0298094 3300045049 Bacteria 1104
233 Ga0466959_0531322 3300045049 Bacteria 794
234 Ga0451576_0032048 3300045051 Bacteria 5601
235 Ga0451576_0108643 3300045051 Bacteria 2886
236 Ga0451576_0636636 3300045051 Bacteria 1120
237 Ga0466958_0067661 3300045836 Bacteria 2182
238 Ga0466967_0171531 3300045976 Bacteria 2041
239 Ga0466967_0209578 3300045976 Bacteria 1848
240 Ga0466967_0259448 3300045976 Bacteria 1663
241 Ga0466967_0332683 3300045976 Bacteria 1467
242 Ga0466967_0568241 3300045976 Bacteria 1117
243 Ga0495603_0000344 3300046455 Bacteria 24914
244 Ga0495629_0009459 3300046459 Bacteria 7129
245 Ga0495641_0024180 3300046461 Bacteria 3003
246 Ga0495580_0004017 3300046472 Bacteria 12417
247 Ga0495582_0001092 3300046473 Bacteria 15205
248 Ga0495639_0002038 3300046475 Bacteria 8942
249 Ga0495594_0000192 3300046499 Bacteria 29747
250 Ga0495608_0362740 3300046511 Bacteria 890
251 Ga0495666_0016384 3300046526 Bacteria 3691
252 Ga0495652_0370577 3300046529 Bacteria 1021
253 Ga0495622_0000726 3300046557 Bacteria 18659
254 Ga0495667_0081630 3300046559 Bacteria 2101
255 Ga0495634_0035276 3300046642 Bacteria 3427
256 Ga0495588_0088671 3300046674 Bacteria 1619
257 Ga0495647_0002439 3300046681 Bacteria 5862
258 Ga0495658_0001833 3300046683 Bacteria 10875
259 Ga0495658_0148575 3300046683 Unclassified 1438
260 Ga0495613_0000472 3300046689 Bacteria 34494
261 Ga0495581_0034789 3300047315 Bacteria 2915
262 Ga0495674_0721672 3300047319 Bacteria 781
263 Ga0495680_0013398 3300047322 Bacteria 7155
264 Ga0495593_0003072 3300047673 Bacteria 10050
265 Ga0495602_0237827 3300048088 Bacteria 1364
266 Ga0495614_0040070 3300048089 Bacteria 2011
267 Ga0496100_0076951 3300048903 Bacteria 2242
268 Ga0496100_0266529 3300048903 Bacteria 1272
269 Ga0496101_0031642 3300048904 Bacteria 3721
270 Ga0496102_0003374 3300048905 Bacteria 13536
271 Ga0496102_0254151 3300048905 Bacteria 1657
272 Ga0496102_0341982 3300048905 Bacteria 1409
273 Ga0496102_0366637 3300048905 Bacteria 1356
274 Ga0496103_0051478 3300048906 Bacteria 2549
275 Ga0496103_0466427 3300048906 Bacteria 809
276 Ga0496104_0124444 3300048907 Bacteria 2475
277 Ga0496104_0140155 3300048907 Bacteria 2323
278 Ga0496105_0267840 3300048908 Bacteria 1380
279 Ga0496106_0037829 3300048909 Bacteria 3610
280 Ga0496106_0495690 3300048909 Bacteria 981
281 Ga0496106_0877843 3300048909 Bacteria 709
282 Ga0496107_0117598 3300048910 Bacteria 1957
283 Ga0496109_0129533 3300048912 Bacteria 2354
284 Ga0496109_0207658 3300048912 Bacteria 1842
285 Ga0496109_0538358 3300048912 Bacteria 1102
286 Ga0496109_0938980 3300048912 Bacteria 803
287 Ga0496110_0015182 3300048913 Bacteria 6407
288 Ga0496110_0080662 3300048913 Bacteria 2900
289 Ga0496110_0681649 3300048913 Bacteria 929
290 Ga0496111_0048860 3300048914 Bacteria 3050
291 Ga0496111_0242621 3300048914 Bacteria 1338
292 Ga0496112_0049303 3300048915 Bacteria 4127
293 Ga0496112_0055206 3300048915 Bacteria 3905
294 Ga0496112_0204837 3300048915 Bacteria 1931
295 Ga0496113_0089447 3300048916 Bacteria 2370
296 Ga0496114_0176252 3300048917 Bacteria 1865
297 Ga0496115_0131372 3300048918 Bacteria 2064
298 Ga0496119_0041343 3300048922 Bacteria 2937
299 Ga0496121_0070737 3300048924 Bacteria 2809
300 Ga0496124_0000004 3300048927 Bacteria 976131
301 Ga0501031_0284597 3300049568 Unclassified 1072
302 Ga0501042_0121494 3300049578 Unclassified 1881
303 Ga0501072_0292796 3300049588 Bacteria 1294
304 Ga0501074_0133761 3300049590 Bacteria 1774
