F411831

General Info

Members Datasets Scaffolds Average Seq Length
334 150 668 194

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10360052|Ga0207668_103600522
Length 184
Sequence MMTNDFMLGGVYLLMAIMLVLGGLMIRRERAAKLLTMGLAWVAIFAAGFVLFTFRDNLGWVAQRLKAEAIGTPVEEGRETRIPMAIDGHFWVTAKVNGHDVKFLVDSGATTTTIDEQRDRYVRTGNGVIRVASGRANELTVGGIRRHDVALEIADNDDLNVLGMNYLSSLRRWGVEGRWLVLVA

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
145 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
148 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
149 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10360052 3300025972 Bacteria 1219
2 JGI24736J21556_1031951 3300001904 Unclassified 813
3 JGI24741J21665_1014139 3300001915 Bacteria 1339
4 JGI24741J21665_1026555 3300001915 Unclassified 881
5 JGI24740J21852_10003295 3300001979 Bacteria 7118
6 JGI24740J21852_10013624 3300001979 Bacteria 3026
7 JGI24740J21852_10077226 3300001979 Bacteria 879
8 JGI24737J22298_10003831 3300001990 Bacteria 5289
9 JGI24737J22298_10059607 3300001990 Bacteria 1150
10 JGI24735J21928_10020069 3300002067 Bacteria 2049
11 JGI24735J21928_10100671 3300002067 Unclassified 830
12 rootH1_10057658 3300003323 Bacteria 1244
13 Ga0065715_10262006 3300005293 Bacteria 1135
14 Ga0070658_10164537 3300005327 Bacteria 1862
15 Ga0070658_10264471 3300005327 Bacteria 1461
16 Ga0070658_10441698 3300005327 Bacteria 1120
17 Ga0070658_10680842 3300005327 Unclassified 892
18 Ga0070676_10405191 3300005328 Bacteria 950
19 Ga0070683_100049157 3300005329 Bacteria 3900
20 Ga0070670_100021122 3300005331 Bacteria 5600
21 Ga0070670_100047885 3300005331 Bacteria 3679
22 Ga0070670_100066971 3300005331 Bacteria 3082
23 Ga0070677_10036381 3300005333 Bacteria 1915
24 Ga0070666_10102783 3300005335 Bacteria 1971
25 Ga0070680_100012389 3300005336 Bacteria 6623
26 Ga0070660_100003814 3300005339 Bacteria 10414
27 Ga0070660_100125353 3300005339 Bacteria 2052
28 Ga0070660_100156366 3300005339 Bacteria 1835
29 Ga0070660_100284898 3300005339 Bacteria 1352
30 Ga0070661_101136173 3300005344 Bacteria 652
31 Ga0070668_100288720 3300005347 Bacteria 1372
32 Ga0070669_100335463 3300005353 Bacteria 1224
33 Ga0070671_100107889 3300005355 Bacteria 2338
34 Ga0070671_100221823 3300005355 Bacteria 1604
35 Ga0070674_100011935 3300005356 Bacteria 5313
36 Ga0070673_100684996 3300005364 Bacteria 940
37 Ga0070659_100001983 3300005366 Bacteria 14621
38 Ga0070659_100051382 3300005366 Bacteria 3241
39 Ga0070667_100069523 3300005367 Bacteria 2996
40 Ga0070714_100526328 3300005435 Unclassified 1130
41 Ga0070714_100562154 3300005435 Bacteria 1093
42 Ga0070713_100047972 3300005436 Bacteria 3514
43 Ga0070663_100027142 3300005455 Bacteria 3884
44 Ga0070678_100266322 3300005456 Bacteria 1443
45 Ga0070662_100051014 3300005457 Bacteria 2986
46 Ga0070662_100126430 3300005457 Bacteria 1965
47 Ga0070662_100758757 3300005457 Bacteria 823
48 Ga0070681_11024156 3300005458 Bacteria 746
49 Ga0068853_100003839 3300005539 Bacteria 11512
50 Ga0070672_100231580 3300005543 Bacteria 1552
51 Ga0070665_100136625 3300005548 Bacteria 2455
52 Ga0068855_100034695 3300005563 Bacteria 6013
53 Ga0070664_100004536 3300005564 Bacteria 11144
54 Ga0070664_100031376 3300005564 Bacteria 4439
55 Ga0068857_100111095 3300005577 Bacteria 2464
56 Ga0068857_100514043 3300005577 Bacteria 1125
57 Ga0068854_100031332 3300005578 Bacteria 3694
58 Ga0068854_100037784 3300005578 Bacteria 3391
59 Ga0068854_100070030 3300005578 Bacteria 2563
