F411791

General Info

Members Datasets Scaffolds Average Seq Length
334 211 292 371

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10017452|Ga0157373_100174523
Length 418
Sequence LLPPFFDFAGLLPLPFLSDYIPVAAPSTNGMMEGKAMTIIRALSLLAGAALIAVPQMASAVTVKRTSFGKLSTGQEVDAFTLTNSHGVSAKVITLGATLQSLIAPDRAGKKADVALGFPDAAAYEDHGSYFGVSVGRYANRIADGRFALDGKAYQLAKNNNGVAALHGGERGFDKHVWKVLEVKGGKVASVTLGLTSPNGDQGYPGTLTVSVTYSLDEANNLKVDYRARTDRPTIVNLTSHGLYNMAGEGSADGAMGNRLTILADRYTPVDANLIPTGQLTPVAGTAFDFRTPKLVKTRLRDASDPQVVLGRGFDHNYVLRGKSGGAPRLIAVLDDPASGRRMELLSDQPGVQLYTGNFIDGTTVGKSGKIYRQGDGIALEPQHYPDSPNRPEFPSVRLDPGQEYRNVMIFRMGVSGR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221641 Nocardioides sp. Root122 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
15 2739367898 Nocardioides sp. CF479 Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
30 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
31 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
32 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
33 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
34 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
35 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
205 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
206 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.43
Metatranscriptomes 0
Isolates 12.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.9
Bulb 0
Endosphere 22.75
Nodule 0.3
Rhizoplane 1.5
Rhizosphere 58.38
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005561 3300001989 Bacteria 4778
2 JGI24737J22298_10002967 3300001990 Bacteria 6012
3 JGI24738J21930_10003280 3300002075 Bacteria 4115
4 JGI25156J39149_1001333 3300002705 Bacteria 10625
5 JGI25157J39369_1005490 3300002741 Bacteria 2060
6 rootL2_10001970 3300003322 Bacteria 1781
7 rootL2_10075327 3300003322 Bacteria 7539
8 Ga0055526_1001245 3300003771 Bacteria 18276
9 Ga0055537_1000185 3300003773 Bacteria 46470
10 Ga0055537_1000646 3300003773 Bacteria 18512
11 Ga0055524_1004986 3300003775 Bacteria 6014
12 Ga0055536_1000029 3300003781 Bacteria 157375
13 Ga0055536_1000057 3300003781 Bacteria 104652
14 Ga0055536_1000126 3300003781 Bacteria 65482
15 Ga0055534_1000172 3300003784 Bacteria 47998
16 Ga0055534_1000518 3300003784 Bacteria 20801
17 Ga0055528_1009213 3300003790 Bacteria 4145
18 Ga0055530_10000132 3300003791 Bacteria 65482
19 Ga0055530_10000628 3300003791 Bacteria 30471
20 Ga0055530_10000856 3300003791 Bacteria 25068
21 Ga0055531_10000053 3300003794 Bacteria 124623
22 Ga0065165_1000388 3300005262 Bacteria 71380
23 Ga0065165_1002943 3300005262 Bacteria 12977
24 Ga0070658_10000292 3300005327 Bacteria 43714
25 Ga0070683_100011044 3300005329 Bacteria 7784
26 Ga0070666_10005004 3300005335 Bacteria 8106
27 Ga0070660_100000655 3300005339 Bacteria 22906
28 Ga0070661_100000138 3300005344 Bacteria 61062
29 Ga0070671_100013927 3300005355 Bacteria 6489
30 Ga0070673_100133797 3300005364 Bacteria 2084
31 Ga0070659_100000081 3300005366 Bacteria 73150
32 Ga0070667_100005341 3300005367 Bacteria 10731
33 Ga0070663_100050187 3300005455 Bacteria 2966
34 Ga0070662_100000025 3300005457 Bacteria 87144
35 Ga0070684_100003050 3300005535 Bacteria 12497
36 Ga0068853_100001144 3300005539 Bacteria 18799
37 Ga0070665_100011521 3300005548 Bacteria 8941
38 Ga0070665_100097876 3300005548 Bacteria 2939
39 Ga0068855_100000503 3300005563 Bacteria 48317
40 Ga0070664_100000012 3300005564 Bacteria 162011
41 Ga0068854_100168680 3300005578 Bacteria 1701
42 Ga0068856_100000163 3300005614 Bacteria 68963
43 Ga0068856_100004505 3300005614 Bacteria 13850
44 Ga0068852_100000160 3300005616 Bacteria 44946
45 Ga0068852_100000426 3300005616 Bacteria 28017
46 Ga0068864_100040889 3300005618 Bacteria 3965
47 Ga0068851_10009355 3300005834 Bacteria 4553
48 Ga0068863_100186222 3300005841 Bacteria 1994
49 Ga0068858_100026543 3300005842 Bacteria 5380
50 Ga0075369_10001558 3300006186 Bacteria 7854
51 Ga0075366_10005939 3300006195 Bacteria 6642
52 Ga0097621_100026395 3300006237 Bacteria 4556
53 Ga0068871_100061457 3300006358 Bacteria 3068
54 Ga0075430_100068675 3300006846 Bacteria 2973
55 Ga0075433_10037406 3300006852 Bacteria 4187
56 Ga0105247_10145805 3300009101 Bacteria 1556
57 Ga0105243_10236015 3300009148 Bacteria 1625
58 Ga0105248_10000299 3300009177 Bacteria 58871
59 Ga0157373_10017452 3300013100 Bacteria 5227
60 Ga0157371_10001635 3300013102 Bacteria 22933
61 Ga0157369_10006638 3300013105 Bacteria 13382
62 Ga0157375_10111685 3300013308 Bacteria 2832
63 Ga0163163_10046166 3300014325 Bacteria 4278
64 Ga0157380_10007320 3300014326 Bacteria 7834
65 Ga0182006_1000404 3300015261 Bacteria 35006
66 Ga0183369_1011 3300015685 Bacteria 252490
