F411791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 211 | 292 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10017452|Ga0157373_100174523 |
| Length | 418 |
| Sequence | LLPPFFDFAGLLPLPFLSDYIPVAAPSTNGMMEGKAMTIIRALSLLAGAALIAVPQMASAVTVKRTSFGKLSTGQEVDAFTLTNSHGVSAKVITLGATLQSLIAPDRAGKKADVALGFPDAAAYEDHGSYFGVSVGRYANRIADGRFALDGKAYQLAKNNNGVAALHGGERGFDKHVWKVLEVKGGKVASVTLGLTSPNGDQGYPGTLTVSVTYSLDEANNLKVDYRARTDRPTIVNLTSHGLYNMAGEGSADGAMGNRLTILADRYTPVDANLIPTGQLTPVAGTAFDFRTPKLVKTRLRDASDPQVVLGRGFDHNYVLRGKSGGAPRLIAVLDDPASGRRMELLSDQPGVQLYTGNFIDGTTVGKSGKIYRQGDGIALEPQHYPDSPNRPEFPSVRLDPGQEYRNVMIFRMGVSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 11 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 12 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 13 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 14 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 15 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 16 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 17 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 18 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 19 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 20 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 21 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 22 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 23 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 24 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 28 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 29 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 30 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 31 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 32 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 33 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 34 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 35 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 39 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 40 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 136 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 172 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 193 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 194 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 196 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 200 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 201 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 204 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 206 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 207 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 208 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 209 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 210 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 211 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.43 |
| Metatranscriptomes | 0 |
| Isolates | 12.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.9 |
| Bulb | 0 |
| Endosphere | 22.75 |
| Nodule | 0.3 |
| Rhizoplane | 1.5 |
| Rhizosphere | 58.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005561 | 3300001989 | Bacteria | 4778 |
| 2 | JGI24737J22298_10002967 | 3300001990 | Bacteria | 6012 |
| 3 | JGI24738J21930_10003280 | 3300002075 | Bacteria | 4115 |
| 4 | JGI25156J39149_1001333 | 3300002705 | Bacteria | 10625 |
| 5 | JGI25157J39369_1005490 | 3300002741 | Bacteria | 2060 |
| 6 | rootL2_10001970 | 3300003322 | Bacteria | 1781 |
| 7 | rootL2_10075327 | 3300003322 | Bacteria | 7539 |
| 8 | Ga0055526_1001245 | 3300003771 | Bacteria | 18276 |
| 9 | Ga0055537_1000185 | 3300003773 | Bacteria | 46470 |
| 10 | Ga0055537_1000646 | 3300003773 | Bacteria | 18512 |
| 11 | Ga0055524_1004986 | 3300003775 | Bacteria | 6014 |
| 12 | Ga0055536_1000029 | 3300003781 | Bacteria | 157375 |
| 13 | Ga0055536_1000057 | 3300003781 | Bacteria | 104652 |
| 14 | Ga0055536_1000126 | 3300003781 | Bacteria | 65482 |
| 15 | Ga0055534_1000172 | 3300003784 | Bacteria | 47998 |
| 16 | Ga0055534_1000518 | 3300003784 | Bacteria | 20801 |
| 17 | Ga0055528_1009213 | 3300003790 | Bacteria | 4145 |
| 18 | Ga0055530_10000132 | 3300003791 | Bacteria | 65482 |
| 19 | Ga0055530_10000628 | 3300003791 | Bacteria | 30471 |
| 20 | Ga0055530_10000856 | 3300003791 | Bacteria | 25068 |
| 21 | Ga0055531_10000053 | 3300003794 | Bacteria | 124623 |
| 22 | Ga0065165_1000388 | 3300005262 | Bacteria | 71380 |
| 23 | Ga0065165_1002943 | 3300005262 | Bacteria | 12977 |
| 24 | Ga0070658_10000292 | 3300005327 | Bacteria | 43714 |
| 25 | Ga0070683_100011044 | 3300005329 | Bacteria | 7784 |
| 26 | Ga0070666_10005004 | 3300005335 | Bacteria | 8106 |
| 27 | Ga0070660_100000655 | 3300005339 | Bacteria | 22906 |
| 28 | Ga0070661_100000138 | 3300005344 | Bacteria | 61062 |
| 29 | Ga0070671_100013927 | 3300005355 | Bacteria | 6489 |
| 30 | Ga0070673_100133797 | 3300005364 | Bacteria | 2084 |
| 31 | Ga0070659_100000081 | 3300005366 | Bacteria | 73150 |
| 32 | Ga0070667_100005341 | 3300005367 | Bacteria | 10731 |
| 33 | Ga0070663_100050187 | 3300005455 | Bacteria | 2966 |
| 34 | Ga0070662_100000025 | 3300005457 | Bacteria | 87144 |
| 35 | Ga0070684_100003050 | 3300005535 | Bacteria | 12497 |
| 36 | Ga0068853_100001144 | 3300005539 | Bacteria | 18799 |
| 37 | Ga0070665_100011521 | 3300005548 | Bacteria | 8941 |
| 38 | Ga0070665_100097876 | 3300005548 | Bacteria | 2939 |
| 39 | Ga0068855_100000503 | 3300005563 | Bacteria | 48317 |
| 40 | Ga0070664_100000012 | 3300005564 | Bacteria | 162011 |
| 41 | Ga0068854_100168680 | 3300005578 | Bacteria | 1701 |
| 42 | Ga0068856_100000163 | 3300005614 | Bacteria | 68963 |
| 43 | Ga0068856_100004505 | 3300005614 | Bacteria | 13850 |
| 44 | Ga0068852_100000160 | 3300005616 | Bacteria | 44946 |
| 45 | Ga0068852_100000426 | 3300005616 | Bacteria | 28017 |