60 Ga0068854_100087279 3300005578 Bacteria 2314
61 Ga0068854_100424649 3300005578 Bacteria 1105
62 Ga0068856_100066903 3300005614 Bacteria 3551
63 Ga0068856_100449317 3300005614 Unclassified 1310
64 Ga0068856_100773886 3300005614 Bacteria 980
65 Ga0068852_100785846 3300005616 Unclassified 965
66 Ga0068852_100914322 3300005616 Bacteria 895
67 Ga0068859_100092743 3300005617 Bacteria 3072
68 Ga0068859_100241282 3300005617 Bacteria 1896
69 Ga0068864_100046769 3300005618 Bacteria 3714
70 Ga0068864_100095365 3300005618 Bacteria 2631
71 Ga0068851_10011863 3300005834 Bacteria 4097
72 Ga0068851_10433080 3300005834 Bacteria 779
73 Ga0068863_100004579 3300005841 Bacteria 13637
74 Ga0068858_100728100 3300005842 Bacteria 966
75 Ga0068860_100888138 3300005843 Bacteria 907
76 Ga0070717_10002916 3300006028 Bacteria 12148
77 Ga0070712_100003207 3300006175 Bacteria 10080
78 Ga0068871_100008298 3300006358 Bacteria 7465
79 Ga0097620_100092739 3300006931 Bacteria 3072
80 Ga0097620_100241285 3300006931 Bacteria 1896
81 Ga0105240_10104447 3300009093 Bacteria 3440
82 Ga0105241_10130326 3300009174 Bacteria 2035
83 Ga0105248_10048697 3300009177 Bacteria 4753
84 Ga0105248_10100063 3300009177 Bacteria 3266
85 Ga0105237_10053836 3300009545 Bacteria 4035
86 Ga0105238_10020608 3300009551 Bacteria 6716
87 Ga0105246_10127978 3300011119 Bacteria 1892
88 Ga0157325_1003148 3300012485 Bacteria 891
89 Ga0157373_10007643 3300013100 Bacteria 8029
90 Ga0157373_10425044 3300013100 Bacteria 954
91 Ga0157370_10029822 3300013104 Bacteria 5348
92 Ga0157370_10569706 3300013104 Bacteria 1038
93 Ga0157370_11055005 3300013104 Unclassified 735
94 Ga0157369_10878422 3300013105 Unclassified 920
95 Ga0157372_10140991 3300013307 Bacteria 2777
96 Ga0157372_10142761 3300013307 Bacteria 2760
97 Ga0163163_10043207 3300014325 Bacteria 4418
98 Ga0157380_10012604 3300014326 Bacteria 6134
99 Ga0206354_11015787 3300020081 Bacteria 696
100 Ga0207697_10043671 3300025315 Bacteria 1843
101 Ga0207656_10013135 3300025321 Bacteria 3159
102 Ga0207682_10001759 3300025893 Bacteria 9943
103 Ga0207688_10492350 3300025901 Bacteria 767
104 Ga0207647_10000793 3300025904 Bacteria 24512
105 Ga0207647_10008873 3300025904 Bacteria 7171
106 Ga0207647_10010434 3300025904 Bacteria 6562
107 Ga0207647_10096735 3300025904 Unclassified 1756
108 Ga0207645_10480979 3300025907 Bacteria 840
109 Ga0207705_10015182 3300025909 Bacteria 5534
110 Ga0207705_10015589 3300025909 Bacteria 5456
111 Ga0207705_10045221 3300025909 Bacteria 3164
112 Ga0207705_10142356 3300025909 Unclassified 1791
113 Ga0207705_10756758 3300025909 Bacteria 755
114 Ga0207707_10789609 3300025912 Bacteria 792
115 Ga0207695_10048417 3300025913 Bacteria 4489
116 Ga0207671_10109196 3300025914 Bacteria 2103
117 Ga0207660_10002713 3300025917 Bacteria 11600
118 Ga0207660_10089964 3300025917 Bacteria 2273
119 Ga0207660_10553562 3300025917 Bacteria 936
120 Ga0207657_10000157 3300025919 Bacteria 69693
121 Ga0207657_10046383 3300025919 Bacteria 3806
122 Ga0207657_10056785 3300025919 Bacteria 3376
123 Ga0207657_10118987 3300025919 Bacteria 2174
124 Ga0207657_10163089 3300025919 Bacteria 1809
125 Ga0207657_10294414 3300025919 Unclassified 1287
126 Ga0207649_10049191 3300025920 Bacteria 2602
127 Ga0207649_10063694 3300025920 Bacteria 2329
128 Ga0207652_10110953 3300025921 Bacteria 2432
129 Ga0207652_10342553 3300025921 Bacteria 1349
130 Ga0207681_10022762 3300025923 Bacteria 4000
131 Ga0207681_10446519 3300025923 Bacteria 1052
132 Ga0207694_10190110 3300025924 Bacteria 1667