67 Ga0163161_10106763 3300017792 Bacteria 2089
68 Ga0209026_1001418 3300025250 Bacteria 10650
69 Ga0209759_1001831 3300025256 Bacteria 10671
70 Ga0209565_1000024 3300025263 Bacteria 379907
71 Ga0209565_1000049 3300025263 Bacteria 224447
72 Ga0209565_1000118 3300025263 Bacteria 113196
73 Ga0209673_1000237 3300025273 Bacteria 106342
74 Ga0209673_1001150 3300025273 Bacteria 28906
75 Ga0209675_1000011 3300025291 Bacteria 520597
76 Ga0209675_1002511 3300025291 Bacteria 9377
77 Ga0209675_1003189 3300025291 Bacteria 7954
78 Ga0209676_1000011 3300025292 Bacteria 860463
79 Ga0209676_1000031 3300025292 Bacteria 478976
80 Ga0209676_1000057 3300025292 Bacteria 361061
81 Ga0209564_1000490 3300025295 Bacteria 65811
82 Ga0209564_1001385 3300025295 Bacteria 25288
83 Ga0209564_1004581 3300025295 Bacteria 8370
84 Ga0209758_1000835 3300025297 Bacteria 42973
85 Ga0209758_1001149 3300025297 Bacteria 33877
86 Ga0209758_1022182 3300025297 Bacteria 2926
87 Ga0209050_1000032 3300025298 Bacteria 456335
88 Ga0209050_1000087 3300025298 Bacteria 261460
89 Ga0209050_1000096 3300025298 Bacteria 240109
90 Ga0209256_1000962 3300025299 Bacteria 34745
91 Ga0209256_1002953 3300025299 Bacteria 12752
92 Ga0209256_1015656 3300025299 Bacteria 2638
93 Ga0209256_1016303 3300025299 Bacteria 2542
94 Ga0209051_1002432 3300025303 Bacteria 13380
95 Ga0209051_1003501 3300025303 Bacteria 10266
96 Ga0209257_1000014 3300025304 Bacteria 946850
97 Ga0209257_1000050 3300025304 Bacteria 439325
98 Ga0209257_1000506 3300025304 Bacteria 68402
99 Ga0209257_1004058 3300025304 Bacteria 11755
100 Ga0207680_10036142 3300025903 Bacteria 2843
101 Ga0207647_10053659 3300025904 Bacteria 2483
102 Ga0207705_10000095 3300025909 Bacteria 106506
103 Ga0207657_10000028 3300025919 Bacteria 141576
104 Ga0207649_10000014 3300025920 Bacteria 255001
105 Ga0207644_10103806 3300025931 Bacteria 2139
106 Ga0207690_10000042 3300025932 Bacteria 120002
107 Ga0207706_10000029 3300025933 Bacteria 146113
108 Ga0207711_10000751 3300025941 Bacteria 31798
109 Ga0207661_10001533 3300025944 Bacteria 15692
110 Ga0207679_10002058 3300025945 Bacteria 12483
111 Ga0207667_10027304 3300025949 Bacteria 6216
112 Ga0207640_10133883 3300025981 Bacteria 1796
113 Ga0207658_10001237 3300025986 Bacteria 20199
114 Ga0207703_10234025 3300026035 Bacteria 1648
115 Ga0207639_10000766 3300026041 Bacteria 21916
116 Ga0207678_10070702 3300026067 Bacteria 2992
117 Ga0207702_10000037 3300026078 Bacteria 153366
118 Ga0207702_10001460 3300026078 Bacteria 23509
119 Ga0207702_10133028 3300026078 Bacteria 2240
120 Ga0207641_10165112 3300026088 Bacteria 2016
121 Ga0207676_10256544 3300026095 Bacteria 1576
122 Ga0207698_10000077 3300026142 Bacteria 65551
123 Ga0207698_10007023 3300026142 Bacteria 7052
124 Ga0268266_10032962 3300028379 Bacteria 4403
125 Ga0307517_10000875 3300028786 Bacteria 51286
126 Ga0307515_10021092 3300028794 Bacteria 11572
127 Ga0307515_10036405 3300028794 Bacteria 7961
128 Ga0316181_1042074 3300030744 Bacteria 3262
129 Ga0373931_0026000 3300035691 Bacteria 2975
130 Ga0395900_0000679 3300037418 Bacteria 45322
131 Ga0395898_0023460 3300037466 Bacteria 6234
132 Ga0395905_0000231 3300037471 Bacteria 84714
133 Ga0395905_0350926 3300037471 Bacteria 1367
134 Ga0395901_0000388 3300038443 Bacteria 52630
135 Ga0451797_0750065 3300041453 Bacteria 3085
136 Ga0451853_1471405 3300041512 Bacteria 1962
137 Ga0439435_0010563 3300042436 Bacteria 2194
138 Ga0466965_0123336 3300044683 Bacteria 1339
139 Ga0466966_0022012 3300044684 Bacteria 4185
140 Ga0466961_0026330 3300044693 Bacteria 3738
141 Ga0466971_0006998 3300044719 Bacteria 4909
142 Ga0466970_0025441 3300044765 Bacteria 3099
143 Ga0466960_0044791 3300044901 Bacteria 2111
144 Ga0466959_0002727 3300045049 Bacteria 11359
145 Ga0466958_0004967 3300045836 Bacteria 7095
146 Ga0466958_0007491 3300045836 Bacteria 6008
147 Ga0466958_0067600 3300045836 Bacteria 2183
148 Ga0466967_0011621 3300045976 Bacteria 6685
149 Ga0466967_0227096 3300045976 Bacteria 1776
150 Ga0495627_000185 3300046453 Bacteria 69533
151 Ga0495627_001767 3300046453 Bacteria 11624
152 Ga0495590_0001569 3300046457 Bacteria 9791
153 Ga0495638_0000849 3300046460 Bacteria 31864
154 Ga0495638_0001016 3300046460 Bacteria 27896
155 Ga0495638_0001206 3300046460 Bacteria 24684
156 Ga0495638_0002055 3300046460 Bacteria 17094
157 Ga0495638_0012117 3300046460 Bacteria 5921
158 Ga0495638_0015079 3300046460 Bacteria 5199
159 Ga0495638_0016808 3300046460 Bacteria 4892
160 Ga0495650_0000017 3300046471 Bacteria 542552
161 Ga0495650_0000069 3300046471 Bacteria 261124
162 Ga0495583_0000029 3300046506 Bacteria 255536
163 Ga0495606_0004031 3300046507 Bacteria 14979