| 46 | Ga0068864_100040889 | 3300005618 | Bacteria | 3965 |
| 47 | Ga0068851_10009355 | 3300005834 | Bacteria | 4553 |
| 48 | Ga0068863_100186222 | 3300005841 | Bacteria | 1994 |
| 49 | Ga0068858_100026543 | 3300005842 | Bacteria | 5380 |
| 50 | Ga0075369_10001558 | 3300006186 | Bacteria | 7854 |
| 51 | Ga0075366_10005939 | 3300006195 | Bacteria | 6642 |
| 52 | Ga0097621_100026395 | 3300006237 | Bacteria | 4556 |
| 53 | Ga0068871_100061457 | 3300006358 | Bacteria | 3068 |
| 54 | Ga0075430_100068675 | 3300006846 | Bacteria | 2973 |
| 55 | Ga0075433_10037406 | 3300006852 | Bacteria | 4187 |
| 56 | Ga0105247_10145805 | 3300009101 | Bacteria | 1556 |
| 57 | Ga0105243_10236015 | 3300009148 | Bacteria | 1625 |
| 58 | Ga0105248_10000299 | 3300009177 | Bacteria | 58871 |
| 59 | Ga0157373_10017452 | 3300013100 | Bacteria | 5227 |
| 60 | Ga0157371_10001635 | 3300013102 | Bacteria | 22933 |
| 61 | Ga0157369_10006638 | 3300013105 | Bacteria | 13382 |
| 62 | Ga0157375_10111685 | 3300013308 | Bacteria | 2832 |
| 63 | Ga0163163_10046166 | 3300014325 | Bacteria | 4278 |
| 64 | Ga0157380_10007320 | 3300014326 | Bacteria | 7834 |
| 65 | Ga0182006_1000404 | 3300015261 | Bacteria | 35006 |
| 66 | Ga0183369_1011 | 3300015685 | Bacteria | 252490 |
| 67 | Ga0163161_10106763 | 3300017792 | Bacteria | 2089 |
| 68 | Ga0209026_1001418 | 3300025250 | Bacteria | 10650 |
| 69 | Ga0209759_1001831 | 3300025256 | Bacteria | 10671 |
| 70 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 71 | Ga0209565_1000049 | 3300025263 | Bacteria | 224447 |
| 72 | Ga0209565_1000118 | 3300025263 | Bacteria | 113196 |
| 73 | Ga0209673_1000237 | 3300025273 | Bacteria | 106342 |
| 74 | Ga0209673_1001150 | 3300025273 | Bacteria | 28906 |
| 75 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 76 | Ga0209675_1002511 | 3300025291 | Bacteria | 9377 |
| 77 | Ga0209675_1003189 | 3300025291 | Bacteria | 7954 |
| 78 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 79 | Ga0209676_1000031 | 3300025292 | Bacteria | 478976 |
| 80 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 81 | Ga0209564_1000490 | 3300025295 | Bacteria | 65811 |
| 82 | Ga0209564_1001385 | 3300025295 | Bacteria | 25288 |
| 83 | Ga0209564_1004581 | 3300025295 | Bacteria | 8370 |
| 84 | Ga0209758_1000835 | 3300025297 | Bacteria | 42973 |
| 85 | Ga0209758_1001149 | 3300025297 | Bacteria | 33877 |
| 86 | Ga0209758_1022182 | 3300025297 | Bacteria | 2926 |
| 87 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 88 | Ga0209050_1000087 | 3300025298 | Bacteria | 261460 |
| 89 | Ga0209050_1000096 | 3300025298 | Bacteria | 240109 |
| 90 | Ga0209256_1000962 | 3300025299 | Bacteria | 34745 |
| 91 | Ga0209256_1002953 | 3300025299 | Bacteria | 12752 |
| 92 | Ga0209256_1015656 | 3300025299 | Bacteria | 2638 |
| 93 | Ga0209256_1016303 | 3300025299 | Bacteria | 2542 |
| 94 | Ga0209051_1002432 | 3300025303 | Bacteria | 13380 |
| 95 | Ga0209051_1003501 | 3300025303 | Bacteria | 10266 |
| 96 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 97 | Ga0209257_1000050 | 3300025304 | Bacteria | 439325 |
| 98 | Ga0209257_1000506 | 3300025304 | Bacteria | 68402 |
| 99 | Ga0209257_1004058 | 3300025304 | Bacteria | 11755 |
| 100 | Ga0207680_10036142 | 3300025903 | Bacteria | 2843 |
| 101 | Ga0207647_10053659 | 3300025904 | Bacteria | 2483 |
| 102 | Ga0207705_10000095 | 3300025909 | Bacteria | 106506 |
| 103 | Ga0207657_10000028 | 3300025919 | Bacteria | 141576 |
| 104 | Ga0207649_10000014 | 3300025920 | Bacteria | 255001 |
| 105 | Ga0207644_10103806 | 3300025931 | Bacteria | 2139 |
| 106 | Ga0207690_10000042 | 3300025932 | Bacteria | 120002 |
| 107 | Ga0207706_10000029 | 3300025933 | Bacteria | 146113 |
| 108 | Ga0207711_10000751 | 3300025941 | Bacteria | 31798 |
| 109 | Ga0207661_10001533 | 3300025944 | Bacteria | 15692 |
| 110 | Ga0207679_10002058 | 3300025945 | Bacteria | 12483 |
| 111 | Ga0207667_10027304 | 3300025949 | Bacteria | 6216 |
| 112 | Ga0207640_10133883 | 3300025981 | Bacteria | 1796 |
| 113 | Ga0207658_10001237 | 3300025986 | Bacteria | 20199 |
| 114 | Ga0207703_10234025 | 3300026035 | Bacteria | 1648 |
| 115 | Ga0207639_10000766 | 3300026041 | Bacteria | 21916 |
| 116 | Ga0207678_10070702 | 3300026067 | Bacteria | 2992 |
| 117 | Ga0207702_10000037 | 3300026078 | Bacteria | 153366 |
| 118 | Ga0207702_10001460 | 3300026078 | Bacteria | 23509 |
| 119 | Ga0207702_10133028 | 3300026078 | Bacteria | 2240 |
| 120 | Ga0207641_10165112 | 3300026088 | Bacteria | 2016 |
| 121 | Ga0207676_10256544 | 3300026095 | Bacteria | 1576 |
| 122 | Ga0207698_10000077 | 3300026142 | Bacteria | 65551 |
| 123 | Ga0207698_10007023 | 3300026142 | Bacteria | 7052 |
| 124 | Ga0268266_10032962 | 3300028379 | Bacteria | 4403 |
| 125 | Ga0307517_10000875 | 3300028786 | Bacteria | 51286 |
| 126 | Ga0307515_10021092 | 3300028794 | Bacteria | 11572 |
| 127 | Ga0307515_10036405 | 3300028794 | Bacteria | 7961 |
| 128 | Ga0316181_1042074 | 3300030744 | Bacteria | 3262 |
| 129 | Ga0373931_0026000 | 3300035691 | Bacteria | 2975 |
| 130 | Ga0395900_0000679 | 3300037418 | Bacteria | 45322 |
| 131 | Ga0395898_0023460 | 3300037466 | Bacteria | 6234 |
| 132 | Ga0395905_0000231 | 3300037471 | Bacteria | 84714 |
| 133 | Ga0395905_0350926 | 3300037471 | Bacteria | 1367 |
| 134 | Ga0395901_0000388 | 3300038443 | Bacteria | 52630 |
| 135 | Ga0451797_0750065 | 3300041453 | Bacteria | 3085 |
| 136 | Ga0451853_1471405 | 3300041512 | Bacteria | 1962 |
| 137 | Ga0439435_0010563 | 3300042436 | Bacteria | 2194 |
| 138 | Ga0466965_0123336 | 3300044683 | Bacteria | 1339 |
| 139 | Ga0466966_0022012 | 3300044684 | Bacteria | 4185 |
| 140 | Ga0466961_0026330 | 3300044693 | Bacteria | 3738 |
| 141 | Ga0466971_0006998 | 3300044719 | Bacteria | 4909 |
| 142 | Ga0466970_0025441 | 3300044765 | Bacteria | 3099 |