133 Ga0207650_10101659 3300025925 Bacteria 2214
134 Ga0207650_10187127 3300025925 Bacteria 1652
135 Ga0207659_10011817 3300025926 Bacteria 5528
136 Ga0207700_10032823 3300025928 Bacteria 3708
137 Ga0207664_10010990 3300025929 Bacteria 6411
138 Ga0207664_10020756 3300025929 Bacteria 4875
139 Ga0207664_10265212 3300025929 Bacteria 1503
140 Ga0207664_10746787 3300025929 Unclassified 880
141 Ga0207644_10086691 3300025931 Bacteria 2325
142 Ga0207690_10000593 3300025932 Bacteria 23445
143 Ga0207690_10125280 3300025932 Bacteria 1872
144 Ga0207690_10218094 3300025932 Unclassified 1458
145 Ga0207690_10796246 3300025932 Bacteria 781
146 Ga0207706_10013139 3300025933 Bacteria 7533
147 Ga0207706_10033929 3300025933 Bacteria 4542
148 Ga0207706_10071833 3300025933 Bacteria 3044
149 Ga0207669_10320299 3300025937 Bacteria 1186
150 Ga0207691_10308030 3300025940 Bacteria 1360
151 Ga0207661_10043126 3300025944 Bacteria 3559
152 Ga0207661_10104647 3300025944 Bacteria 2383
153 Ga0207679_10448705 3300025945 Bacteria 1143
154 Ga0207667_10463118 3300025949 Bacteria 1287
155 Ga0207667_10557749 3300025949 Bacteria 1158
156 Ga0207651_10110469 3300025960 Bacteria 2062
157 Ga0207651_10810684 3300025960 Bacteria 830
158 Ga0207668_10323094 3300025972 Bacteria 1281
159 Ga0207640_10008389 3300025981 Bacteria 5744
160 Ga0207640_10148187 3300025981 Bacteria 1721
161 Ga0207640_10255303 3300025981 Bacteria 1363
162 Ga0207703_10597259 3300026035 Bacteria 1044
163 Ga0207639_10055951 3300026041 Bacteria 3021
164 Ga0207678_10001853 3300026067 Bacteria 19325
165 Ga0207678_10094375 3300026067 Bacteria 2556
166 Ga0207678_10418069 3300026067 Bacteria 1162
167 Ga0207678_10473793 3300026067 Bacteria 1090
168 Ga0207702_10095503 3300026078 Bacteria 2612
169 Ga0207702_10170219 3300026078 Bacteria 1997
170 Ga0207702_10350974 3300026078 Unclassified 1412
171 Ga0207641_10061485 3300026088 Bacteria 3203
172 Ga0207676_10060067 3300026095 Bacteria 3005
173 Ga0207674_10000139 3300026116 Bacteria 84273
174 Ga0207674_10001776 3300026116 Bacteria 27533
175 Ga0207683_10508903 3300026121 Bacteria 1112
176 Ga0207698_10400048 3300026142 Bacteria 1312
177 Ga0207698_10413685 3300026142 Unclassified 1292
178 Ga0207698_10870469 3300026142 Bacteria 907
179 Ga0268266_10724949 3300028379 Bacteria 959
180 Ga0307405_10036770 3300031731 Bacteria 2937
181 Ga0307413_10111200 3300031824 Bacteria 1834
182 Ga0307410_10009074 3300031852 Bacteria 5557
183 Ga0307406_10142287 3300031901 Bacteria 1700
184 Ga0307407_10125260 3300031903 Bacteria 1635
185 Ga0307412_10179029 3300031911 Bacteria 1592
186 Ga0307412_10237250 3300031911 Bacteria 1408
187 Ga0307409_100004257 3300031995 Bacteria 7993
188 Ga0307409_100035158 3300031995 Bacteria 3668
189 Ga0307409_100272873 3300031995 Bacteria 1558
190 Ga0307416_100026600 3300032002 Bacteria 4266
191 Ga0307416_100112566 3300032002 Bacteria 2402
192 Ga0307411_10000215 3300032005 Bacteria 18597
193 Ga0307411_10070617 3300032005 Bacteria 2364
194 Ga0307411_10205711 3300032005 Bacteria 1515
195 Ga0307411_10576865 3300032005 Bacteria 964
196 Ga0307415_100060874 3300032126 Bacteria 2611
197 Ga0307415_100132721 3300032126 Bacteria 1888
198 Ga0373943_0003470 3300035170 Bacteria 7170
199 Ga0373927_0097148 3300035695 Bacteria 1915
200 Ga0395899_0002059 3300037312 Bacteria 16550
201 Ga0395899_0005719 3300037312 Bacteria 9649
202 Ga0395899_0044646 3300037312 Bacteria 3302
203 Ga0395899_0088159 3300037312 Bacteria 2251