164 Ga0495606_0004595 3300046507 Bacteria 13684
165 Ga0495610_0000176 3300046512 Bacteria 71110
166 Ga0495610_0000378 3300046512 Bacteria 45991
167 Ga0495610_0001716 3300046512 Bacteria 19206
168 Ga0495610_0002127 3300046512 Bacteria 16847
169 Ga0495610_0004554 3300046512 Bacteria 10194
170 Ga0495620_0028976 3300046515 Bacteria 2568
171 Ga0495631_0007881 3300046518 Bacteria 5394
172 Ga0495637_0001982 3300046520 Bacteria 11580
173 Ga0495637_0010675 3300046520 Bacteria 4433
174 Ga0495637_0018199 3300046520 Bacteria 3261
175 Ga0495637_0025604 3300046520 Bacteria 2657
176 Ga0495643_0000086 3300046522 Bacteria 156793
177 Ga0495643_0052247 3300046522 Bacteria 2195
178 Ga0495648_0000229 3300046524 Bacteria 64205
179 Ga0495648_0008946 3300046524 Bacteria 7827
180 Ga0495648_0051702 3300046524 Bacteria 2501
181 Ga0495663_0013718 3300046525 Bacteria 2267
182 Ga0495654_0000012 3300046530 Bacteria 328997
183 Ga0495654_0000285 3300046530 Bacteria 46016
184 Ga0495668_0000019 3300046616 Bacteria 416042
185 Ga0495668_0004598 3300046616 Bacteria 9710
186 Ga0495668_0013068 3300046616 Bacteria 4913
187 Ga0495625_0000011 3300046660 Bacteria 377120
188 Ga0495625_0000143 3300046660 Bacteria 110121
189 Ga0495625_0000721 3300046660 Bacteria 46512
190 Ga0495625_0001867 3300046660 Bacteria 23949
191 Ga0495625_0003460 3300046660 Bacteria 15720
192 Ga0495625_0005726 3300046660 Bacteria 11236
193 Ga0495625_0007875 3300046660 Bacteria 9178
194 Ga0495625_0026904 3300046660 Bacteria 4337
195 Ga0495625_0035932 3300046660 Bacteria 3646
196 Ga0495625_0047259 3300046660 Bacteria 3103
197 Ga0495625_0083842 3300046660 Bacteria 2214
198 Ga0495589_0005938 3300046794 Bacteria 6446
199 Ga0495660_0002223 3300046810 Bacteria 12490
200 Ga0495660_0061981 3300046810 Bacteria 2006
201 Ga0495672_0000006 3300047320 Bacteria 589807
202 Ga0495672_0000663 3300047320 Bacteria 38282
203 Ga0495672_0000665 3300047320 Bacteria 38253
204 Ga0495679_006783 3300047446 Bacteria 4874
205 Ga0495679_009469 3300047446 Bacteria 3899
206 Ga0495673_0000039 3300047469 Bacteria 301943
207 Ga0495673_0000056 3300047469 Bacteria 245918
208 Ga0495673_0000225 3300047469 Bacteria 83589
209 Ga0495673_0000887 3300047469 Bacteria 27526
210 Ga0495673_0001625 3300047469 Bacteria 17407
211 Ga0495673_0001751 3300047469 Bacteria 16546
212 Ga0495686_0000161 3300047472 Bacteria 126951
213 Ga0495686_0001667 3300047472 Bacteria 23087
214 Ga0495686_0001697 3300047472 Bacteria 22775
215 Ga0495686_0003356 3300047472 Bacteria 13952
216 Ga0495686_0005217 3300047472 Bacteria 10331
217 Ga0495686_0011462 3300047472 Bacteria 6243
218 Ga0495686_0032226 3300047472 Bacteria 3393
219 Ga0495686_0038425 3300047472 Bacteria 3061
220 Ga0495686_0111437 3300047472 Bacteria 1640
221 Ga0496106_0170483 3300048909 Bacteria 1725
222 Ga0496107_0000395 3300048910 Bacteria 23591
223 Ga0496107_0000515 3300048910 Bacteria 21514
224 Ga0496115_0013355 3300048918 Bacteria 6212
225 Ga0496117_0007562 3300048920 Bacteria 10581
226 Ga0496117_0078331 3300048920 Bacteria 2182
227 Ga0496118_0000110 3300048921 Bacteria 152891
228 Ga0496121_0005998 3300048924 Bacteria 15336
229 Ga0496121_0007177 3300048924 Bacteria 13499
230 Ga0496121_0028182 3300048924 Bacteria 5234
231 Ga0496121_0040557 3300048924 Bacteria 4082
232 Ga0496121_0190434 3300048924 Bacteria 1471
233 Ga0496122_0000203 3300048925 Bacteria 132679
234 Ga0496123_0000164 3300048926 Bacteria 132565
235 Ga0496123_0010263 3300048926 Bacteria 8307
236 Ga0496124_0000393 3300048927 Bacteria 79747
237 Ga0496124_0014279 3300048927 Bacteria 7688
238 Ga0496124_0015679 3300048927 Bacteria 7249
239 Ga0496124_0165683 3300048927 Bacteria 1718
240 Ga0496124_0220634 3300048927 Bacteria 1426
241 Ga0496125_0000144 3300048928 Bacteria 156270
242 Ga0496125_0016889 3300048928 Bacteria 6987
243 Ga0496125_0040582 3300048928 Bacteria 3990
244 Ga0496125_0041373 3300048928 Bacteria 3940
245 Ga0496126_0023320 3300048929 Bacteria 5997
246 Ga0495678_001659 3300049459 Bacteria 16921
247 Ga0501032_0102096 3300049569 Bacteria 1900
248 Ga0501033_0006715 3300049570 Bacteria 8990
249 Ga0501033_0208965 3300049570 Bacteria 1392
250 Ga0501034_0192814 3300049571 Bacteria 1999
251 Ga0501039_0114159 3300049575 Bacteria 2113
252 Ga0501046_0007503 3300049580 Bacteria 9571
253 Ga0501048_0149071 3300049582 Bacteria 1654
254 Ga0501070_0019294 3300049586 Bacteria 5718
255 Ga0501080_0113990 3300049742 Bacteria 2506
256 Ga0501035_0032266 3300049822 Bacteria 4766
257 Ga0501035_0037446 3300049822 Bacteria 4392
258 Ga0501044_0013590 3300049823 Bacteria 8798
259 Ga0501044_0027953 3300049823 Bacteria 5953
260 Ga0501044_0191200 3300049823 Bacteria 2009