| 143 | Ga0466960_0044791 | 3300044901 | Bacteria | 2111 |
| 144 | Ga0466959_0002727 | 3300045049 | Bacteria | 11359 |
| 145 | Ga0466958_0004967 | 3300045836 | Bacteria | 7095 |
| 146 | Ga0466958_0007491 | 3300045836 | Bacteria | 6008 |
| 147 | Ga0466958_0067600 | 3300045836 | Bacteria | 2183 |
| 148 | Ga0466967_0011621 | 3300045976 | Bacteria | 6685 |
| 149 | Ga0466967_0227096 | 3300045976 | Bacteria | 1776 |
| 150 | Ga0495627_000185 | 3300046453 | Bacteria | 69533 |
| 151 | Ga0495627_001767 | 3300046453 | Bacteria | 11624 |
| 152 | Ga0495590_0001569 | 3300046457 | Bacteria | 9791 |
| 153 | Ga0495638_0000849 | 3300046460 | Bacteria | 31864 |
| 154 | Ga0495638_0001016 | 3300046460 | Bacteria | 27896 |
| 155 | Ga0495638_0001206 | 3300046460 | Bacteria | 24684 |
| 156 | Ga0495638_0002055 | 3300046460 | Bacteria | 17094 |
| 157 | Ga0495638_0012117 | 3300046460 | Bacteria | 5921 |
| 158 | Ga0495638_0015079 | 3300046460 | Bacteria | 5199 |
| 159 | Ga0495638_0016808 | 3300046460 | Bacteria | 4892 |
| 160 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 161 | Ga0495650_0000069 | 3300046471 | Bacteria | 261124 |
| 162 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 163 | Ga0495606_0004031 | 3300046507 | Bacteria | 14979 |
| 164 | Ga0495606_0004595 | 3300046507 | Bacteria | 13684 |
| 165 | Ga0495610_0000176 | 3300046512 | Bacteria | 71110 |
| 166 | Ga0495610_0000378 | 3300046512 | Bacteria | 45991 |
| 167 | Ga0495610_0001716 | 3300046512 | Bacteria | 19206 |
| 168 | Ga0495610_0002127 | 3300046512 | Bacteria | 16847 |
| 169 | Ga0495610_0004554 | 3300046512 | Bacteria | 10194 |
| 170 | Ga0495620_0028976 | 3300046515 | Bacteria | 2568 |
| 171 | Ga0495631_0007881 | 3300046518 | Bacteria | 5394 |
| 172 | Ga0495637_0001982 | 3300046520 | Bacteria | 11580 |
| 173 | Ga0495637_0010675 | 3300046520 | Bacteria | 4433 |
| 174 | Ga0495637_0018199 | 3300046520 | Bacteria | 3261 |
| 175 | Ga0495637_0025604 | 3300046520 | Bacteria | 2657 |
| 176 | Ga0495643_0000086 | 3300046522 | Bacteria | 156793 |
| 177 | Ga0495643_0052247 | 3300046522 | Bacteria | 2195 |
| 178 | Ga0495648_0000229 | 3300046524 | Bacteria | 64205 |
| 179 | Ga0495648_0008946 | 3300046524 | Bacteria | 7827 |
| 180 | Ga0495648_0051702 | 3300046524 | Bacteria | 2501 |
| 181 | Ga0495663_0013718 | 3300046525 | Bacteria | 2267 |
| 182 | Ga0495654_0000012 | 3300046530 | Bacteria | 328997 |
| 183 | Ga0495654_0000285 | 3300046530 | Bacteria | 46016 |
| 184 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 185 | Ga0495668_0004598 | 3300046616 | Bacteria | 9710 |
| 186 | Ga0495668_0013068 | 3300046616 | Bacteria | 4913 |
| 187 | Ga0495625_0000011 | 3300046660 | Bacteria | 377120 |
| 188 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 189 | Ga0495625_0000721 | 3300046660 | Bacteria | 46512 |
| 190 | Ga0495625_0001867 | 3300046660 | Bacteria | 23949 |
| 191 | Ga0495625_0003460 | 3300046660 | Bacteria | 15720 |
| 192 | Ga0495625_0005726 | 3300046660 | Bacteria | 11236 |
| 193 | Ga0495625_0007875 | 3300046660 | Bacteria | 9178 |
| 194 | Ga0495625_0026904 | 3300046660 | Bacteria | 4337 |
| 195 | Ga0495625_0035932 | 3300046660 | Bacteria | 3646 |
| 196 | Ga0495625_0047259 | 3300046660 | Bacteria | 3103 |
| 197 | Ga0495625_0083842 | 3300046660 | Bacteria | 2214 |
| 198 | Ga0495589_0005938 | 3300046794 | Bacteria | 6446 |
| 199 | Ga0495660_0002223 | 3300046810 | Bacteria | 12490 |
| 200 | Ga0495660_0061981 | 3300046810 | Bacteria | 2006 |
| 201 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 202 | Ga0495672_0000663 | 3300047320 | Bacteria | 38282 |
| 203 | Ga0495672_0000665 | 3300047320 | Bacteria | 38253 |
| 204 | Ga0495679_006783 | 3300047446 | Bacteria | 4874 |
| 205 | Ga0495679_009469 | 3300047446 | Bacteria | 3899 |
| 206 | Ga0495673_0000039 | 3300047469 | Bacteria | 301943 |
| 207 | Ga0495673_0000056 | 3300047469 | Bacteria | 245918 |
| 208 | Ga0495673_0000225 | 3300047469 | Bacteria | 83589 |
| 209 | Ga0495673_0000887 | 3300047469 | Bacteria | 27526 |
| 210 | Ga0495673_0001625 | 3300047469 | Bacteria | 17407 |
| 211 | Ga0495673_0001751 | 3300047469 | Bacteria | 16546 |
| 212 | Ga0495686_0000161 | 3300047472 | Bacteria | 126951 |
| 213 | Ga0495686_0001667 | 3300047472 | Bacteria | 23087 |
| 214 | Ga0495686_0001697 | 3300047472 | Bacteria | 22775 |
| 215 | Ga0495686_0003356 | 3300047472 | Bacteria | 13952 |
| 216 | Ga0495686_0005217 | 3300047472 | Bacteria | 10331 |
| 217 | Ga0495686_0011462 | 3300047472 | Bacteria | 6243 |
| 218 | Ga0495686_0032226 | 3300047472 | Bacteria | 3393 |
| 219 | Ga0495686_0038425 | 3300047472 | Bacteria | 3061 |
| 220 | Ga0495686_0111437 | 3300047472 | Bacteria | 1640 |
| 221 | Ga0496106_0170483 | 3300048909 | Bacteria | 1725 |
| 222 | Ga0496107_0000395 | 3300048910 | Bacteria | 23591 |
| 223 | Ga0496107_0000515 | 3300048910 | Bacteria | 21514 |
| 224 | Ga0496115_0013355 | 3300048918 | Bacteria | 6212 |
| 225 | Ga0496117_0007562 | 3300048920 | Bacteria | 10581 |
| 226 | Ga0496117_0078331 | 3300048920 | Bacteria | 2182 |
| 227 | Ga0496118_0000110 | 3300048921 | Bacteria | 152891 |
| 228 | Ga0496121_0005998 | 3300048924 | Bacteria | 15336 |
| 229 | Ga0496121_0007177 | 3300048924 | Bacteria | 13499 |
| 230 | Ga0496121_0028182 | 3300048924 | Bacteria | 5234 |
| 231 | Ga0496121_0040557 | 3300048924 | Bacteria | 4082 |
| 232 | Ga0496121_0190434 | 3300048924 | Bacteria | 1471 |
| 233 | Ga0496122_0000203 | 3300048925 | Bacteria | 132679 |
| 234 | Ga0496123_0000164 | 3300048926 | Bacteria | 132565 |
| 235 | Ga0496123_0010263 | 3300048926 | Bacteria | 8307 |
| 236 | Ga0496124_0000393 | 3300048927 | Bacteria | 79747 |
| 237 | Ga0496124_0014279 | 3300048927 | Bacteria | 7688 |
| 238 | Ga0496124_0015679 | 3300048927 | Bacteria | 7249 |
| 239 | Ga0496124_0165683 | 3300048927 | Bacteria | 1718 |