305 Ga0501079_0167301 3300049741 Bacteria 1714
306 Ga0501081_0013003 3300049743 Bacteria 5475
307 Ga0501282_000996 3300049778 Bacteria 3209
308 nmdc:mga00v17_64480_c1 3300050491 Bacteria 2257
309 nmdc:mga05p37_122373_c1 3300050507 Bacteria 3195
310 nmdc:mga05p37_420098_c1 3300050507 Bacteria 1556
311 nmdc:mga05p37_59215_c1 3300050507 Bacteria 4717
312 nmdc:mga0n895_164_c1 3300050512 Bacteria 40868
313 nmdc:mga0n895_310460_c1 3300050512 Unclassified 1598
314 nmdc:mga0rr50_31649_c1 3300050513 Bacteria 3761
315 nmdc:mga08x19_12920_c1 3300050514 Bacteria 5040
316 nmdc:mga08x19_1704_c1 3300050514 Bacteria 13531
317 nmdc:mga08x19_232746_c1 3300050514 Bacteria 1268
318 nmdc:mga0a205_124651_c1 3300050515 Bacteria 2476
319 nmdc:mga0a205_352238_c1 3300050515 Bacteria 1339
320 nmdc:mga0a205_93_c1 3300050515 Bacteria 13196
321 Ga0495619_0029379 3300053085 Bacteria 3550
322 Ga0501084_0667795 3300054114 Bacteria 877
323 Ga0590071_000052 3300059421 Bacteria 30813
324 Ga0590074_001649 3300059423 Bacteria 3638
325 Ga0590075_003254 3300059424 Bacteria 3872
326 Ga0590077_000533 3300059426 Bacteria 10520
327 Ga0501082_0701113 3300060353 Bacteria 886
328 2745169231 2744054657 Bacteria 5016802
329 2817478870 2816332295 Bacteria 4352468
330 2817617131 2816332336 Bacteria 5207640
331 2857547412 2857542790 Bacteria 5326616
332 2904492825 2904490793 Bacteria 7046938
333 8022793483 8022792930 Bacteria 5693794
334 8057977663 8057977335 Bacteria 5694872
335 Ga0466963_0224735
336 Ga0070670_100131860
337 Ga0070670_100263039
338 Ga0068869_100224965
339 Ga0068868_100072496
340 Ga0068868_100491822
341 Ga0068868_100550273
342 Ga0070689_100074371
343 Ga0070692_10000405
344 Ga0070669_100063337
345 Ga0070671_100075853
346 Ga0070673_100055632
347 Ga0070673_100343504
348 Ga0070688_100164842
349 Ga0070667_100419228
350 Ga0070667_100460913
351 Ga0070714_100337246
352 Ga0070714_100992806
353 Ga0070710_10185354
354 Ga0070711_100266504
355 Ga0070700_100356563
356 Ga0070694_100051431
357 Ga0070694_100407154
358 Ga0070708_100002892
359 Ga0070708_100159191
360 Ga0070708_100177710
361 Ga0070708_100237674
362 Ga0070663_100012500
363 Ga0070663_100076764
364 Ga0070678_100147465
365 Ga0070662_100946847
366 Ga0070681_10048340
367 Ga0070681_10161987
368 Ga0070706_100019286
369 Ga0070706_100099463
370 Ga0070706_100186834
371 Ga0070706_100236723
372 Ga0070707_100131735
373 Ga0070707_100735977
374 Ga0070698_100000841
375 Ga0070699_100009321
376 Ga0070699_100292010
377 Ga0070697_100009032
378 Ga0070697_100011452
379 Ga0070697_100025698
380 Ga0070672_100025671
381 Ga0070672_100346604
382 Ga0070686_100404812
383 Ga0070695_100023779
384 Ga0070695_100034598
385 Ga0070696_100130556
386 Ga0070704_100224200
387 Ga0068855_100034822
388 Ga0070664_100099607
389 Ga0068852_100001183
390 Ga0068859_100943922
391 Ga0068864_100034333
392 Ga0068864_100131726
393 Ga0068864_100133480
394 Ga0068864_100240809
395 Ga0068861_100158078
396 Ga0068851_10304699
397 Ga0068863_100033174
398 Ga0068863_100161119
399 Ga0068858_100161605
400 Ga0068858_100170295
401 Ga0068860_100138732
402 Ga0068862_100011024
403 Ga0070717_10794815
404 Ga0070712_100158713
405 Ga0097621_100127370
406 Ga0068871_100019491
407 Ga0068871_100049055
408 Ga0075428_100171288
409 Ga0075428_100747791
410 Ga0075433_10000073
411 Ga0075433_10039287
412 Ga0075433_10358645
413 Ga0075434_100001311
414 Ga0075434_100057918
415 Ga0075434_100813441
416 Ga0068865_100203814
417 Ga0068865_100805279
418 Ga0075436_100000482