261 Ga0501044_0196190 3300049823 Bacteria 1979
262 nmdc:mga0qj67_137336_c1 3300050509 Bacteria 1981
263 nmdc:mga0a205_22944_c1 3300050515 Bacteria 5917
264 Ga0500578_0000030 3300053086 Bacteria 140063
265 Ga0500578_0061013 3300053086 Bacteria 2408
266 Ga0500643_031646 3300053087 Bacteria 1611
267 Ga0500644_0000122 3300053088 Bacteria 48036
268 Ga0500644_0006741 3300053088 Bacteria 2959
269 Ga0500554_001021 3300053102 Bacteria 5448
270 Ga0500554_023315 3300053102 Bacteria 1739
271 Ga0500556_0001162 3300053104 Bacteria 12663
272 Ga0500556_0001490 3300053104 Bacteria 9718
273 Ga0500562_000331 3300053108 Bacteria 11349
274 Ga0500594_0000077 3300053118 Bacteria 30827
275 Ga0500608_000004 3300053122 Bacteria 108109
276 Ga0500614_010548 3300053123 Bacteria 1986
277 Ga0500618_000024 3300053125 Bacteria 152149
278 Ga0500618_000240 3300053125 Bacteria 43528
279 Ga0500658_0002525 3300053134 Bacteria 7088
280 Ga0500559_0000015 3300053136 Bacteria 158494
281 Ga0500559_0000031 3300053136 Bacteria 114782
282 Ga0500559_0004426 3300053136 Bacteria 6675
283 Ga0500559_0004723 3300053136 Bacteria 6407
284 Ga0500564_000014 3300053138 Bacteria 53518
285 Ga0500573_0016155 3300053140 Bacteria 4235
286 Ga0500577_0005521 3300053142 Bacteria 3416
287 Ga0500622_0000867 3300053156 Bacteria 25738
288 Ga0500622_0011947 3300053156 Bacteria 4722
289 Ga0500622_0068438 3300053156 Bacteria 1799
290 Ga0500611_004229 3300053727 Bacteria 1920
291 Ga0500645_003955 3300053730 Bacteria 5836
292 Ga0466962_0004700 3300061719 Bacteria 6560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0007177 Ga0496121_0007177_24_953 303
2 3300037471 Ga0395905_0350926 Ga0395905_0350926_76_1167 316
3 3300044693 Ga0466961_0026330 Ga0466961_0026330_2623_3714 316
4 3300005616 Ga0068852_100000160 Ga0068852_10000016046 320
5 3300026142 Ga0207698_10000077 Ga0207698_1000007727 320
6 3300026078 Ga0207702_10133028 Ga0207702_101330282 321
7 3300025299 Ga0209256_1015656 Ga0209256_10156562 323
8 3300049822 Ga0501035_0037446 Ga0501035_0037446_14_1072 325
9 3300044719 Ga0466971_0006998 Ga0466971_0006998_289_1410 326
10 3300045836 Ga0466958_0004967 Ga0466958_0004967_5814_6935 326
11 3300045976 Ga0466967_0227096 Ga0466967_0227096_514_1635 326
12 3300003781 Ga0055536_1000029 Ga0055536_100002990 328
13 3300003791 Ga0055530_10000628 Ga0055530_1000062811 328
14 3300025292 Ga0209676_1000057 Ga0209676_1000057188 328
15 3300025298 Ga0209050_1000096 Ga0209050_100009685 328
16 3300025303 Ga0209051_1002432 Ga0209051_10024328 328
17 3300037418 Ga0395900_0000679 Ga0395900_0000679_35548_36735 328
18 3300037466 Ga0395898_0023460 Ga0395898_0023460_1549_2736 328
19 3300037471 Ga0395905_0000231 Ga0395905_0000231_68714_69901 328
20 3300038443 Ga0395901_0000388 Ga0395901_0000388_45347_46534 328
21 3300044683 Ga0466965_0123336 Ga0466965_0123336_171_1316 328
22 3300044684 Ga0466966_0022012 Ga0466966_0022012_1324_2469 328
23 3300044765 Ga0466970_0025441 Ga0466970_0025441_165_1310 328
24 3300045049 Ga0466959_0002727 Ga0466959_0002727_678_1823 328
25 3300045836 Ga0466958_0067600 Ga0466958_0067600_81_1226 328
26 3300053140 Ga0500573_0016155 Ga0500573_0016155_1719_2714 330
27 3300041453 Ga0451797_0750065 Ga0451797_0750065_46_1107 332
28 iso_pu_bacteria 2857442823 2857443928 332
29 3300030744 Ga0316181_1042074 Ga0316181_10420743 334
30 iso_pu_bacteria 2739367898 2740168437 335
31 3300005262 Ga0065165_1002943 Ga0065165_10029438 337
32 3300005614 Ga0068856_100004505 Ga0068856_1000045052 337
33 3300013105 Ga0157369_10006638 Ga0157369_100066386 337
34 3300025295 Ga0209564_1004581 Ga0209564_10045813 337
35 3300026078 Ga0207702_10000037 Ga0207702_100000372 337
36 3300041512 Ga0451853_1471405 Ga0451853_1471405_205_1413 337
37 3300046616 Ga0495668_0013068 Ga0495668_0013068_2221_3429 337
38 3300053122 Ga0500608_000004 Ga0500608_000004_65225_66379 337
39 3300053156 Ga0500622_0068438 Ga0500622_0068438_381_1535 337
40 3300049569 Ga0501032_0102096 Ga0501032_0102096_724_1878 338
41 3300049571 Ga0501034_0192814 Ga0501034_0192814_164_1375 338
42 3300049575 Ga0501039_0114159 Ga0501039_0114159_321_1532 338
43 3300049580 Ga0501046_0007503 Ga0501046_0007503_5263_6474 338
44 3300049582 Ga0501048_0149071 Ga0501048_0149071_23_1177 338
45 3300003322 rootL2_10001970 rootL2_100019701 339
46 3300049570 Ga0501033_0006715 Ga0501033_0006715_1319_2524 339
47 3300042436 Ga0439435_0010563 Ga0439435_0010563_627_1835 340
48 3300046520 Ga0495637_0018199 Ga0495637_0018199_1245_2396 340
49 3300053104 Ga0500556_0001162 Ga0500556_0001162_6832_7983 340
50 3300025297 Ga0209758_1000835 Ga0209758_100083513 341
51 3300046525 Ga0495663_0013718 Ga0495663_0013718_113_1267 341