| 240 | Ga0496124_0220634 | 3300048927 | Bacteria | 1426 |
| 241 | Ga0496125_0000144 | 3300048928 | Bacteria | 156270 |
| 242 | Ga0496125_0016889 | 3300048928 | Bacteria | 6987 |
| 243 | Ga0496125_0040582 | 3300048928 | Bacteria | 3990 |
| 244 | Ga0496125_0041373 | 3300048928 | Bacteria | 3940 |
| 245 | Ga0496126_0023320 | 3300048929 | Bacteria | 5997 |
| 246 | Ga0495678_001659 | 3300049459 | Bacteria | 16921 |
| 247 | Ga0501032_0102096 | 3300049569 | Bacteria | 1900 |
| 248 | Ga0501033_0006715 | 3300049570 | Bacteria | 8990 |
| 249 | Ga0501033_0208965 | 3300049570 | Bacteria | 1392 |
| 250 | Ga0501034_0192814 | 3300049571 | Bacteria | 1999 |
| 251 | Ga0501039_0114159 | 3300049575 | Bacteria | 2113 |
| 252 | Ga0501046_0007503 | 3300049580 | Bacteria | 9571 |
| 253 | Ga0501048_0149071 | 3300049582 | Bacteria | 1654 |
| 254 | Ga0501070_0019294 | 3300049586 | Bacteria | 5718 |
| 255 | Ga0501080_0113990 | 3300049742 | Bacteria | 2506 |
| 256 | Ga0501035_0032266 | 3300049822 | Bacteria | 4766 |
| 257 | Ga0501035_0037446 | 3300049822 | Bacteria | 4392 |
| 258 | Ga0501044_0013590 | 3300049823 | Bacteria | 8798 |
| 259 | Ga0501044_0027953 | 3300049823 | Bacteria | 5953 |
| 260 | Ga0501044_0191200 | 3300049823 | Bacteria | 2009 |
| 261 | Ga0501044_0196190 | 3300049823 | Bacteria | 1979 |
| 262 | nmdc:mga0qj67_137336_c1 | 3300050509 | Bacteria | 1981 |
| 263 | nmdc:mga0a205_22944_c1 | 3300050515 | Bacteria | 5917 |
| 264 | Ga0500578_0000030 | 3300053086 | Bacteria | 140063 |
| 265 | Ga0500578_0061013 | 3300053086 | Bacteria | 2408 |
| 266 | Ga0500643_031646 | 3300053087 | Bacteria | 1611 |
| 267 | Ga0500644_0000122 | 3300053088 | Bacteria | 48036 |
| 268 | Ga0500644_0006741 | 3300053088 | Bacteria | 2959 |
| 269 | Ga0500554_001021 | 3300053102 | Bacteria | 5448 |
| 270 | Ga0500554_023315 | 3300053102 | Bacteria | 1739 |
| 271 | Ga0500556_0001162 | 3300053104 | Bacteria | 12663 |
| 272 | Ga0500556_0001490 | 3300053104 | Bacteria | 9718 |
| 273 | Ga0500562_000331 | 3300053108 | Bacteria | 11349 |
| 274 | Ga0500594_0000077 | 3300053118 | Bacteria | 30827 |
| 275 | Ga0500608_000004 | 3300053122 | Bacteria | 108109 |
| 276 | Ga0500614_010548 | 3300053123 | Bacteria | 1986 |
| 277 | Ga0500618_000024 | 3300053125 | Bacteria | 152149 |
| 278 | Ga0500618_000240 | 3300053125 | Bacteria | 43528 |
| 279 | Ga0500658_0002525 | 3300053134 | Bacteria | 7088 |
| 280 | Ga0500559_0000015 | 3300053136 | Bacteria | 158494 |
| 281 | Ga0500559_0000031 | 3300053136 | Bacteria | 114782 |
| 282 | Ga0500559_0004426 | 3300053136 | Bacteria | 6675 |
| 283 | Ga0500559_0004723 | 3300053136 | Bacteria | 6407 |
| 284 | Ga0500564_000014 | 3300053138 | Bacteria | 53518 |
| 285 | Ga0500573_0016155 | 3300053140 | Bacteria | 4235 |
| 286 | Ga0500577_0005521 | 3300053142 | Bacteria | 3416 |
| 287 | Ga0500622_0000867 | 3300053156 | Bacteria | 25738 |
| 288 | Ga0500622_0011947 | 3300053156 | Bacteria | 4722 |
| 289 | Ga0500622_0068438 | 3300053156 | Bacteria | 1799 |
| 290 | Ga0500611_004229 | 3300053727 | Bacteria | 1920 |
| 291 | Ga0500645_003955 | 3300053730 | Bacteria | 5836 |
| 292 | Ga0466962_0004700 | 3300061719 | Bacteria | 6560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0007177 | Ga0496121_0007177_24_953 | 303 |
| 2 | 3300037471 | Ga0395905_0350926 | Ga0395905_0350926_76_1167 | 316 |
| 3 | 3300044693 | Ga0466961_0026330 | Ga0466961_0026330_2623_3714 | 316 |
| 4 | 3300005616 | Ga0068852_100000160 | Ga0068852_10000016046 | 320 |
| 5 | 3300026142 | Ga0207698_10000077 | Ga0207698_1000007727 | 320 |
| 6 | 3300026078 | Ga0207702_10133028 | Ga0207702_101330282 | 321 |
| 7 | 3300025299 | Ga0209256_1015656 | Ga0209256_10156562 | 323 |
| 8 | 3300049822 | Ga0501035_0037446 | Ga0501035_0037446_14_1072 | 325 |
| 9 | 3300044719 | Ga0466971_0006998 | Ga0466971_0006998_289_1410 | 326 |
| 10 | 3300045836 | Ga0466958_0004967 | Ga0466958_0004967_5814_6935 | 326 |
| 11 | 3300045976 | Ga0466967_0227096 | Ga0466967_0227096_514_1635 | 326 |
| 12 | 3300003781 | Ga0055536_1000029 | Ga0055536_100002990 | 328 |
| 13 | 3300003791 | Ga0055530_10000628 | Ga0055530_1000062811 | 328 |
| 14 | 3300025292 | Ga0209676_1000057 | Ga0209676_1000057188 | 328 |
| 15 | 3300025298 | Ga0209050_1000096 | Ga0209050_100009685 | 328 |
| 16 | 3300025303 | Ga0209051_1002432 | Ga0209051_10024328 | 328 |
| 17 | 3300037418 | Ga0395900_0000679 | Ga0395900_0000679_35548_36735 | 328 |
| 18 | 3300037466 | Ga0395898_0023460 | Ga0395898_0023460_1549_2736 | 328 |
| 19 | 3300037471 | Ga0395905_0000231 | Ga0395905_0000231_68714_69901 | 328 |
| 20 | 3300038443 | Ga0395901_0000388 | Ga0395901_0000388_45347_46534 | 328 |
| 21 | 3300044683 | Ga0466965_0123336 | Ga0466965_0123336_171_1316 | 328 |
| 22 | 3300044684 | Ga0466966_0022012 | Ga0466966_0022012_1324_2469 | 328 |
| 23 | 3300044765 | Ga0466970_0025441 | Ga0466970_0025441_165_1310 | 328 |
| 24 | 3300045049 | Ga0466959_0002727 | Ga0466959_0002727_678_1823 | 328 |
| 25 | 3300045836 | Ga0466958_0067600 | Ga0466958_0067600_81_1226 | 328 |
| 26 | 3300053140 | Ga0500573_0016155 | Ga0500573_0016155_1719_2714 | 330 |
| 27 | 3300041453 | Ga0451797_0750065 | Ga0451797_0750065_46_1107 | 332 |
| 28 | iso_pu_bacteria | 2857442823 | 2857443928 | 332 |
| 29 | 3300030744 | Ga0316181_1042074 | Ga0316181_10420743 | 334 |
| 30 | iso_pu_bacteria | 2739367898 | 2740168437 | 335 |
| 31 | 3300005262 | Ga0065165_1002943 | Ga0065165_10029438 | 337 |
| 32 | 3300005614 | Ga0068856_100004505 | Ga0068856_1000045052 | 337 |
| 33 | 3300013105 | Ga0157369_10006638 | Ga0157369_100066386 | 337 |
| 34 | 3300025295 | Ga0209564_1004581 | Ga0209564_10045813 | 337 |
| 35 | 3300026078 | Ga0207702_10000037 | Ga0207702_100000372 | 337 |
| 36 | 3300041512 | Ga0451853_1471405 | Ga0451853_1471405_205_1413 | 337 |