204 Ga0395899_0104052 3300037312 Bacteria 2046
205 Ga0395899_0116333 3300037312 Bacteria 1918
206 Ga0395899_0130315 3300037312 Bacteria 1796
207 Ga0395899_0136774 3300037312 Bacteria 1746
208 Ga0395899_0142418 3300037312 Bacteria 1705
209 Ga0395899_0319899 3300037312 Bacteria 1045
210 Ga0395899_0376372 3300037312 Bacteria 944
211 Ga0395900_0000449 3300037418 Bacteria 58912
212 Ga0395900_0000814 3300037418 Bacteria 41259
213 Ga0395900_0012091 3300037418 Bacteria 8821
214 Ga0395900_0017493 3300037418 Bacteria 7315
215 Ga0395900_0024061 3300037418 Bacteria 6233
216 Ga0395900_0035520 3300037418 Bacteria 5134
217 Ga0395900_0036538 3300037418 Bacteria 5064
218 Ga0395900_0080035 3300037418 Bacteria 3358
219 Ga0395900_0087188 3300037418 Bacteria 3208
220 Ga0395900_0087227 3300037418 Bacteria 3207
221 Ga0395900_0104244 3300037418 Bacteria 2914
222 Ga0395900_0132076 3300037418 Bacteria 2558
223 Ga0395900_0170601 3300037418 Bacteria 2215
224 Ga0395900_0187582 3300037418 Bacteria 2099
225 Ga0395900_0197818 3300037418 Bacteria 2035
226 Ga0395900_0232215 3300037418 Bacteria 1854
227 Ga0395900_0241450 3300037418 Bacteria 1812
228 Ga0395900_0311364 3300037418 Bacteria 1558
229 Ga0395900_0331466 3300037418 Bacteria 1500
230 Ga0395900_0526342 3300037418 Bacteria 1129
231 Ga0395900_0568506 3300037418 Bacteria 1077
232 Ga0395900_0973588 3300037418 Unclassified 769
233 Ga0395900_1459495 3300037418 Bacteria 596
234 Ga0395900_1523530 3300037418 Unclassified 580
235 Ga0395898_0001564 3300037466 Bacteria 31366
236 Ga0395898_0070356 3300037466 Bacteria 3383
237 Ga0395898_0082624 3300037466 Bacteria 3096
238 Ga0395898_0167932 3300037466 Bacteria 2098
239 Ga0395898_0175518 3300037466 Bacteria 2048
240 Ga0395898_0268692 3300037466 Bacteria 1626
241 Ga0395898_0274062 3300037466 Bacteria 1609
242 Ga0395898_0329481 3300037466 Bacteria 1456
243 Ga0395898_0402708 3300037466 Bacteria 1305
244 Ga0395898_0423193 3300037466 Bacteria 1269
245 Ga0395898_0472235 3300037466 Unclassified 1193
246 Ga0395898_0532833 3300037466 Bacteria 1116
247 Ga0395898_0641064 3300037466 Bacteria 1005
248 Ga0395905_0000434 3300037471 Bacteria 58335
249 Ga0395905_0002589 3300037471 Bacteria 19894
250 Ga0395905_0007179 3300037471 Bacteria 11125
251 Ga0395905_0008954 3300037471 Bacteria 9824
252 Ga0395905_0011336 3300037471 Bacteria 8620
253 Ga0395905_0017679 3300037471 Bacteria 6768
254 Ga0395905_0018900 3300037471 Bacteria 6535
255 Ga0395905_0033515 3300037471 Bacteria 4823
256 Ga0395905_0046695 3300037471 Bacteria 4060
257 Ga0395905_0065149 3300037471 Bacteria 3411
258 Ga0395905_0087778 3300037471 Bacteria 2916
259 Ga0395905_0099231 3300037471 Bacteria 2735
260 Ga0395905_0103951 3300037471 Bacteria 2666
261 Ga0395905_0153705 3300037471 Bacteria 2164
262 Ga0395905_0160214 3300037471 Bacteria 2115
263 Ga0395905_0196758 3300037471 Bacteria 1890
264 Ga0395905_0237740 3300037471 Bacteria 1702
265 Ga0395905_0269191 3300037471 Bacteria 1589
266 Ga0395905_0409048 3300037471 Bacteria 1252
267 Ga0395905_0423010 3300037471 Bacteria 1228
268 Ga0395905_0525022 3300037471 Bacteria 1084
269 Ga0395905_0928623 3300037471 Bacteria 773
270 Ga0395905_1599166 3300037471 Unclassified 556
271 Ga0395901_0016711 3300038443 Bacteria 7476
272 Ga0395901_0018456 3300038443 Bacteria 7120
273 Ga0395901_0027738 3300038443 Bacteria 5822
274 Ga0395901_0032158 3300038443 Bacteria 5414
275 Ga0395901_0032196 3300038443 Bacteria 5411
276 Ga0395901_0059384 3300038443 Bacteria 3978
277 Ga0395901_0076847 3300038443 Bacteria 3484