52 3300049742 Ga0501080_0113990 Ga0501080_0113990_1260_2414 341
53 3300049822 Ga0501035_0032266 Ga0501035_0032266_2451_3599 341
54 3300049823 Ga0501044_0027953 Ga0501044_0027953_1908_3056 341
55 3300049823 Ga0501044_0191200 Ga0501044_0191200_666_1886 341
56 3300002705 JGI25156J39149_1001333 JGI25156J39149_10013332 342
57 3300002741 JGI25157J39369_1005490 JGI25157J39369_10054902 342
58 3300005578 Ga0068854_100168680 Ga0068854_1001686802 342
59 3300025250 Ga0209026_1001418 Ga0209026_10014182 342
60 3300025256 Ga0209759_1001831 Ga0209759_10018317 342
61 3300025981 Ga0207640_10133883 Ga0207640_101338832 342
62 3300044901 Ga0466960_0044791 Ga0466960_0044791_743_1783 342
63 3300049586 Ga0501070_0019294 Ga0501070_0019294_2732_3790 342
64 3300049823 Ga0501044_0196190 Ga0501044_0196190_148_1293 342
65 iso_pu_bacteria 2643221641 2644229519 342
66 iso_pu_bacteria 8054609563 8054611546 342
67 3300025299 Ga0209256_1000962 Ga0209256_10009628 343
68 3300025304 Ga0209257_1000506 Ga0209257_100050627 343
69 3300053102 Ga0500554_023315 Ga0500554_023315_180_1346 344
70 iso_pu_bacteria 2984576629 2984577333 344
71 iso_pu_bacteria 2990256926 2990259494 344
72 3300005262 Ga0065165_1000388 Ga0065165_100038859 345
73 3300025295 Ga0209564_1001385 Ga0209564_100138520 345
74 3300049570 Ga0501033_0208965 Ga0501033_0208965_301_1338 345
75 3300003771 Ga0055526_1001245 Ga0055526_100124517 346
76 3300003773 Ga0055537_1000185 Ga0055537_10001851 346
77 3300003781 Ga0055536_1000126 Ga0055536_10001265 346
78 3300003784 Ga0055534_1000172 Ga0055534_10001726 346
79 3300003784 Ga0055534_1000518 Ga0055534_100051812 346
80 3300003791 Ga0055530_10000132 Ga0055530_100001325 346
81 3300005548 Ga0070665_100097876 Ga0070665_1000978762 346
82 3300015261 Ga0182006_1000404 Ga0182006_100040413 346
83 3300025263 Ga0209565_1000024 Ga0209565_100002486 346
84 3300025273 Ga0209673_1000237 Ga0209673_100023760 346
85 3300025291 Ga0209675_1000011 Ga0209675_100001124 346
86 3300025292 Ga0209676_1000011 Ga0209676_1000011377 346
87 3300025295 Ga0209564_1000490 Ga0209564_100049040 346
88 3300025298 Ga0209050_1000032 Ga0209050_1000032256 346
89 3300025303 Ga0209051_1003501 Ga0209051_10035018 346
90 3300025304 Ga0209257_1000014 Ga0209257_1000014436 346
91 3300025304 Ga0209257_1004058 Ga0209257_10040583 346
92 3300048926 Ga0496123_0010263 Ga0496123_0010263_393_1538 346
93 3300048927 Ga0496124_0015679 Ga0496124_0015679_472_1617 346
94 3300048928 Ga0496125_0016889 Ga0496125_0016889_1902_2990 346
95 3300048928 Ga0496125_0041373 Ga0496125_0041373_645_1790 346
96 3300017792 Ga0163161_10106763 Ga0163161_101067632 347
97 3300046460 Ga0495638_0000849 Ga0495638_0000849_1967_3082 347
98 3300015685 Ga0183369_1011 Ga0183369_1011217 348
99 3300025297 Ga0209758_1022182 Ga0209758_10221824 348
100 3300053136 Ga0500559_0004723 Ga0500559_0004723_3247_4365 348
101 3300053156 Ga0500622_0011947 Ga0500622_0011947_3255_4373 348
102 3300053087 Ga0500643_031646 Ga0500643_031646_32_1180 350
103 3300053088 Ga0500644_0000122 Ga0500644_0000122_36280_37428 350
104 3300046660 Ga0495625_0000721 Ga0495625_0000721_35292_36611 351
105 3300053104 Ga0500556_0001490 Ga0500556_0001490_8090_9229 353
106 3300053123 Ga0500614_010548 Ga0500614_010548_753_1886 353
107 3300053730 Ga0500645_003955 Ga0500645_003955_2968_4107 353
108 3300025263 Ga0209565_1000049 Ga0209565_1000049139 355
109 3300025291 Ga0209675_1003189 Ga0209675_10031897 355
110 3300025297 Ga0209758_1001149 Ga0209758_100114912 355
111 3300025299 Ga0209256_1002953 Ga0209256_100295310 355
112 3300025299 Ga0209256_1016303 Ga0209256_10163034 355
113 3300046507 Ga0495606_0004595 Ga0495606_0004595_12219_13343 355
114 3300046660 Ga0495625_0007875 Ga0495625_0007875_4543_5667 355
115 3300046810 Ga0495660_0002223 Ga0495660_0002223_5943_7076 355
116 3300048918 Ga0496115_0013355 Ga0496115_0013355_627_1757 355
117 3300053086 Ga0500578_0061013 Ga0500578_0061013_629_1753 355
118 3300053102 Ga0500554_001021 Ga0500554_001021_2737_3870 355
119 iso_pu_bacteria 2582581280 2585153580 355
120 iso_pu_bacteria 2582581293 2585197384 355
121 3300046471 Ga0495650_0000017 Ga0495650_0000017_482971_484101 356
122 3300046512 Ga0495610_0000176 Ga0495610_0000176_60162_61301 356
123 3300046515 Ga0495620_0028976 Ga0495620_0028976_874_2004 356
124 3300046520 Ga0495637_0010675 Ga0495637_0010675_1088_2227 356
125 3300046522 Ga0495643_0052247 Ga0495643_0052247_254_1393 356
126 3300046524 Ga0495648_0008946 Ga0495648_0008946_2318_3448 356
127 3300046524 Ga0495648_0051702 Ga0495648_0051702_118_1317 356
128 3300046530 Ga0495654_0000012 Ga0495654_0000012_49412_50542 356
129 3300046660 Ga0495625_0000011 Ga0495625_0000011_339063_340226 356
130 3300046660 Ga0495625_0026904 Ga0495625_0026904_2880_4019 356
131 3300046660 Ga0495625_0083842 Ga0495625_0083842_414_1544 356
132 3300047320 Ga0495672_0000665 Ga0495672_0000665_10552_11691 356
133 3300047472 Ga0495686_0001667 Ga0495686_0001667_12353_13492 356
134 3300048909 Ga0496106_0170483 Ga0496106_0170483_395_1546 356
135 3300048910 Ga0496107_0000395 Ga0496107_0000395_17868_19022 356
136 3300048924 Ga0496121_0005998 Ga0496121_0005998_338_1492 356
137 3300053134 Ga0500658_0002525 Ga0500658_0002525_370_1509 356
138 3300003322 rootL2_10075327 rootL2_100753274 357
139 3300046460 Ga0495638_0016808 Ga0495638_0016808_100_1245 357
140 3300046512 Ga0495610_0001716 Ga0495610_0001716_14826_15947 357
141 3300046520 Ga0495637_0025604 Ga0495637_0025604_638_1759 357
142 3300046522 Ga0495643_0000086 Ga0495643_0000086_106079_107224 357
143 3300046524 Ga0495648_0000229 Ga0495648_0000229_36112_37260 357
144 3300047320 Ga0495672_0000006 Ga0495672_0000006_322517_323662 357
145 3300047469 Ga0495673_0000056 Ga0495673_0000056_175701_176822 357
146 3300047469 Ga0495673_0000887 Ga0495673_0000887_10592_11743 357
147 3300047472 Ga0495686_0003356 Ga0495686_0003356_12144_13289 357
148 3300047472 Ga0495686_0111437 Ga0495686_0111437_61_1182 357
149 3300048920 Ga0496117_0007562 Ga0496117_0007562_6055_7200 357
150 3300048921 Ga0496118_0000110 Ga0496118_0000110_69716_70861 357
151 3300048925 Ga0496122_0000203 Ga0496122_0000203_87181_88326 357
152 3300048926 Ga0496123_0000164 Ga0496123_0000164_44223_45368 357
153 3300048927 Ga0496124_0000393 Ga0496124_0000393_73574_74719 357
154 3300048928 Ga0496125_0000144 Ga0496125_0000144_98647_99792 357
155 3300053138 Ga0500564_000014 Ga0500564_000014_29445_30593 357
156 3300053142 Ga0500577_0005521 Ga0500577_0005521_676_1797 357
157 iso_pu_bacteria 2510917020 2511121484 357
158 iso_pu_bacteria 2643221545 2643751590 357
159 iso_pu_bacteria 2643221583 2643926078 357
160 iso_pu_bacteria 2643221691 2644511349 357
161 iso_pu_bacteria 2939589442 2939591605 357
162 iso_pu_bacteria 2939622612 2939623930 357
163 iso_pu_bacteria 2974307012 2974308859 357
164 iso_pu_bacteria 2977247770 2977249575 357
165 iso_pu_bacteria 2984514374 2984515933 357
166 3300006846 Ga0075430_100068675 Ga0075430_1000686752 358
167 3300006852 Ga0075433_10037406 Ga0075433_100374064 358
168 3300009101 Ga0105247_10145805 Ga0105247_101458051 358
169 3300014326 Ga0157380_10007320 Ga0157380_100073207 358
170 3300046453 Ga0495627_000185 Ga0495627_000185_64479_65603 358
171 3300046460 Ga0495638_0002055 Ga0495638_0002055_15559_16794 358
172 3300046460 Ga0495638_0015079 Ga0495638_0015079_139_1263 358
173 3300046506 Ga0495583_0000029 Ga0495583_0000029_114726_115880 358
174 3300046660 Ga0495625_0001867 Ga0495625_0001867_15909_17144 358
175 3300047446 Ga0495679_009469 Ga0495679_009469_1782_3095 358
176 3300047469 Ga0495673_0001625 Ga0495673_0001625_15476_16630 358
177 3300047472 Ga0495686_0038425 Ga0495686_0038425_1151_2287 358
178 3300048910 Ga0496107_0000515 Ga0496107_0000515_13454_14605 358
179 3300048924 Ga0496121_0028182 Ga0496121_0028182_252_1403 358
180 3300048924 Ga0496121_0040557 Ga0496121_0040557_2749_3990 358
181 3300048927 Ga0496124_0165683 Ga0496124_0165683_104_1246 358
182 3300050509 nmdc:mga0qj67_137336_c1 nmdc:mga0qj67_137336_c1_692_1915 358
183 3300050515 nmdc:mga0a205_22944_c1 nmdc:mga0a205_22944_c1_779_1963 358
184 3300053125 Ga0500618_000024 Ga0500618_000024_51859_53073 358
185 3300053136 Ga0500559_0000015 Ga0500559_0000015_7288_8439 358
186 3300003781 Ga0055536_1000057 Ga0055536_100005760 359
187 3300003791 Ga0055530_10000856 Ga0055530_100008568 359
188 3300003794 Ga0055531_10000053 Ga0055531_1000005387 359
189 3300006195 Ga0075366_10005939 Ga0075366_100059396 359
190 3300025292 Ga0209676_1000031 Ga0209676_1000031196 359
191 3300025298 Ga0209050_1000087 Ga0209050_100008776 359
192 3300025304 Ga0209257_1000050 Ga0209257_1000050234 359
193 3300045836 Ga0466958_0007491 Ga0466958_0007491_124_1251 359
194 3300045976 Ga0466967_0011621 Ga0466967_0011621_784_1911 359
195 3300048927 Ga0496124_0220634 Ga0496124_0220634_145_1284 359
196 3300048928 Ga0496125_0040582 Ga0496125_0040582_371_1510 359
197 3300048929 Ga0496126_0023320 Ga0496126_0023320_3455_4594 359
198 3300061719 Ga0466962_0004700 Ga0466962_0004700_2265_3392 359
199 iso_pu_bacteria 2585428106 2587916293 359
200 iso_pu_bacteria 2643221640 2644226198 359
201 iso_pu_bacteria 2643221642 2644235686 359
202 3300009148 Ga0105243_10236015 Ga0105243_102360152 360
203 3300013308 Ga0157375_10111685 Ga0157375_101116852 360
204 3300046616 Ga0495668_0000019 Ga0495668_0000019_285451_286596 360
205 3300048920 Ga0496117_0078331 Ga0496117_0078331_636_1760 360
206 3300048924 Ga0496121_0190434 Ga0496121_0190434_198_1337 360
207 3300049823 Ga0501044_0013590 Ga0501044_0013590_6204_7331 360
208 iso_pu_bacteria 2884960567 2884963655 360
209 3300047472 Ga0495686_0000161 Ga0495686_0000161_22245_23384 361
210 3300049459 Ga0495678_001659 Ga0495678_001659_3046_4173 361
211 3300053118 Ga0500594_0000077 Ga0500594_0000077_12478_13605 361
212 iso_pu_bacteria 2687453130 2687584875 361
213 3300028786 Ga0307517_10000875 Ga0307517_1000087520 362
214 3300028794 Ga0307515_10036405 Ga0307515_100364056 362
215 3300046457 Ga0495590_0001569 Ga0495590_0001569_3613_4764 362
216 3300046460 Ga0495638_0001016 Ga0495638_0001016_18396_19547 362
217 3300046460 Ga0495638_0012117 Ga0495638_0012117_424_1575 362
218 3300046512 Ga0495610_0002127 Ga0495610_0002127_1173_2324 362
219 3300046512 Ga0495610_0004554 Ga0495610_0004554_7759_8910 362
220 3300046518 Ga0495631_0007881 Ga0495631_0007881_1426_2577 362
221 3300046520 Ga0495637_0001982 Ga0495637_0001982_1606_2757 362
222 3300046616 Ga0495668_0004598 Ga0495668_0004598_6554_7705 362
223 3300046810 Ga0495660_0061981 Ga0495660_0061981_465_1616 362
224 3300047472 Ga0495686_0001697 Ga0495686_0001697_2298_3449 362
225 3300047472 Ga0495686_0011462 Ga0495686_0011462_3059_4210 362
226 3300047472 Ga0495686_0032226 Ga0495686_0032226_495_1646 362
227 3300053086 Ga0500578_0000030 Ga0500578_0000030_60719_61870 362
228 3300053088 Ga0500644_0006741 Ga0500644_0006741_1176_2327 362
229 3300053108 Ga0500562_000331 Ga0500562_000331_2301_3452 362
230 3300053156 Ga0500622_0000867 Ga0500622_0000867_16410_17561 362
231 3300053727 Ga0500611_004229 Ga0500611_004229_117_1268 362
232 iso_pu_bacteria 2582581279 2585148329 362
233 3300003773 Ga0055537_1000646 Ga0055537_100064613 363
234 3300003775 Ga0055524_1004986 Ga0055524_10049862 363
235 3300003790 Ga0055528_1009213 Ga0055528_10092132 363
236 3300025263 Ga0209565_1000118 Ga0209565_1000118102 363
237 3300025273 Ga0209673_1001150 Ga0209673_100115015 363
238 3300025291 Ga0209675_1002511 Ga0209675_10025119 363
239 3300028794 Ga0307515_10021092 Ga0307515_100210924 363
240 3300046453 Ga0495627_001767 Ga0495627_001767_8904_10055 363
241 3300046460 Ga0495638_0001206 Ga0495638_0001206_5033_6187 363
242 3300046471 Ga0495650_0000069 Ga0495650_0000069_234361_235512 363
243 3300046507 Ga0495606_0004031 Ga0495606_0004031_4065_5219 363
244 3300046512 Ga0495610_0000378 Ga0495610_0000378_16852_18006 363
245 3300046530 Ga0495654_0000285 Ga0495654_0000285_27660_28811 363
246 3300046660 Ga0495625_0000143 Ga0495625_0000143_61636_62787 363
247 3300046660 Ga0495625_0003460 Ga0495625_0003460_5514_6665 363
248 3300046660 Ga0495625_0005726 Ga0495625_0005726_6309_7463 363
249 3300046660 Ga0495625_0035932 Ga0495625_0035932_1600_2754 363
250 3300046660 Ga0495625_0047259 Ga0495625_0047259_1413_2564 363
251 3300046794 Ga0495589_0005938 Ga0495589_0005938_961_2112 363
252 3300047320 Ga0495672_0000663 Ga0495672_0000663_26864_28018 363
253 3300047446 Ga0495679_006783 Ga0495679_006783_2179_3330 363
254 3300047469 Ga0495673_0000039 Ga0495673_0000039_131018_132169 363
255 3300047469 Ga0495673_0000225 Ga0495673_0000225_38237_39382 363
256 3300047469 Ga0495673_0001751 Ga0495673_0001751_15347_16501 363
257 3300047472 Ga0495686_0005217 Ga0495686_0005217_1211_2365 363
258 3300053125 Ga0500618_000240 Ga0500618_000240_37919_39070 363
259 3300053136 Ga0500559_0000031 Ga0500559_0000031_76477_77628 363
260 3300053136 Ga0500559_0004426 Ga0500559_0004426_2468_3619 363
261 iso_pu_bacteria 2510917020 2511120862 363
262 iso_pu_bacteria 2582581280 2585155355 363
263 iso_pu_bacteria 2582581293 2585198919 363
264 iso_pu_bacteria 2643221545 2643748266 363
265 iso_pu_bacteria 2643221552 2643779081 363
266 iso_pu_bacteria 2643221583 2643925431 363
267 iso_pu_bacteria 2643221584 2643927648 363
268 iso_pu_bacteria 2643221691 2644508011 363
269 iso_pu_bacteria 2791355048 2792460906 363
270 iso_pu_bacteria 2818991435 2819539588 363
271 iso_pu_bacteria 2818991454 2819648796 363
272 iso_pu_bacteria 2843744320 2843747714 363
273 iso_pu_bacteria 2849560528 2849565414 363
274 iso_pu_bacteria 2849573788 2849578357 363
275 iso_pu_bacteria 2851153111 2851153865 363
276 iso_pu_bacteria 2898329390 2898329460 363
277 3300006186 Ga0075369_10001558 Ga0075369_100015585 364
278 3300013100 Ga0157373_10017452 Ga0157373_100174523 364
279 3300048927 Ga0496124_0014279 Ga0496124_0014279_3535_4689 364
280 iso_pu_bacteria 2830075706 2830075982 364
281 iso_pu_bacteria 2857504554 2857507833 364
282 iso_pu_bacteria 2928531327 2928535436 364
283 3300001989 JGI24739J22299_10005561 JGI24739J22299_100055611 365
284 3300001990 JGI24737J22298_10002967 JGI24737J22298_100029673 365