| 37 | 3300046616 | Ga0495668_0013068 | Ga0495668_0013068_2221_3429 | 337 |
| 38 | 3300053122 | Ga0500608_000004 | Ga0500608_000004_65225_66379 | 337 |
| 39 | 3300053156 | Ga0500622_0068438 | Ga0500622_0068438_381_1535 | 337 |
| 40 | 3300049569 | Ga0501032_0102096 | Ga0501032_0102096_724_1878 | 338 |
| 41 | 3300049571 | Ga0501034_0192814 | Ga0501034_0192814_164_1375 | 338 |
| 42 | 3300049575 | Ga0501039_0114159 | Ga0501039_0114159_321_1532 | 338 |
| 43 | 3300049580 | Ga0501046_0007503 | Ga0501046_0007503_5263_6474 | 338 |
| 44 | 3300049582 | Ga0501048_0149071 | Ga0501048_0149071_23_1177 | 338 |
| 45 | 3300003322 | rootL2_10001970 | rootL2_100019701 | 339 |
| 46 | 3300049570 | Ga0501033_0006715 | Ga0501033_0006715_1319_2524 | 339 |
| 47 | 3300042436 | Ga0439435_0010563 | Ga0439435_0010563_627_1835 | 340 |
| 48 | 3300046520 | Ga0495637_0018199 | Ga0495637_0018199_1245_2396 | 340 |
| 49 | 3300053104 | Ga0500556_0001162 | Ga0500556_0001162_6832_7983 | 340 |
| 50 | 3300025297 | Ga0209758_1000835 | Ga0209758_100083513 | 341 |
| 51 | 3300046525 | Ga0495663_0013718 | Ga0495663_0013718_113_1267 | 341 |
| 52 | 3300049742 | Ga0501080_0113990 | Ga0501080_0113990_1260_2414 | 341 |
| 53 | 3300049822 | Ga0501035_0032266 | Ga0501035_0032266_2451_3599 | 341 |
| 54 | 3300049823 | Ga0501044_0027953 | Ga0501044_0027953_1908_3056 | 341 |
| 55 | 3300049823 | Ga0501044_0191200 | Ga0501044_0191200_666_1886 | 341 |
| 56 | 3300002705 | JGI25156J39149_1001333 | JGI25156J39149_10013332 | 342 |
| 57 | 3300002741 | JGI25157J39369_1005490 | JGI25157J39369_10054902 | 342 |
| 58 | 3300005578 | Ga0068854_100168680 | Ga0068854_1001686802 | 342 |
| 59 | 3300025250 | Ga0209026_1001418 | Ga0209026_10014182 | 342 |
| 60 | 3300025256 | Ga0209759_1001831 | Ga0209759_10018317 | 342 |
| 61 | 3300025981 | Ga0207640_10133883 | Ga0207640_101338832 | 342 |
| 62 | 3300044901 | Ga0466960_0044791 | Ga0466960_0044791_743_1783 | 342 |
| 63 | 3300049586 | Ga0501070_0019294 | Ga0501070_0019294_2732_3790 | 342 |
| 64 | 3300049823 | Ga0501044_0196190 | Ga0501044_0196190_148_1293 | 342 |
| 65 | iso_pu_bacteria | 2643221641 | 2644229519 | 342 |
| 66 | iso_pu_bacteria | 8054609563 | 8054611546 | 342 |
| 67 | 3300025299 | Ga0209256_1000962 | Ga0209256_10009628 | 343 |
| 68 | 3300025304 | Ga0209257_1000506 | Ga0209257_100050627 | 343 |
| 69 | 3300053102 | Ga0500554_023315 | Ga0500554_023315_180_1346 | 344 |
| 70 | iso_pu_bacteria | 2984576629 | 2984577333 | 344 |
| 71 | iso_pu_bacteria | 2990256926 | 2990259494 | 344 |
| 72 | 3300005262 | Ga0065165_1000388 | Ga0065165_100038859 | 345 |
| 73 | 3300025295 | Ga0209564_1001385 | Ga0209564_100138520 | 345 |
| 74 | 3300049570 | Ga0501033_0208965 | Ga0501033_0208965_301_1338 | 345 |
| 75 | 3300003771 | Ga0055526_1001245 | Ga0055526_100124517 | 346 |
| 76 | 3300003773 | Ga0055537_1000185 | Ga0055537_10001851 | 346 |
| 77 | 3300003781 | Ga0055536_1000126 | Ga0055536_10001265 | 346 |
| 78 | 3300003784 | Ga0055534_1000172 | Ga0055534_10001726 | 346 |
| 79 | 3300003784 | Ga0055534_1000518 | Ga0055534_100051812 | 346 |
| 80 | 3300003791 | Ga0055530_10000132 | Ga0055530_100001325 | 346 |
| 81 | 3300005548 | Ga0070665_100097876 | Ga0070665_1000978762 | 346 |
| 82 | 3300015261 | Ga0182006_1000404 | Ga0182006_100040413 | 346 |
| 83 | 3300025263 | Ga0209565_1000024 | Ga0209565_100002486 | 346 |
| 84 | 3300025273 | Ga0209673_1000237 | Ga0209673_100023760 | 346 |
| 85 | 3300025291 | Ga0209675_1000011 | Ga0209675_100001124 | 346 |
| 86 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011377 | 346 |
| 87 | 3300025295 | Ga0209564_1000490 | Ga0209564_100049040 | 346 |
| 88 | 3300025298 | Ga0209050_1000032 | Ga0209050_1000032256 | 346 |
| 89 | 3300025303 | Ga0209051_1003501 | Ga0209051_10035018 | 346 |
| 90 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014436 | 346 |
| 91 | 3300025304 | Ga0209257_1004058 | Ga0209257_10040583 | 346 |
| 92 | 3300048926 | Ga0496123_0010263 | Ga0496123_0010263_393_1538 | 346 |
| 93 | 3300048927 | Ga0496124_0015679 | Ga0496124_0015679_472_1617 | 346 |
| 94 | 3300048928 | Ga0496125_0016889 | Ga0496125_0016889_1902_2990 | 346 |
| 95 | 3300048928 | Ga0496125_0041373 | Ga0496125_0041373_645_1790 | 346 |
| 96 | 3300017792 | Ga0163161_10106763 | Ga0163161_101067632 | 347 |
| 97 | 3300046460 | Ga0495638_0000849 | Ga0495638_0000849_1967_3082 | 347 |
| 98 | 3300015685 | Ga0183369_1011 | Ga0183369_1011217 | 348 |
| 99 | 3300025297 | Ga0209758_1022182 | Ga0209758_10221824 | 348 |
| 100 | 3300053136 | Ga0500559_0004723 | Ga0500559_0004723_3247_4365 | 348 |
| 101 | 3300053156 | Ga0500622_0011947 | Ga0500622_0011947_3255_4373 | 348 |
| 102 | 3300053087 | Ga0500643_031646 | Ga0500643_031646_32_1180 | 350 |
| 103 | 3300053088 | Ga0500644_0000122 | Ga0500644_0000122_36280_37428 | 350 |
| 104 | 3300046660 | Ga0495625_0000721 | Ga0495625_0000721_35292_36611 | 351 |
| 105 | 3300053104 | Ga0500556_0001490 | Ga0500556_0001490_8090_9229 | 353 |
| 106 | 3300053123 | Ga0500614_010548 | Ga0500614_010548_753_1886 | 353 |
| 107 | 3300053730 | Ga0500645_003955 | Ga0500645_003955_2968_4107 | 353 |
| 108 | 3300025263 | Ga0209565_1000049 | Ga0209565_1000049139 | 355 |
| 109 | 3300025291 | Ga0209675_1003189 | Ga0209675_10031897 | 355 |
| 110 | 3300025297 | Ga0209758_1001149 | Ga0209758_100114912 | 355 |
| 111 | 3300025299 | Ga0209256_1002953 | Ga0209256_100295310 | 355 |
| 112 | 3300025299 | Ga0209256_1016303 | Ga0209256_10163034 | 355 |
| 113 | 3300046507 | Ga0495606_0004595 | Ga0495606_0004595_12219_13343 | 355 |
| 114 | 3300046660 | Ga0495625_0007875 | Ga0495625_0007875_4543_5667 | 355 |
| 115 | 3300046810 | Ga0495660_0002223 | Ga0495660_0002223_5943_7076 | 355 |
| 116 | 3300048918 | Ga0496115_0013355 | Ga0496115_0013355_627_1757 | 355 |
| 117 | 3300053086 | Ga0500578_0061013 | Ga0500578_0061013_629_1753 | 355 |