278 Ga0395901_0082622 3300038443 Bacteria 3356
279 Ga0395901_0104441 3300038443 Bacteria 2973
280 Ga0395901_0116121 3300038443 Bacteria 2811
281 Ga0395901_0137843 3300038443 Bacteria 2564
282 Ga0395901_0154685 3300038443 Bacteria 2409
283 Ga0395901_0162069 3300038443 Bacteria 2349
284 Ga0395901_0164502 3300038443 Bacteria 2329
285 Ga0395901_0201005 3300038443 Bacteria 2089
286 Ga0395901_0264802 3300038443 Bacteria 1788
287 Ga0395901_0270882 3300038443 Bacteria 1766
288 Ga0395901_0279724 3300038443 Bacteria 1734
289 Ga0395901_0440024 3300038443 Bacteria 1334
290 Ga0395901_0541125 3300038443 Bacteria 1181
291 Ga0395901_0593514 3300038443 Bacteria 1117
292 Ga0439448_0027168 3300042005 Bacteria 1802
293 Ga0439449_0050032 3300042007 Bacteria 1546
294 Ga0439458_0004534 3300042157 Bacteria 3182
295 Ga0439458_0009202 3300042157 Bacteria 2200
296 Ga0466969_0187197 3300044656 Bacteria 947
297 Ga0466972_0020500 3300044658 Bacteria 3303
298 Ga0466966_0023978 3300044684 Bacteria 3993
299 Ga0466966_0057715 3300044684 Bacteria 2454
300 Ga0466961_0169920 3300044693 Bacteria 1356
301 Ga0466963_0000126 3300044694 Bacteria 28872
302 Ga0466963_0104880 3300044694 Bacteria 1937
303 Ga0466964_0272372 3300044706 Bacteria 843
304 Ga0466964_0339211 3300044706 Bacteria 769
305 Ga0466971_0057474 3300044719 Bacteria 1755
306 Ga0466971_0173795 3300044719 Bacteria 1011
307 Ga0466957_0075520 3300044842 Bacteria 2091
308 Ga0466957_0550400 3300044842 Unclassified 804
309 Ga0466959_0005875 3300045049 Bacteria 8453
310 Ga0466959_0070201 3300045049 Bacteria 2538
311 Ga0466958_0030574 3300045836 Bacteria 3200
312 Ga0466967_0000114 3300045976 Bacteria 29801
313 Ga0466967_0062357 3300045976 Bacteria 3309
314 Ga0466967_0154414 3300045976 Bacteria 2149
315 Ga0466967_0230412 3300045976 Bacteria 1763
316 Ga0466967_0758044 3300045976 Unclassified 963
317 Ga0466967_1421464 3300045976 Bacteria 691
318 Ga0495643_0194705 3300046522 Bacteria 977
319 Ga0496103_0379961 3300048906 Bacteria 908
320 Ga0496108_0483967 3300048911 Bacteria 1081
321 Ga0496109_1914904 3300048912 Unclassified 525
322 Ga0496111_0199481 3300048914 Bacteria 1488
323 Ga0496112_0005464 3300048915 Bacteria 10999
324 Ga0501209_240648 3300049656 Bacteria 564
325 Ga0501223_019757 3300049663 Bacteria 1323
326 Ga0501235_036756 3300049669 Bacteria 1114
327 Ga0501240_012563 3300049673 Unclassified 1161
328 Ga0501242_014704 3300049674 Unclassified 971
329 Ga0501249_018893 3300049679 Bacteria 1493
330 Ga0501221_005254 3300049704 Bacteria 2160
331 Ga0501273_008491 3300049770 Bacteria 1231
332 Ga0501204_007819 3300049850 Unclassified 1208
333 Ga0466962_0037596 3300061719 Bacteria 2318
334 Ga0466962_0080273 3300061719 Bacteria 1560
335 Ga0207668_10360052
336 JGI24736J21556_1031951
337 JGI24741J21665_1014139
338 JGI24741J21665_1026555
339 JGI24740J21852_10003295
340 JGI24740J21852_10013624
341 JGI24740J21852_10077226
342 JGI24737J22298_10003831
343 JGI24737J22298_10059607
344 JGI24735J21928_10020069
345 JGI24735J21928_10100671
346 rootH1_10057658
347 Ga0065715_10262006
348 Ga0070658_10164537
349 Ga0070658_10264471
350 Ga0070658_10441698
351 Ga0070658_10680842
352 Ga0070676_10405191
353 Ga0070683_100049157
354 Ga0070670_100021122
355 Ga0070670_100047885
356 Ga0070670_100066971
357 Ga0070677_10036381
358 Ga0070666_10102783
359 Ga0070680_100012389
360 Ga0070660_100003814
361 Ga0070660_100125353
362 Ga0070660_100156366
363 Ga0070660_100284898
364 Ga0070661_101136173
365 Ga0070668_100288720