285 3300002075 JGI24738J21930_10003280 JGI24738J21930_100032802 365
286 3300005327 Ga0070658_10000292 Ga0070658_1000029217 365
287 3300005329 Ga0070683_100011044 Ga0070683_1000110442 365
288 3300005335 Ga0070666_10005004 Ga0070666_100050042 365
289 3300005339 Ga0070660_100000655 Ga0070660_1000006552 365
290 3300005344 Ga0070661_100000138 Ga0070661_10000013835 365
291 3300005355 Ga0070671_100013927 Ga0070671_1000139273 365
292 3300005364 Ga0070673_100133797 Ga0070673_1001337972 365
293 3300005366 Ga0070659_100000081 Ga0070659_10000008140 365
294 3300005367 Ga0070667_100005341 Ga0070667_1000053417 365
295 3300005455 Ga0070663_100050187 Ga0070663_1000501872 365
296 3300005457 Ga0070662_100000025 Ga0070662_1000000253 365
297 3300005535 Ga0070684_100003050 Ga0070684_1000030504 365
298 3300005539 Ga0068853_100001144 Ga0068853_1000011449 365
299 3300005548 Ga0070665_100011521 Ga0070665_1000115214 365
300 3300005563 Ga0068855_100000503 Ga0068855_10000050317 365
301 3300005564 Ga0070664_100000012 Ga0070664_100000012101 365
302 3300005614 Ga0068856_100000163 Ga0068856_10000016346 365
303 3300005616 Ga0068852_100000426 Ga0068852_1000004267 365
304 3300005618 Ga0068864_100040889 Ga0068864_1000408893 365
305 3300005834 Ga0068851_10009355 Ga0068851_100093552 365
306 3300005841 Ga0068863_100186222 Ga0068863_1001862222 365
307 3300005842 Ga0068858_100026543 Ga0068858_1000265432 365
308 3300006237 Ga0097621_100026395 Ga0097621_1000263953 365
309 3300006358 Ga0068871_100061457 Ga0068871_1000614572 365
310 3300009177 Ga0105248_10000299 Ga0105248_1000029929 365
311 3300013102 Ga0157371_10001635 Ga0157371_1000163513 365
312 3300014325 Ga0163163_10046166 Ga0163163_100461662 365
313 3300025903 Ga0207680_10036142 Ga0207680_100361422 365
314 3300025904 Ga0207647_10053659 Ga0207647_100536592 365
315 3300025909 Ga0207705_10000095 Ga0207705_1000009531 365
316 3300025919 Ga0207657_10000028 Ga0207657_1000002824 365
317 3300025920 Ga0207649_10000014 Ga0207649_10000014210 365
318 3300025931 Ga0207644_10103806 Ga0207644_101038062 365
319 3300025932 Ga0207690_10000042 Ga0207690_1000004269 365
320 3300025933 Ga0207706_10000029 Ga0207706_1000002929 365
321 3300025941 Ga0207711_10000751 Ga0207711_1000075115 365
322 3300025944 Ga0207661_10001533 Ga0207661_100015334 365
323 3300025945 Ga0207679_10002058 Ga0207679_100020587 365
324 3300025949 Ga0207667_10027304 Ga0207667_100273042 365
325 3300025986 Ga0207658_10001237 Ga0207658_1000123712 365
326 3300026035 Ga0207703_10234025 Ga0207703_102340251 365
327 3300026041 Ga0207639_10000766 Ga0207639_100007664 365
328 3300026067 Ga0207678_10070702 Ga0207678_100707021 365
329 3300026078 Ga0207702_10001460 Ga0207702_100014602 365
330 3300026088 Ga0207641_10165112 Ga0207641_101651122 365
331 3300026095 Ga0207676_10256544 Ga0207676_102565442 365
332 3300026142 Ga0207698_10007023 Ga0207698_100070232 365
333 3300028379 Ga0268266_10032962 Ga0268266_100329624 365
334 3300035691 Ga0373931_0026000 Ga0373931_0026000_309_1448 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

78

412

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9703 10 362
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9592 10 362
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9554 7 363
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.9522 27 364
1ns7-assembly1.cif.gz_A crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose 0.951 10 364
ID Description Score Start End Superfamily
af_Q66HG4_1_342_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9665 10 362 2.70.98.10
af_Q9VP02_15_358_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9648 23 362 2.70.98.10
af_P0A9C3_9_344_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9567 19 361 2.70.98.10
af_I1KJ59_42_349_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9559 56 362 2.70.98.10
4rnlC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9555 10 363 2.70.98.10
ID Description Score Start End GO Terms
AF-T0H0Y2-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9925 19 364 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A520I3Q9-F1-model_v4 Galactose mutarotase 0.991 133 364 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A520J9B2-F1-model_v4 Galactose mutarotase 0.991 142 364 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-T0H0Y2-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9896 19 364 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A519PJH1-F1-model_v4 Galactose-1-epimerase 0.9882 174 364 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499

Feature Viewer

pLDDT pTM Quality
92.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map