| 118 | 3300053102 | Ga0500554_001021 | Ga0500554_001021_2737_3870 | 355 |
| 119 | iso_pu_bacteria | 2582581280 | 2585153580 | 355 |
| 120 | iso_pu_bacteria | 2582581293 | 2585197384 | 355 |
| 121 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_482971_484101 | 356 |
| 122 | 3300046512 | Ga0495610_0000176 | Ga0495610_0000176_60162_61301 | 356 |
| 123 | 3300046515 | Ga0495620_0028976 | Ga0495620_0028976_874_2004 | 356 |
| 124 | 3300046520 | Ga0495637_0010675 | Ga0495637_0010675_1088_2227 | 356 |
| 125 | 3300046522 | Ga0495643_0052247 | Ga0495643_0052247_254_1393 | 356 |
| 126 | 3300046524 | Ga0495648_0008946 | Ga0495648_0008946_2318_3448 | 356 |
| 127 | 3300046524 | Ga0495648_0051702 | Ga0495648_0051702_118_1317 | 356 |
| 128 | 3300046530 | Ga0495654_0000012 | Ga0495654_0000012_49412_50542 | 356 |
| 129 | 3300046660 | Ga0495625_0000011 | Ga0495625_0000011_339063_340226 | 356 |
| 130 | 3300046660 | Ga0495625_0026904 | Ga0495625_0026904_2880_4019 | 356 |
| 131 | 3300046660 | Ga0495625_0083842 | Ga0495625_0083842_414_1544 | 356 |
| 132 | 3300047320 | Ga0495672_0000665 | Ga0495672_0000665_10552_11691 | 356 |
| 133 | 3300047472 | Ga0495686_0001667 | Ga0495686_0001667_12353_13492 | 356 |
| 134 | 3300048909 | Ga0496106_0170483 | Ga0496106_0170483_395_1546 | 356 |
| 135 | 3300048910 | Ga0496107_0000395 | Ga0496107_0000395_17868_19022 | 356 |
| 136 | 3300048924 | Ga0496121_0005998 | Ga0496121_0005998_338_1492 | 356 |
| 137 | 3300053134 | Ga0500658_0002525 | Ga0500658_0002525_370_1509 | 356 |
| 138 | 3300003322 | rootL2_10075327 | rootL2_100753274 | 357 |
| 139 | 3300046460 | Ga0495638_0016808 | Ga0495638_0016808_100_1245 | 357 |
| 140 | 3300046512 | Ga0495610_0001716 | Ga0495610_0001716_14826_15947 | 357 |
| 141 | 3300046520 | Ga0495637_0025604 | Ga0495637_0025604_638_1759 | 357 |
| 142 | 3300046522 | Ga0495643_0000086 | Ga0495643_0000086_106079_107224 | 357 |
| 143 | 3300046524 | Ga0495648_0000229 | Ga0495648_0000229_36112_37260 | 357 |
| 144 | 3300047320 | Ga0495672_0000006 | Ga0495672_0000006_322517_323662 | 357 |
| 145 | 3300047469 | Ga0495673_0000056 | Ga0495673_0000056_175701_176822 | 357 |
| 146 | 3300047469 | Ga0495673_0000887 | Ga0495673_0000887_10592_11743 | 357 |
| 147 | 3300047472 | Ga0495686_0003356 | Ga0495686_0003356_12144_13289 | 357 |
| 148 | 3300047472 | Ga0495686_0111437 | Ga0495686_0111437_61_1182 | 357 |
| 149 | 3300048920 | Ga0496117_0007562 | Ga0496117_0007562_6055_7200 | 357 |
| 150 | 3300048921 | Ga0496118_0000110 | Ga0496118_0000110_69716_70861 | 357 |
| 151 | 3300048925 | Ga0496122_0000203 | Ga0496122_0000203_87181_88326 | 357 |
| 152 | 3300048926 | Ga0496123_0000164 | Ga0496123_0000164_44223_45368 | 357 |
| 153 | 3300048927 | Ga0496124_0000393 | Ga0496124_0000393_73574_74719 | 357 |
| 154 | 3300048928 | Ga0496125_0000144 | Ga0496125_0000144_98647_99792 | 357 |
| 155 | 3300053138 | Ga0500564_000014 | Ga0500564_000014_29445_30593 | 357 |
| 156 | 3300053142 | Ga0500577_0005521 | Ga0500577_0005521_676_1797 | 357 |
| 157 | iso_pu_bacteria | 2510917020 | 2511121484 | 357 |
| 158 | iso_pu_bacteria | 2643221545 | 2643751590 | 357 |
| 159 | iso_pu_bacteria | 2643221583 | 2643926078 | 357 |
| 160 | iso_pu_bacteria | 2643221691 | 2644511349 | 357 |
| 161 | iso_pu_bacteria | 2939589442 | 2939591605 | 357 |
| 162 | iso_pu_bacteria | 2939622612 | 2939623930 | 357 |
| 163 | iso_pu_bacteria | 2974307012 | 2974308859 | 357 |
| 164 | iso_pu_bacteria | 2977247770 | 2977249575 | 357 |
| 165 | iso_pu_bacteria | 2984514374 | 2984515933 | 357 |
| 166 | 3300006846 | Ga0075430_100068675 | Ga0075430_1000686752 | 358 |
| 167 | 3300006852 | Ga0075433_10037406 | Ga0075433_100374064 | 358 |
| 168 | 3300009101 | Ga0105247_10145805 | Ga0105247_101458051 | 358 |
| 169 | 3300014326 | Ga0157380_10007320 | Ga0157380_100073207 | 358 |
| 170 | 3300046453 | Ga0495627_000185 | Ga0495627_000185_64479_65603 | 358 |
| 171 | 3300046460 | Ga0495638_0002055 | Ga0495638_0002055_15559_16794 | 358 |
| 172 | 3300046460 | Ga0495638_0015079 | Ga0495638_0015079_139_1263 | 358 |
| 173 | 3300046506 | Ga0495583_0000029 | Ga0495583_0000029_114726_115880 | 358 |
| 174 | 3300046660 | Ga0495625_0001867 | Ga0495625_0001867_15909_17144 | 358 |
| 175 | 3300047446 | Ga0495679_009469 | Ga0495679_009469_1782_3095 | 358 |
| 176 | 3300047469 | Ga0495673_0001625 | Ga0495673_0001625_15476_16630 | 358 |
| 177 | 3300047472 | Ga0495686_0038425 | Ga0495686_0038425_1151_2287 | 358 |
| 178 | 3300048910 | Ga0496107_0000515 | Ga0496107_0000515_13454_14605 | 358 |
| 179 | 3300048924 | Ga0496121_0028182 | Ga0496121_0028182_252_1403 | 358 |
| 180 | 3300048924 | Ga0496121_0040557 | Ga0496121_0040557_2749_3990 | 358 |
| 181 | 3300048927 | Ga0496124_0165683 | Ga0496124_0165683_104_1246 | 358 |
| 182 | 3300050509 | nmdc:mga0qj67_137336_c1 | nmdc:mga0qj67_137336_c1_692_1915 | 358 |
| 183 | 3300050515 | nmdc:mga0a205_22944_c1 | nmdc:mga0a205_22944_c1_779_1963 | 358 |
| 184 | 3300053125 | Ga0500618_000024 | Ga0500618_000024_51859_53073 | 358 |
| 185 | 3300053136 | Ga0500559_0000015 | Ga0500559_0000015_7288_8439 | 358 |
| 186 | 3300003781 | Ga0055536_1000057 | Ga0055536_100005760 | 359 |
| 187 | 3300003791 | Ga0055530_10000856 | Ga0055530_100008568 | 359 |
| 188 | 3300003794 | Ga0055531_10000053 | Ga0055531_1000005387 | 359 |
| 189 | 3300006195 | Ga0075366_10005939 | Ga0075366_100059396 | 359 |
| 190 | 3300025292 | Ga0209676_1000031 | Ga0209676_1000031196 | 359 |
| 191 | 3300025298 | Ga0209050_1000087 | Ga0209050_100008776 | 359 |
| 192 | 3300025304 | Ga0209257_1000050 | Ga0209257_1000050234 | 359 |
| 193 | 3300045836 | Ga0466958_0007491 | Ga0466958_0007491_124_1251 | 359 |
| 194 | 3300045976 | Ga0466967_0011621 | Ga0466967_0011621_784_1911 | 359 |
| 195 | 3300048927 | Ga0496124_0220634 | Ga0496124_0220634_145_1284 | 359 |