419 Ga0075436_100002175
420 Ga0097620_100943667
421 Ga0075435_100000033
422 Ga0075435_100194646
423 Ga0105240_10511205
424 Ga0111539_10546042
425 Ga0105245_10713886
426 Ga0114129_10000359
427 Ga0114129_10150113
428 Ga0114129_11078800
429 Ga0105242_10395101
430 Ga0105248_10096084
431 Ga0105248_10447589
432 Ga0105249_10115693
433 Ga0105239_10709115
434 Ga0157373_10310877
435 Ga0157369_10012287
436 Ga0163162_10158691
437 Ga0157375_10997888
438 Ga0157375_11413309
439 Ga0163163_10021705
440 Ga0157380_10208074
441 Ga0157377_10471879
442 Ga0157379_10590750
443 Ga0163161_10498751
444 Ga0213873_10019265
445 Ga0213874_10008981
446 Ga0213874_10012164
447 Ga0213876_10021492
448 Ga0213876_10029682
449 Ga0213876_10122923
450 Ga0213875_10000071
451 Ga0213875_10175307
452 Ga0207682_10005196
453 Ga0207699_10161582
454 Ga0207684_10000281
455 Ga0207684_10008170
456 Ga0207684_10023437
457 Ga0207684_10435271
458 Ga0207707_10026234
459 Ga0207695_10362874
460 Ga0207693_10117685
461 Ga0207663_10718792
462 Ga0207663_10727521
463 Ga0207646_10001761
464 Ga0207646_10045882
465 Ga0207646_10639797
466 Ga0207681_10122109
467 Ga0207650_10059391
468 Ga0207650_10080513
469 Ga0207650_10170631
470 Ga0207650_10271075
471 Ga0207659_10330427
472 Ga0207664_10151230
473 Ga0207664_10547150
474 Ga0207644_10091934
475 Ga0207706_10257417
476 Ga0207670_10054314
477 Ga0207704_10225026
478 Ga0207691_10085373
479 Ga0207691_10096336
480 Ga0207711_10062445
481 Ga0207661_10227367
482 Ga0207661_10328370
483 Ga0207661_10625797
484 Ga0207679_10082000
485 Ga0207667_10464916
486 Ga0207651_10629990
487 Ga0207712_10058044
488 Ga0207712_10090766
489 Ga0207677_10095695
490 Ga0207677_10478902
491 Ga0207703_10153612
492 Ga0207703_10161378
493 Ga0207678_10009401
494 Ga0207678_10052143
495 Ga0207708_10377748
496 Ga0207641_10047385
497 Ga0207676_10158029
498 Ga0207676_10300498
499 Ga0207676_10468803
500 Ga0207674_10765055
501 Ga0207675_100236248
502 Ga0207675_100575972
503 Ga0207675_101256029
504 Ga0207683_10182563
505 Ga0207698_10002346
506 Ga0209588_1028657
507 Ga0268264_10268088
508 Ga0268264_10649023
509 Ga0265328_10045311
510 Ga0265327_10000233
511 Ga0265316_10000708
512 Ga0307508_10042936
513 Ga0307412_10119702
514 Ga0307412_10289470
515 Ga0307409_100908300
516 Ga0307416_100126555
517 Ga0307411_10123087
518 Ga0373954_0002524
519 Ga0373956_0003815
520 Ga0373956_0140610
521 Ga0373956_0326838
522 Ga0373955_0378239
523 Ga0373924_0230563
524 Ga0373931_0082822
525 Ga0373935_0438222
526 Ga0373927_0000991
527 Ga0373927_0068608
528 Ga0373933_0034481
529 Ga0373933_0113464
530 Ga0373933_0346067
531 Ga0373947_0003285
532 Ga0373947_0147509
533 Ga0373937_0192161
534 Ga0373937_0402875
535 Ga0373925_0004172
536 Ga0373925_0063746
537 Ga0395900_0444831
538 Ga0436364_0287205
539 Ga0436364_0346073
540 Ga0436364_0619304
541 Ga0436365_0731231
542 Ga0436365_1242399
543 Ga0436365_1529010
544 Ga0436363_0416829
545 Ga0436363_0664067
546 Ga0436362_0706010
547 Ga0436362_1007624
548 Ga0436362_1081802
549 Ga0439439_0117720
550 Ga0439465_0156688
551 Ga0439431_0105526
552 Ga0450923_006198
553 Ga0439434_0048576
554 Ga0451577_0007286
555 Ga0451577_0393657
556 Ga0466966_0352228
557 Ga0466963_0001754
558 Ga0466964_0247073
559 Ga0466964_0257390
560 Ga0453684_0014832
561 Ga0453684_0231971
562 Ga0453684_0729107
563 Ga0466971_0007828
564 Ga0466959_0085685
565 Ga0466959_0211541
566 Ga0466959_0298094
567 Ga0466959_0531322
568 Ga0451576_0032048
569 Ga0451576_0108643
570 Ga0451576_0636636
571 Ga0466958_0067661
572 Ga0466967_0171531
573 Ga0466967_0209578
574 Ga0466967_0259448
575 Ga0466967_0332683
576 Ga0466967_0568241
577 Ga0495603_0000344
578 Ga0495629_0009459
579 Ga0495641_0024180
580 Ga0495580_0004017
581 Ga0495582_0001092
582 Ga0495639_0002038
583 Ga0495594_0000192
584 Ga0495608_0362740
585 Ga0495666_0016384
586 Ga0495652_0370577
587 Ga0495622_0000726
588 Ga0495667_0081630
589 Ga0495634_0035276
590 Ga0495588_0088671
591 Ga0495647_0002439
592 Ga0495658_0001833
593 Ga0495658_0148575
594 Ga0495613_0000472
595 Ga0495581_0034789
596 Ga0495674_0721672
597 Ga0495680_0013398
598 Ga0495593_0003072
599 Ga0495602_0237827
600 Ga0495614_0040070
601 Ga0496100_0076951
602 Ga0496100_0266529
603 Ga0496101_0031642
604 Ga0496102_0003374
605 Ga0496102_0254151
606 Ga0496102_0341982
607 Ga0496102_0366637
608 Ga0496103_0051478
609 Ga0496103_0466427
610 Ga0496104_0124444
611 Ga0496104_0140155
612 Ga0496105_0267840
613 Ga0496106_0037829
614 Ga0496106_0495690
615 Ga0496106_0877843
616 Ga0496107_0117598
617 Ga0496109_0129533
618 Ga0496109_0207658
619 Ga0496109_0538358
620 Ga0496109_0938980
621 Ga0496110_0015182
622 Ga0496110_0080662
623 Ga0496110_0681649
624 Ga0496111_0048860
625 Ga0496111_0242621
626 Ga0496112_0049303
627 Ga0496112_0055206
628 Ga0496112_0204837
629 Ga0496113_0089447
630 Ga0496114_0176252
631 Ga0496115_0131372
632 Ga0496119_0041343
633 Ga0496121_0070737
634 Ga0496124_0000004
635 Ga0501031_0284597
636 Ga0501042_0121494
637 Ga0501072_0292796
638 Ga0501074_0133761
639 Ga0501079_0167301
640 Ga0501081_0013003
641 Ga0501282_000996
642 nmdc:mga00v17_64480_c1
643 nmdc:mga05p37_122373_c1
644 nmdc:mga05p37_420098_c1
645 nmdc:mga05p37_59215_c1
646 nmdc:mga0n895_164_c1
647 nmdc:mga0n895_310460_c1
648 nmdc:mga0rr50_31649_c1
649 nmdc:mga08x19_12920_c1
650 nmdc:mga08x19_1704_c1
651 nmdc:mga08x19_232746_c1
652 nmdc:mga0a205_124651_c1
653 nmdc:mga0a205_352238_c1
654 nmdc:mga0a205_93_c1
655 Ga0495619_0029379
656 Ga0501084_0667795
657 Ga0590071_000052
658 Ga0590074_001649
659 Ga0590075_003254
660 Ga0590077_000533
661 Ga0501082_0701113
662 2745169231
663 2817478870
664 2817617131
665 2857547412
666 2904492825
667 8022793483
668 8057977663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9196 8 203
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.908 6 203
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9069 7 203
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9053 1 203
7lav-assembly1.cif.gz_A pseudomonas fluorescens g150t isocyanide hydratase (g150t-1) at 274k, refmac5-refined 0.8996 7 203
ID Description Score Start End Superfamily
4k2hC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8926 7 203 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8897 1 203 3.40.50.880
4k2hC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8745 7 203 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8707 44 203 3.40.50.880
af_O88767_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8622 4 201 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A534XWN7-F1-model_v4 DJ-1/PfpI family protein 0.977 2 130 GO:0006355
AF-A0A2L1UBL2-F1-model_v4 Transcriptional regulator 0.9658 1 116 GO:0006355
AF-A0A2U3QJL4-F1-model_v4 Amidase and AraC-type DNA-binding HTH domain-containing transcriptional regulator 0.9645 6 217 GO:0003677
GO:0006355
AF-A0A257XAH1-F1-model_v4 Peptidase 0.9639 27 219 GO:0006355
AF-A0A1B3LHZ3-F1-model_v4 Amidotransferase family protein 0.9623 1 225 GO:0006355
GO:0016740

Map