366 Ga0070669_100335463
367 Ga0070671_100107889
368 Ga0070671_100221823
369 Ga0070674_100011935
370 Ga0070673_100684996
371 Ga0070659_100001983
372 Ga0070659_100051382
373 Ga0070667_100069523
374 Ga0070714_100526328
375 Ga0070714_100562154
376 Ga0070713_100047972
377 Ga0070663_100027142
378 Ga0070678_100266322
379 Ga0070662_100051014
380 Ga0070662_100126430
381 Ga0070662_100758757
382 Ga0070681_11024156
383 Ga0068853_100003839
384 Ga0070672_100231580
385 Ga0070665_100136625
386 Ga0068855_100034695
387 Ga0070664_100004536
388 Ga0070664_100031376
389 Ga0068857_100111095
390 Ga0068857_100514043
391 Ga0068854_100031332
392 Ga0068854_100037784
393 Ga0068854_100070030
394 Ga0068854_100087279
395 Ga0068854_100424649
396 Ga0068856_100066903
397 Ga0068856_100449317
398 Ga0068856_100773886
399 Ga0068852_100785846
400 Ga0068852_100914322
401 Ga0068859_100092743
402 Ga0068859_100241282
403 Ga0068864_100046769
404 Ga0068864_100095365
405 Ga0068851_10011863
406 Ga0068851_10433080
407 Ga0068863_100004579
408 Ga0068858_100728100
409 Ga0068860_100888138
410 Ga0070717_10002916
411 Ga0070712_100003207
412 Ga0068871_100008298
413 Ga0097620_100092739
414 Ga0097620_100241285
415 Ga0105240_10104447
416 Ga0105241_10130326
417 Ga0105248_10048697
418 Ga0105248_10100063
419 Ga0105237_10053836
420 Ga0105238_10020608
421 Ga0105246_10127978
422 Ga0157325_1003148
423 Ga0157373_10007643
424 Ga0157373_10425044
425 Ga0157370_10029822
426 Ga0157370_10569706
427 Ga0157370_11055005
428 Ga0157369_10878422
429 Ga0157372_10140991
430 Ga0157372_10142761
431 Ga0163163_10043207
432 Ga0157380_10012604
433 Ga0206354_11015787
434 Ga0207697_10043671
435 Ga0207656_10013135
436 Ga0207682_10001759
437 Ga0207688_10492350
438 Ga0207647_10000793
439 Ga0207647_10008873
440 Ga0207647_10010434
441 Ga0207647_10096735
442 Ga0207645_10480979
443 Ga0207705_10015182
444 Ga0207705_10015589
445 Ga0207705_10045221
446 Ga0207705_10142356
447 Ga0207705_10756758
448 Ga0207707_10789609
449 Ga0207695_10048417
450 Ga0207671_10109196
451 Ga0207660_10002713
452 Ga0207660_10089964
453 Ga0207660_10553562
454 Ga0207657_10000157
455 Ga0207657_10046383
456 Ga0207657_10056785
457 Ga0207657_10118987
458 Ga0207657_10163089
459 Ga0207657_10294414
460 Ga0207649_10049191
461 Ga0207649_10063694
462 Ga0207652_10110953
463 Ga0207652_10342553
464 Ga0207681_10022762
465 Ga0207681_10446519
466 Ga0207694_10190110
467 Ga0207650_10101659
468 Ga0207650_10187127
469 Ga0207659_10011817
470 Ga0207700_10032823
471 Ga0207664_10010990
472 Ga0207664_10020756
473 Ga0207664_10265212
474 Ga0207664_10746787
475 Ga0207644_10086691
476 Ga0207690_10000593
477 Ga0207690_10125280
478 Ga0207690_10218094
479 Ga0207690_10796246
480 Ga0207706_10013139
481 Ga0207706_10033929
482 Ga0207706_10071833
483 Ga0207669_10320299
484 Ga0207691_10308030
485 Ga0207661_10043126
486 Ga0207661_10104647
487 Ga0207679_10448705
488 Ga0207667_10463118
489 Ga0207667_10557749
490 Ga0207651_10110469
491 Ga0207651_10810684
492 Ga0207668_10323094
493 Ga0207640_10008389
494 Ga0207640_10148187
495 Ga0207640_10255303
496 Ga0207703_10597259
497 Ga0207639_10055951
498 Ga0207678_10001853
499 Ga0207678_10094375
500 Ga0207678_10418069
501 Ga0207678_10473793
502 Ga0207702_10095503
503 Ga0207702_10170219
504 Ga0207702_10350974
505 Ga0207641_10061485
506 Ga0207676_10060067
507 Ga0207674_10000139
508 Ga0207674_10001776
509 Ga0207683_10508903
510 Ga0207698_10400048
511 Ga0207698_10413685
512 Ga0207698_10870469
513 Ga0268266_10724949
514 Ga0307405_10036770
515 Ga0307413_10111200
516 Ga0307410_10009074
517 Ga0307406_10142287
518 Ga0307407_10125260
519 Ga0307412_10179029
520 Ga0307412_10237250
521 Ga0307409_100004257
522 Ga0307409_100035158
523 Ga0307409_100272873
524 Ga0307416_100026600
525 Ga0307416_100112566
526 Ga0307411_10000215
527 Ga0307411_10070617
528 Ga0307411_10205711
529 Ga0307411_10576865
530 Ga0307415_100060874
531 Ga0307415_100132721
532 Ga0373943_0003470
533 Ga0373927_0097148
534 Ga0395899_0002059
535 Ga0395899_0005719
536 Ga0395899_0044646
537 Ga0395899_0088159
538 Ga0395899_0104052
539 Ga0395899_0116333
540 Ga0395899_0130315
541 Ga0395899_0136774
542 Ga0395899_0142418
543 Ga0395899_0319899
544 Ga0395899_0376372
545 Ga0395900_0000449
546 Ga0395900_0000814
547 Ga0395900_0012091
548 Ga0395900_0017493
549 Ga0395900_0024061
550 Ga0395900_0035520
551 Ga0395900_0036538
552 Ga0395900_0080035
553 Ga0395900_0087188
554 Ga0395900_0087227
555 Ga0395900_0104244
556 Ga0395900_0132076
557 Ga0395900_0170601
558 Ga0395900_0187582
559 Ga0395900_0197818
560 Ga0395900_0232215
561 Ga0395900_0241450
562 Ga0395900_0311364
563 Ga0395900_0331466
564 Ga0395900_0526342
565 Ga0395900_0568506
566 Ga0395900_0973588
567 Ga0395900_1459495
568 Ga0395900_1523530
569 Ga0395898_0001564
570 Ga0395898_0070356
571 Ga0395898_0082624
572 Ga0395898_0167932
573 Ga0395898_0175518
574 Ga0395898_0268692
575 Ga0395898_0274062
576 Ga0395898_0329481
577 Ga0395898_0402708
578 Ga0395898_0423193
579 Ga0395898_0472235
580 Ga0395898_0532833
581 Ga0395898_0641064
582 Ga0395905_0000434
583 Ga0395905_0002589
584 Ga0395905_0007179
585 Ga0395905_0008954
586 Ga0395905_0011336
587 Ga0395905_0017679
588 Ga0395905_0018900
589 Ga0395905_0033515
590 Ga0395905_0046695
591 Ga0395905_0065149
592 Ga0395905_0087778
593 Ga0395905_0099231
594 Ga0395905_0103951
595 Ga0395905_0153705
596 Ga0395905_0160214
597 Ga0395905_0196758
598 Ga0395905_0237740
599 Ga0395905_0269191
600 Ga0395905_0409048
601 Ga0395905_0423010
602 Ga0395905_0525022
603 Ga0395905_0928623
604 Ga0395905_1599166
605 Ga0395901_0016711
606 Ga0395901_0018456
607 Ga0395901_0027738
608 Ga0395901_0032158
609 Ga0395901_0032196
610 Ga0395901_0059384
611 Ga0395901_0076847
612 Ga0395901_0082622
613 Ga0395901_0104441
614 Ga0395901_0116121
615 Ga0395901_0137843
616 Ga0395901_0154685
617 Ga0395901_0162069
618 Ga0395901_0164502
619 Ga0395901_0201005
620 Ga0395901_0264802
621 Ga0395901_0270882
622 Ga0395901_0279724
623 Ga0395901_0440024
624 Ga0395901_0541125
625 Ga0395901_0593514
626 Ga0439448_0027168
627 Ga0439449_0050032
628 Ga0439458_0004534
629 Ga0439458_0009202
630 Ga0466969_0187197
631 Ga0466972_0020500
632 Ga0466966_0023978
633 Ga0466966_0057715
634 Ga0466961_0169920
635 Ga0466963_0000126
636 Ga0466963_0104880
637 Ga0466964_0272372
638 Ga0466964_0339211
639 Ga0466971_0057474
640 Ga0466971_0173795
641 Ga0466957_0075520
642 Ga0466957_0550400
643 Ga0466959_0005875
644 Ga0466959_0070201
645 Ga0466958_0030574
646 Ga0466967_0000114
647 Ga0466967_0062357
648 Ga0466967_0154414
649 Ga0466967_0230412
650 Ga0466967_0758044
651 Ga0466967_1421464
652 Ga0495643_0194705
653 Ga0496103_0379961
654 Ga0496108_0483967
655 Ga0496109_1914904
656 Ga0496111_0199481
657 Ga0496112_0005464
658 Ga0501209_240648
659 Ga0501223_019757
660 Ga0501235_036756
661 Ga0501240_012563
662 Ga0501242_014704
663 Ga0501249_018893
664 Ga0501221_005254
665 Ga0501273_008491
666 Ga0501204_007819
667 Ga0466962_0037596
668 Ga0466962_0080273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13650

Asp_protease_2

Aspartyl protease

92

120

0.94

PF13975

gag-asp_proteas

gag-polyprotein putative aspartyl protease

92

169

0.92

PF13650

Asp_protease_2

Aspartyl protease

115

166

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c9d-assembly1.cif.gz_A crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8895 78 193
5c9b-assembly1.cif.gz_D crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8825 78 193
5c9f-assembly1.cif.gz_D crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8481 78 193
5c9f-assembly1.cif.gz_B crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.845 78 193
5c9b-assembly1.cif.gz_A crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.84 78 193
ID Description Score Start End Superfamily
5c9fB00 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.845 78 193 2.40.70.10
af_Q54J95_15_120_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8324 88 183 2.40.70.10
af_F4J7U9_265_379_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8283 88 174 2.40.70.10
af_Q7KWM0_146_263_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.82 89 191 2.40.70.10
af_Q54VD1_290_401_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8113 92 189 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A7H0GF63-F1-model_v4 deleted 0.9562 66 195
AF-Q1NDV4-F1-model_v4 Peptidase A2 domain-containing protein 0.9544 71 195 GO:0004190
GO:0006508
AF-A0A1F3WUQ6-F1-model_v4 Aspartyl protease 0.9417 72 194
AF-A0A259K117-F1-model_v4 DNA topoisomerase (ATP-hydrolyzing) (EC 5.6.2.2) 0.9408 71 195 GO:0003677
GO:0004190
GO:0005524
GO:0006265
GO:0006508
GO:0034335
AF-A0A5C6TPU1-F1-model_v4 TIGR02281 family clan AA aspartic protease (EC 3.4.23.-) 0.9341 75 193 GO:0004190
GO:0006508

Map