| 196 | 3300048928 | Ga0496125_0040582 | Ga0496125_0040582_371_1510 | 359 |
| 197 | 3300048929 | Ga0496126_0023320 | Ga0496126_0023320_3455_4594 | 359 |
| 198 | 3300061719 | Ga0466962_0004700 | Ga0466962_0004700_2265_3392 | 359 |
| 199 | iso_pu_bacteria | 2585428106 | 2587916293 | 359 |
| 200 | iso_pu_bacteria | 2643221640 | 2644226198 | 359 |
| 201 | iso_pu_bacteria | 2643221642 | 2644235686 | 359 |
| 202 | 3300009148 | Ga0105243_10236015 | Ga0105243_102360152 | 360 |
| 203 | 3300013308 | Ga0157375_10111685 | Ga0157375_101116852 | 360 |
| 204 | 3300046616 | Ga0495668_0000019 | Ga0495668_0000019_285451_286596 | 360 |
| 205 | 3300048920 | Ga0496117_0078331 | Ga0496117_0078331_636_1760 | 360 |
| 206 | 3300048924 | Ga0496121_0190434 | Ga0496121_0190434_198_1337 | 360 |
| 207 | 3300049823 | Ga0501044_0013590 | Ga0501044_0013590_6204_7331 | 360 |
| 208 | iso_pu_bacteria | 2884960567 | 2884963655 | 360 |
| 209 | 3300047472 | Ga0495686_0000161 | Ga0495686_0000161_22245_23384 | 361 |
| 210 | 3300049459 | Ga0495678_001659 | Ga0495678_001659_3046_4173 | 361 |
| 211 | 3300053118 | Ga0500594_0000077 | Ga0500594_0000077_12478_13605 | 361 |
| 212 | iso_pu_bacteria | 2687453130 | 2687584875 | 361 |
| 213 | 3300028786 | Ga0307517_10000875 | Ga0307517_1000087520 | 362 |
| 214 | 3300028794 | Ga0307515_10036405 | Ga0307515_100364056 | 362 |
| 215 | 3300046457 | Ga0495590_0001569 | Ga0495590_0001569_3613_4764 | 362 |
| 216 | 3300046460 | Ga0495638_0001016 | Ga0495638_0001016_18396_19547 | 362 |
| 217 | 3300046460 | Ga0495638_0012117 | Ga0495638_0012117_424_1575 | 362 |
| 218 | 3300046512 | Ga0495610_0002127 | Ga0495610_0002127_1173_2324 | 362 |
| 219 | 3300046512 | Ga0495610_0004554 | Ga0495610_0004554_7759_8910 | 362 |
| 220 | 3300046518 | Ga0495631_0007881 | Ga0495631_0007881_1426_2577 | 362 |
| 221 | 3300046520 | Ga0495637_0001982 | Ga0495637_0001982_1606_2757 | 362 |
| 222 | 3300046616 | Ga0495668_0004598 | Ga0495668_0004598_6554_7705 | 362 |
| 223 | 3300046810 | Ga0495660_0061981 | Ga0495660_0061981_465_1616 | 362 |
| 224 | 3300047472 | Ga0495686_0001697 | Ga0495686_0001697_2298_3449 | 362 |
| 225 | 3300047472 | Ga0495686_0011462 | Ga0495686_0011462_3059_4210 | 362 |
| 226 | 3300047472 | Ga0495686_0032226 | Ga0495686_0032226_495_1646 | 362 |
| 227 | 3300053086 | Ga0500578_0000030 | Ga0500578_0000030_60719_61870 | 362 |
| 228 | 3300053088 | Ga0500644_0006741 | Ga0500644_0006741_1176_2327 | 362 |
| 229 | 3300053108 | Ga0500562_000331 | Ga0500562_000331_2301_3452 | 362 |
| 230 | 3300053156 | Ga0500622_0000867 | Ga0500622_0000867_16410_17561 | 362 |
| 231 | 3300053727 | Ga0500611_004229 | Ga0500611_004229_117_1268 | 362 |
| 232 | iso_pu_bacteria | 2582581279 | 2585148329 | 362 |
| 233 | 3300003773 | Ga0055537_1000646 | Ga0055537_100064613 | 363 |
| 234 | 3300003775 | Ga0055524_1004986 | Ga0055524_10049862 | 363 |
| 235 | 3300003790 | Ga0055528_1009213 | Ga0055528_10092132 | 363 |
| 236 | 3300025263 | Ga0209565_1000118 | Ga0209565_1000118102 | 363 |
| 237 | 3300025273 | Ga0209673_1001150 | Ga0209673_100115015 | 363 |
| 238 | 3300025291 | Ga0209675_1002511 | Ga0209675_10025119 | 363 |
| 239 | 3300028794 | Ga0307515_10021092 | Ga0307515_100210924 | 363 |
| 240 | 3300046453 | Ga0495627_001767 | Ga0495627_001767_8904_10055 | 363 |
| 241 | 3300046460 | Ga0495638_0001206 | Ga0495638_0001206_5033_6187 | 363 |
| 242 | 3300046471 | Ga0495650_0000069 | Ga0495650_0000069_234361_235512 | 363 |
| 243 | 3300046507 | Ga0495606_0004031 | Ga0495606_0004031_4065_5219 | 363 |
| 244 | 3300046512 | Ga0495610_0000378 | Ga0495610_0000378_16852_18006 | 363 |
| 245 | 3300046530 | Ga0495654_0000285 | Ga0495654_0000285_27660_28811 | 363 |
| 246 | 3300046660 | Ga0495625_0000143 | Ga0495625_0000143_61636_62787 | 363 |
| 247 | 3300046660 | Ga0495625_0003460 | Ga0495625_0003460_5514_6665 | 363 |
| 248 | 3300046660 | Ga0495625_0005726 | Ga0495625_0005726_6309_7463 | 363 |
| 249 | 3300046660 | Ga0495625_0035932 | Ga0495625_0035932_1600_2754 | 363 |
| 250 | 3300046660 | Ga0495625_0047259 | Ga0495625_0047259_1413_2564 | 363 |
| 251 | 3300046794 | Ga0495589_0005938 | Ga0495589_0005938_961_2112 | 363 |
| 252 | 3300047320 | Ga0495672_0000663 | Ga0495672_0000663_26864_28018 | 363 |
| 253 | 3300047446 | Ga0495679_006783 | Ga0495679_006783_2179_3330 | 363 |
| 254 | 3300047469 | Ga0495673_0000039 | Ga0495673_0000039_131018_132169 | 363 |
| 255 | 3300047469 | Ga0495673_0000225 | Ga0495673_0000225_38237_39382 | 363 |
| 256 | 3300047469 | Ga0495673_0001751 | Ga0495673_0001751_15347_16501 | 363 |
| 257 | 3300047472 | Ga0495686_0005217 | Ga0495686_0005217_1211_2365 | 363 |
| 258 | 3300053125 | Ga0500618_000240 | Ga0500618_000240_37919_39070 | 363 |
| 259 | 3300053136 | Ga0500559_0000031 | Ga0500559_0000031_76477_77628 | 363 |
| 260 | 3300053136 | Ga0500559_0004426 | Ga0500559_0004426_2468_3619 | 363 |
| 261 | iso_pu_bacteria | 2510917020 | 2511120862 | 363 |
| 262 | iso_pu_bacteria | 2582581280 | 2585155355 | 363 |
| 263 | iso_pu_bacteria | 2582581293 | 2585198919 | 363 |
| 264 | iso_pu_bacteria | 2643221545 | 2643748266 | 363 |
| 265 | iso_pu_bacteria | 2643221552 | 2643779081 | 363 |
| 266 | iso_pu_bacteria | 2643221583 | 2643925431 | 363 |
| 267 | iso_pu_bacteria | 2643221584 | 2643927648 | 363 |
| 268 | iso_pu_bacteria | 2643221691 | 2644508011 | 363 |
| 269 | iso_pu_bacteria | 2791355048 | 2792460906 | 363 |
| 270 | iso_pu_bacteria | 2818991435 | 2819539588 | 363 |
| 271 | iso_pu_bacteria | 2818991454 | 2819648796 | 363 |
| 272 | iso_pu_bacteria | 2843744320 | 2843747714 | 363 |
| 273 | iso_pu_bacteria | 2849560528 | 2849565414 | 363 |
| 274 | iso_pu_bacteria | 2849573788 | 2849578357 | 363 |
| 275 | iso_pu_bacteria | 2851153111 | 2851153865 | 363 |
| 276 | iso_pu_bacteria | 2898329390 | 2898329460 | 363 |
| 277 | 3300006186 | Ga0075369_10001558 | Ga0075369_100015585 | 364 |
| 278 | 3300013100 | Ga0157373_10017452 | Ga0157373_100174523 | 364 |
| 279 | 3300048927 | Ga0496124_0014279 | Ga0496124_0014279_3535_4689 | 364 |
| 280 | iso_pu_bacteria | 2830075706 | 2830075982 | 364 |
| 281 | iso_pu_bacteria | 2857504554 | 2857507833 | 364 |
| 282 | iso_pu_bacteria | 2928531327 | 2928535436 | 364 |
| 283 | 3300001989 | JGI24739J22299_10005561 | JGI24739J22299_100055611 | 365 |
| 284 | 3300001990 | JGI24737J22298_10002967 | JGI24737J22298_100029673 | 365 |
| 285 | 3300002075 | JGI24738J21930_10003280 | JGI24738J21930_100032802 | 365 |
| 286 | 3300005327 | Ga0070658_10000292 | Ga0070658_1000029217 | 365 |
| 287 | 3300005329 | Ga0070683_100011044 | Ga0070683_1000110442 | 365 |
| 288 | 3300005335 | Ga0070666_10005004 | Ga0070666_100050042 | 365 |
| 289 | 3300005339 | Ga0070660_100000655 | Ga0070660_1000006552 | 365 |
| 290 | 3300005344 | Ga0070661_100000138 | Ga0070661_10000013835 | 365 |
| 291 | 3300005355 | Ga0070671_100013927 | Ga0070671_1000139273 | 365 |
| 292 | 3300005364 | Ga0070673_100133797 | Ga0070673_1001337972 | 365 |
| 293 | 3300005366 | Ga0070659_100000081 | Ga0070659_10000008140 | 365 |
| 294 | 3300005367 | Ga0070667_100005341 | Ga0070667_1000053417 | 365 |
| 295 | 3300005455 | Ga0070663_100050187 | Ga0070663_1000501872 | 365 |
| 296 | 3300005457 | Ga0070662_100000025 | Ga0070662_1000000253 | 365 |
| 297 | 3300005535 | Ga0070684_100003050 | Ga0070684_1000030504 | 365 |
| 298 | 3300005539 | Ga0068853_100001144 | Ga0068853_1000011449 | 365 |
| 299 | 3300005548 | Ga0070665_100011521 | Ga0070665_1000115214 | 365 |
| 300 | 3300005563 | Ga0068855_100000503 | Ga0068855_10000050317 | 365 |
| 301 | 3300005564 | Ga0070664_100000012 | Ga0070664_100000012101 | 365 |
| 302 | 3300005614 | Ga0068856_100000163 | Ga0068856_10000016346 | 365 |
| 303 | 3300005616 | Ga0068852_100000426 | Ga0068852_1000004267 | 365 |
| 304 | 3300005618 | Ga0068864_100040889 | Ga0068864_1000408893 | 365 |
| 305 | 3300005834 | Ga0068851_10009355 | Ga0068851_100093552 | 365 |
| 306 | 3300005841 | Ga0068863_100186222 | Ga0068863_1001862222 | 365 |
| 307 | 3300005842 | Ga0068858_100026543 | Ga0068858_1000265432 | 365 |
| 308 | 3300006237 | Ga0097621_100026395 | Ga0097621_1000263953 | 365 |
| 309 | 3300006358 | Ga0068871_100061457 | Ga0068871_1000614572 | 365 |
| 310 | 3300009177 | Ga0105248_10000299 | Ga0105248_1000029929 | 365 |
| 311 | 3300013102 | Ga0157371_10001635 | Ga0157371_1000163513 | 365 |
| 312 | 3300014325 | Ga0163163_10046166 | Ga0163163_100461662 | 365 |
| 313 | 3300025903 | Ga0207680_10036142 | Ga0207680_100361422 | 365 |
| 314 | 3300025904 | Ga0207647_10053659 | Ga0207647_100536592 | 365 |
| 315 | 3300025909 | Ga0207705_10000095 | Ga0207705_1000009531 | 365 |
| 316 | 3300025919 | Ga0207657_10000028 | Ga0207657_1000002824 | 365 |
| 317 | 3300025920 | Ga0207649_10000014 | Ga0207649_10000014210 | 365 |
| 318 | 3300025931 | Ga0207644_10103806 | Ga0207644_101038062 | 365 |
| 319 | 3300025932 | Ga0207690_10000042 | Ga0207690_1000004269 | 365 |
| 320 | 3300025933 | Ga0207706_10000029 | Ga0207706_1000002929 | 365 |
| 321 | 3300025941 | Ga0207711_10000751 | Ga0207711_1000075115 | 365 |
| 322 | 3300025944 | Ga0207661_10001533 | Ga0207661_100015334 | 365 |
| 323 | 3300025945 | Ga0207679_10002058 | Ga0207679_100020587 | 365 |
| 324 | 3300025949 | Ga0207667_10027304 | Ga0207667_100273042 | 365 |
| 325 | 3300025986 | Ga0207658_10001237 | Ga0207658_1000123712 | 365 |
| 326 | 3300026035 | Ga0207703_10234025 | Ga0207703_102340251 | 365 |
| 327 | 3300026041 | Ga0207639_10000766 | Ga0207639_100007664 | 365 |
| 328 | 3300026067 | Ga0207678_10070702 | Ga0207678_100707021 | 365 |
| 329 | 3300026078 | Ga0207702_10001460 | Ga0207702_100014602 | 365 |
| 330 | 3300026088 | Ga0207641_10165112 | Ga0207641_101651122 | 365 |
| 331 | 3300026095 | Ga0207676_10256544 | Ga0207676_102565442 | 365 |
| 332 | 3300026142 | Ga0207698_10007023 | Ga0207698_100070232 | 365 |
| 333 | 3300028379 | Ga0268266_10032962 | Ga0268266_100329624 | 365 |
| 334 | 3300035691 | Ga0373931_0026000 | Ga0373931_0026000_309_1448 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9703 | 10 | 362 |
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9592 | 10 | 362 |
| 4rnl-assembly1.cif.gz_A | the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus | 0.9554 | 7 | 363 |
| 1lur-assembly2.cif.gz_B | crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 | 0.9522 | 27 | 364 |
| 1ns7-assembly1.cif.gz_A | crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose | 0.951 | 10 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q66HG4_1_342_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9665 | 10 | 362 | 2.70.98.10 |
| af_Q9VP02_15_358_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9648 | 23 | 362 | 2.70.98.10 |
| af_P0A9C3_9_344_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9567 | 19 | 361 | 2.70.98.10 |
| af_I1KJ59_42_349_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9559 | 56 | 362 | 2.70.98.10 |
| 4rnlC00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9555 | 10 | 363 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0H0Y2-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) | 0.9925 | 19 | 364 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A520I3Q9-F1-model_v4 | Galactose mutarotase | 0.991 | 133 | 364 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A520J9B2-F1-model_v4 | Galactose mutarotase | 0.991 | 142 | 364 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-T0H0Y2-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) | 0.9896 | 19 | 364 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A519PJH1-F1-model_v4 | Galactose-1-epimerase | 0.9882 | 174 | 364 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar