F411725

General Info

Members Datasets Scaffolds Average Seq Length
334 208 668 213

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100054103|Ga0070712_1000541034
Length 238
Sequence MSGVGSTKPQAGDAGPVGASHHHSARATLLLSLADDELILGWRDSEWTGIAPTLEEDVAFSSIAQNEIGHARALYELAAAELDTDADALAFDRAPSEYRCAPLVELRLIDDWALTIARRYLYEEADRVRIEALKESDDTELAGLAAKIDREEVYHRLHAELWAARLRDEPRFTAAVDRLWPFALAVVDPPQREELARRVGRPSANLAQTSERGTHTSDLTALWEEMTEVRRSEPGAQW

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 5.69
Rhizosphere 92.22
Stem 0
Stem Tuber 0
Unclassified 12.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100054103 3300006175 Bacteria 2805
2 Ga0070658_10007365 3300005327 Bacteria 8888
3 Ga0070658_10093282 3300005327 Bacteria 2483
4 Ga0070683_100576661 3300005329 Unclassified 1076
5 Ga0070683_100919071 3300005329 Unclassified 840
6 Ga0070680_100381842 3300005336 Bacteria 1199
7 Ga0070668_100005609 3300005347 Bacteria 9302
8 Ga0070675_100250471 3300005354 Bacteria 1550
9 Ga0070675_100422037 3300005354 Unclassified 1193
10 Ga0070671_100305437 3300005355 Archaea 1355
11 Ga0070714_100268787 3300005435 Bacteria 1581
12 Ga0070714_100716788 3300005435 Bacteria 966
13 Ga0070713_100281586 3300005436 Bacteria 1526
14 Ga0070713_100558420 3300005436 Bacteria 1085
15 Ga0070710_10588798 3300005437 Bacteria 773
16 Ga0070678_100600066 3300005456 Unclassified 983
17 Ga0070678_101164823 3300005456 Bacteria 714
18 Ga0070707_101154618 3300005468 Bacteria 740
19 Ga0070699_100520281 3300005518 Bacteria 1082
20 Ga0070672_100084061 3300005543 Unclassified 2555
21 Ga0070696_100179598 3300005546 Bacteria 1569
22 Ga0068855_100088837 3300005563 Bacteria 3569
23 Ga0068855_100454280 3300005563 Bacteria 1397
24 Ga0068861_100034702 3300005719 Bacteria 3731
25 Ga0068870_10302595 3300005840 Unclassified 1010
26 Ga0081455_10158211 3300005937 Bacteria 1739
27 Ga0081538_10000052 3300005981 Bacteria 109642
28 Ga0081539_10003742 3300005985 Bacteria 18097
29 Ga0070717_10076579 3300006028 Bacteria 2800
30 Ga0070717_10151342 3300006028 Bacteria 2007
31 Ga0075365_10169646 3300006038 Bacteria 1523
32 Ga0075365_10338364 3300006038 Bacteria 1060
33 Ga0075365_10455922 3300006038 Unclassified 903
34 Ga0075428_100112702 3300006844 Bacteria 2963
35 Ga0075430_100334070 3300006846 Bacteria 1252
36 Ga0075431_100120197 3300006847 Bacteria 2710
37 Ga0105240_10388468 3300009093 Bacteria 1574
38 Ga0105240_11389876 3300009093 Bacteria 738
39 Ga0111539_10284828 3300009094 Unclassified 1923
40 Ga0111539_10738832 3300009094 Bacteria 1146
41 Ga0111539_11855034 3300009094 Unclassified 699
42 Ga0105245_10183243 3300009098 Unclassified 2002
43 Ga0105245_10572474 3300009098 Bacteria 1153
44 Ga0105245_10610268 3300009098 Bacteria 1118
45 Ga0105245_10715687 3300009098 Unclassified 1035
46 Ga0114129_10008110 3300009147 Bacteria 14967
47 Ga0114129_10271428 3300009147 Bacteria 2269
48 Ga0114129_10298901 3300009147 Bacteria 2146
49 Ga0114129_10370870 3300009147 Archaea 1892
50 Ga0105243_10267704 3300009148 Bacteria 1533
51 Ga0105243_10863416 3300009148 Unclassified 897
52 Ga0105242_10436754 3300009176 Bacteria 1230
53 Ga0105242_10516404 3300009176 Bacteria 1139
54 Ga0105238_10675685 3300009551 Bacteria 1044
55 Ga0105249_10009089 3300009553 Bacteria 8689
56 Ga0105239_10196000 3300010375 Bacteria 2262
57 Ga0105239_10371199 3300010375 Bacteria 1617
58 Ga0157370_10207460 3300013104 Unclassified 1817
59 Ga0157369_10014777 3300013105 Bacteria 8808
60 Ga0157369_10036129 3300013105 Bacteria 5415
61 Ga0157378_10947120 3300013297 Unclassified 893
62 Ga0163162_10074197 3300013306 Bacteria 3460
63 Ga0163162_10288249 3300013306 Bacteria 1774
64 Ga0182008_10046156 3300014497 Bacteria 2166
65 Ga0163161_10711092 3300017792 Unclassified 837
66 Ga0206353_10760715 3300020082 Bacteria 1384
67 Ga0213876_10200639 3300021384 Bacteria 1060
68 Ga0207642_10117382 3300025899 Bacteria 1366
69 Ga0207688_10075735 3300025901 Bacteria 1916
70 Ga0207705_10234369 3300025909 Unclassified 1397
71 Ga0207695_10088798 3300025913 Bacteria 3110
72 Ga0207693_10222478 3300025915 Bacteria 1483
73 Ga0207693_10274696 3300025915 Bacteria 1320
74 Ga0207663_10224999 3300025916 Bacteria 1367
75 Ga0207652_10984750 3300025921 Unclassified 742
76 Ga0207694_10464775 3300025924 Bacteria 1057
77 Ga0207659_10198006 3300025926 Bacteria 1602
78 Ga0207687_10099488 3300025927 Bacteria 2137
79 Ga0207687_10505718 3300025927 Bacteria 1009
80 Ga0207687_10920379 3300025927 Bacteria 748
81 Ga0207700_10122071 3300025928 Bacteria 2114
82 Ga0207700_10221188 3300025928 Bacteria 1605
83 Ga0207664_10304661 3300025929 Bacteria 1402
84 Ga0207664_11001820 3300025929 Bacteria 749
85 Ga0207706_10033158 3300025933 Bacteria 4597
86 Ga0207686_10290327 3300025934 Archaea 1211
87 Ga0207709_10450803 3300025935 Bacteria 994
88 Ga0207669_10032792 3300025937 Unclassified 2922
89 Ga0207669_10203307 3300025937 Unclassified 1440
90 Ga0207691_10100371 3300025940 Bacteria 2583
91 Ga0207651_10464865 3300025960 Unclassified 1088
92 Ga0207712_10005906 3300025961 Bacteria 7720
93 Ga0207668_10063741 3300025972 Unclassified 2601
94 Ga0207640_10556553 3300025981 Bacteria 964
95 Ga0207678_10996853 3300026067 Bacteria 741
96 Ga0207708_10108123 3300026075 Bacteria 2157
97 Ga0207708_10725247 3300026075 Unclassified 851
98 Ga0207675_100002117 3300026118 Bacteria 19674
99 Ga0207675_100524297 3300026118 Bacteria 1181
100 Ga0207683_10759450 3300026121 Bacteria 900
101 Ga0207428_10532707 3300027907 Bacteria 851
102 Ga0268265_10319347 3300028380 Bacteria 1406
103 Ga0265319_1077692 3300028563 Bacteria 1057
104 Ga0265319_1143504 3300028563 Bacteria 740
105 Ga0265334_10056117 3300028573 Bacteria 1497
106 Ga0265329_10035141 3300031242 Bacteria 1618
107 Ga0265327_10157179 3300031251 Bacteria 1053
108 Ga0307408_100599294 3300031548 Unclassified 979
109 Ga0265314_10134199 3300031711 Bacteria 1540
110 Ga0307405_10329151 3300031731 Bacteria 1170
111 Ga0307406_10645868 3300031901 Bacteria 878
112 Ga0307409_100060823 3300031995 Bacteria 2948
113 Ga0307409_100680172 3300031995 Bacteria 1026
114 Ga0307416_100139066 3300032002 Bacteria 2203
115 Ga0373926_0085021 3300035083 Bacteria 1173
116 Ga0373944_0033699 3300035089 Bacteria 1553
117 Ga0373936_0105723 3300035113 Unclassified 1191
118 Ga0373945_0010130 3300035116 Bacteria 3099
119 Ga0373945_0014009 3300035116 Bacteria 2682
120 Ga0373943_0002043 3300035170 Bacteria 9152
121 Ga0373943_0015268 3300035170 Bacteria 3487
122 Ga0373946_0020493 3300035171 Bacteria 2556
123 Ga0373946_0070303 3300035171 Bacteria 1510
124 Ga0373935_0004692 3300035692 Bacteria 8044
125 Ga0373927_0094280 3300035695 Bacteria 1945
126 Ga0373947_0003483 3300035725 Bacteria 9301
127 Ga0373937_0752347 3300036401 Bacteria 922
128 Ga0373925_0009943 3300037068 Bacteria 6909
129 Ga0373925_0080642 3300037068 Bacteria 2473
130 Ga0395899_0001001 3300037312 Bacteria 25945
131 Ga0395899_0105497 3300037312 Bacteria 2029
132 Ga0395899_0167715 3300037312 Bacteria 1548
133 Ga0395899_0406256 3300037312 Bacteria 900
134 Ga0395900_0003844 3300037418 Bacteria 16052
135 Ga0395900_0008264 3300037418 Bacteria 10716
136 Ga0395900_0112617 3300037418 Bacteria 2794
137 Ga0395900_0123952 3300037418 Bacteria 2650
138 Ga0395900_0176316 3300037418 Bacteria 2174
139 Ga0395900_1028189 3300037418 Unclassified 743
140 Ga0395900_1629247 3300037418 Unclassified 557
141 Ga0395898_0001979 3300037466 Bacteria 25746
142 Ga0395898_0027037 3300037466 Bacteria 5763
143 Ga0395898_0085863 3300037466 Bacteria 3033
144 Ga0395898_0120665 3300037466 Bacteria 2512
145 Ga0395898_0308992 3300037466 Unclassified 1508
146 Ga0395898_0782266 3300037466 Bacteria 895
147 Ga0395905_0001332 3300037471 Bacteria 30138
148 Ga0395905_0045938 3300037471 Bacteria 4096
149 Ga0395905_0180650 3300037471 Bacteria 1981
150 Ga0395905_0205274 3300037471 Bacteria 1847
151 Ga0395905_0375486 3300037471 Bacteria 1315
152 Ga0395905_0384073 3300037471 Bacteria 1298
153 Ga0395905_0463829 3300037471 Bacteria 1165
154 Ga0395905_0526615 3300037471 Bacteria 1082
155 Ga0395901_0001969 3300038443 Bacteria 21132
156 Ga0395901_0003938 3300038443 Bacteria 14937
157 Ga0395901_0108816 3300038443 Bacteria 2909
158 Ga0395901_0161094 3300038443 Bacteria 2356
159 Ga0395901_0202922 3300038443 Bacteria 2078
160 Ga0395901_0234138 3300038443 Bacteria 1917
161 Ga0436365_1037644 3300039437 Unclassified 1576
162 Ga0436365_1495419 3300039437 Bacteria 3530
163 Ga0439436_0047213 3300041404 Bacteria 1222
164 Ga0451804_0344157 3300041463 Unclassified 784
165 Ga0439431_0001396 3300041997 Bacteria 5325
166 Ga0439433_0018899 3300041999 Unclassified 1535
167 Ga0439448_0200383 3300042005 Bacteria 700
168 Ga0439462_0003894 3300042015 Bacteria 3604
169 Ga0439446_0008374 3300042156 Bacteria 2743
170 Ga0439434_0003077 3300042435 Bacteria 4893
171 Ga0439434_0015021 3300042435 Unclassified 2306
172 Ga0439434_0032239 3300042435 Bacteria 1594
173 Ga0450918_008115 3300042531 Bacteria 1848
174 Ga0466969_0098729 3300044656 Unclassified 1377
175 Ga0466969_0260496 3300044656 Bacteria 786
176 Ga0466966_0105348 3300044684 Bacteria 1741
177 Ga0466961_0044571 3300044693 Bacteria 2838
178 Ga0466963_0012372 3300044694 Bacteria 5221
179 Ga0466963_0018004 3300044694 Bacteria 4408
180 Ga0466963_0067263 3300044694 Bacteria 2404
181 Ga0466963_0098921 3300044694 Bacteria 1994
182 Ga0466963_0124090 3300044694 Bacteria 1779
183 Ga0466963_0136452 3300044694 Bacteria 1698
184 Ga0466963_0547215 3300044694 Bacteria 817
185 Ga0466964_0017632 3300044706 Bacteria 2734
186 Ga0466971_0004309 3300044719 Bacteria 6132
187 Ga0466968_0211155 3300044735 Bacteria 912
188 Ga0466957_0041581 3300044842 Bacteria 2779
189 Ga0466957_0101189 3300044842 Bacteria 1817
190 Ga0466959_0046860 3300045049 Bacteria 3181
191 Ga0466958_0002117 3300045836 Bacteria 9854
192 Ga0466967_0010896 3300045976 Bacteria 6850
193 Ga0466967_0012818 3300045976 Bacteria 6441
194 Ga0466967_0028314 3300045976 Bacteria 4676
195 Ga0466967_0042864 3300045976 Bacteria 3914
196 Ga0466967_0072616 3300045976 Bacteria 3084
197 Ga0466967_0140204 3300045976 Bacteria 2251
198 Ga0466967_0148409 3300045976 Bacteria 2189
199 Ga0466967_0187451 3300045976 Bacteria 1954
200 Ga0466967_0507405 3300045976 Bacteria 1184
201 Ga0466967_0551792 3300045976 Bacteria 1134
202 Ga0495603_0019323 3300046455 Bacteria 4124
203 Ga0495603_0078408 3300046455 Bacteria 1937
204 Ga0495629_0015908 3300046459 Bacteria 5405
205 Ga0495629_0034527 3300046459 Bacteria 3575
206 Ga0495641_0002836 3300046461 Bacteria 13406
207 Ga0495641_0046020 3300046461 Bacteria 2007
208 Ga0495653_0040331 3300046463 Bacteria 3649
209 Ga0495653_0117005 3300046463 Bacteria 1905
210 Ga0495653_0160202 3300046463 Bacteria 1563
211 Ga0495580_0258527 3300046472 Bacteria 1191
212 Ga0495582_0000188 3300046473 Bacteria 33908
213 Ga0495582_0179292 3300046473 Bacteria 1207
214 Ga0495639_0001294 3300046475 Bacteria 11253
215 Ga0495662_0004283 3300046476 Bacteria 7175
216 Ga0495585_0071174 3300046492 Bacteria 1896
217 Ga0495594_0120282 3300046499 Bacteria 1484
218 Ga0495596_0161092 3300046500 Bacteria 872
219 Ga0495607_0107268 3300046501 Bacteria 1486
220 Ga0495608_0256154 3300046511 Bacteria 1090
221 Ga0495628_0038975 3300046516 Bacteria 3802
222 Ga0495630_0031587 3300046517 Bacteria 3943
223 Ga0495630_0487348 3300046517 Bacteria 945
224 Ga0495630_0583956 3300046517 Bacteria 857
225 Ga0495652_0166693 3300046529 Bacteria 1704
226 Ga0495652_0167702 3300046529 Bacteria 1697
227 Ga0495640_0049723 3300046533 Bacteria 2889
228 Ga0495586_0119373 3300046535 Bacteria 1472
229 Ga0495587_0176702 3300046536 Bacteria 1212
230 Ga0495609_0140242 3300046538 Bacteria 1032
231 Ga0495656_0049719 3300046615 Bacteria 1787
232 Ga0495656_0182530 3300046615 Bacteria 1032
233 Ga0495656_0210914 3300046615 Bacteria 968
234 Ga0495634_0056568 3300046642 Unclassified 2620
235 Ga0495635_0078604 3300046663 Bacteria 2258
236 Ga0495599_0210044 3300046678 Bacteria 1194
237 Ga0495646_0057105 3300046680 Bacteria 2338
238 Ga0495647_0048034 3300046681 Bacteria 1649
239 Ga0495658_0055559 3300046683 Bacteria 2255
240 Ga0495613_0340690 3300046689 Unclassified 1031
241 Ga0495671_0269039 3300046692 Unclassified 822
242 Ga0495589_0066908 3300046794 Unclassified 1759
243 Ga0495600_0002798 3300046809 Bacteria 10133
244 Ga0495581_0005891 3300047315 Bacteria 7107
245 Ga0495604_0017247 3300047317 Bacteria 5778
246 Ga0495674_0009426 3300047319 Bacteria 9279
247 Ga0495674_0113811 3300047319 Bacteria 2291
248 Ga0495676_0020705 3300047321 Bacteria 5764
249 Ga0495676_0138067 3300047321 Bacteria 1750
250 Ga0495676_0169506 3300047321 Bacteria 1538
251 Ga0495680_0016102 3300047322 Bacteria 6428
252 Ga0495684_0003153 3300047471 Bacteria 12924
253 Ga0495684_0005386 3300047471 Bacteria 9962
254 Ga0495614_0048339 3300048089 Bacteria 1824
255 Ga0495614_0302968 3300048089 Bacteria 739
256 Ga0496100_0115702 3300048903 Bacteria 1870
257 Ga0496100_0430668 3300048903 Bacteria 1009
258 Ga0496101_0202397 3300048904 Archaea 1535
259 Ga0496101_0206192 3300048904 Bacteria 1521
260 Ga0496102_0501643 3300048905 Bacteria 1136
261 Ga0496103_0555540 3300048906 Bacteria 733
262 Ga0496104_0028693 3300048907 Bacteria 5158
263 Ga0496104_0045050 3300048907 Bacteria 4147
264 Ga0496105_0036006 3300048908 Bacteria 4076
265 Ga0496105_0058421 3300048908 Bacteria 3184
266 Ga0496107_0305446 3300048910 Unclassified 1184
267 Ga0496109_0663425 3300048912 Bacteria 980
268 Ga0496110_0505891 3300048913 Bacteria 1100
269 Ga0496112_0105384 3300048915 Unclassified 2789
270 Ga0496112_0875150 3300048915 Bacteria 821
271 Ga0496114_0012447 3300048917 Bacteria 6811
272 Ga0496115_0013002 3300048918 Bacteria 6282
273 Ga0496115_0206822 3300048918 Bacteria 1621
274 Ga0501031_0013368 3300049568 Bacteria 5357
275 Ga0501036_0001744 3300049572 Bacteria 16890
276 Ga0501036_0030133 3300049572 Bacteria 4584
277 Ga0501036_0032924 3300049572 Bacteria 4382
278 Ga0501036_0577218 3300049572 Bacteria 934
279 Ga0501037_0090694 3300049573 Bacteria 2210
280 Ga0501038_0019252 3300049574 Bacteria 6158
281 Ga0501038_0064801 3300049574 Bacteria 3115
282 Ga0501039_0052131 3300049575 Bacteria 3166
283 Ga0501040_0003374 3300049576 Bacteria 10314
284 Ga0501041_0008373 3300049577 Bacteria 6081
285 Ga0501041_0017590 3300049577 Bacteria 4254
286 Ga0501042_0002775 3300049578 Bacteria 10822
287 Ga0501042_0423649 3300049578 Bacteria 964
288 Ga0501046_0009021 3300049580 Bacteria 8649
289 Ga0501047_0155223 3300049581 Bacteria 2163
290 Ga0501047_0470892 3300049581 Bacteria 1084
291 Ga0501048_0014047 3300049582 Bacteria 5935
292 Ga0501068_0060141 3300049584 Bacteria 2307
293 Ga0501069_0460595 3300049585 Bacteria 756
294 Ga0501070_0000243 3300049586 Bacteria 51201
295 Ga0501071_0056359 3300049587 Bacteria 2838
296 Ga0501072_0036061 3300049588 Bacteria 3876
297 Ga0501072_0333156 3300049588 Unclassified 1206
298 Ga0501074_0047598 3300049590 Bacteria 3099
299 Ga0501074_0091589 3300049590 Bacteria 2177
300 Ga0501075_0003847 3300049591 Bacteria 10108
301 Ga0501075_0325119 3300049591 Bacteria 1172
302 Ga0501076_0006202 3300049592 Bacteria 8653
303 Ga0501076_0351974 3300049592 Bacteria 1209
304 Ga0501077_0144336 3300049593 Bacteria 1510
305 Ga0501077_0197080 3300049593 Unclassified 1279
306 Ga0501079_0004754 3300049741 Bacteria 10059
307 Ga0501079_0022819 3300049741 Bacteria 4803
308 Ga0501079_0266505 3300049741 Bacteria 1339
309 Ga0501080_0074901 3300049742 Bacteria 3149
310 Ga0501081_0002201 3300049743 Bacteria 12259
311 Ga0501083_0050666 3300049744 Bacteria 2794
312 Ga0501035_0006981 3300049822 Bacteria 10548
313 Ga0501035_0055123 3300049822 Bacteria 3550
314 Ga0501045_0056303 3300049824 Bacteria 2875
315 Ga0501045_0628686 3300049824 Unclassified 794
316 nmdc:mga0yw44_548056_c1 3300050492 Bacteria 785
317 nmdc:mga05p37_1108117_c1 3300050507 Archaea 828
318 nmdc:mga05p37_14915_c1 3300050507 Bacteria 9332
319 nmdc:mga05p37_389437_c1 3300050507 Bacteria 1630
320 nmdc:mga0qj67_307362_c1 3300050509 Bacteria 1284
321 nmdc:mga06r32_114642_c1 3300050510 Bacteria 2653
322 nmdc:mga08y16_754954_c1 3300050511 Bacteria 969
323 nmdc:mga0n895_949635_c1 3300050512 Bacteria 843
324 Ga0495601_0072465 3300053077 Bacteria 2200
325 Ga0495612_0120624 3300053078 Bacteria 1128
326 Ga0495595_0000856 3300053084 Bacteria 11668
327 Ga0495595_0006153 3300053084 Bacteria 4879
328 Ga0495619_0000619 3300053085 Bacteria 23500
329 Ga0501084_0000453 3300054114 Bacteria 31556
330 Ga0590075_012087 3300059424 Bacteria 2094
331 Ga0501082_0008768 3300060353 Bacteria 8718
332 Ga0466962_0007355 3300061719 Bacteria 5284
333 Ga0530510_0010362 3300061734 Bacteria 6535
334 Ga0530510_0026006 3300061734 Bacteria 4186
335 Ga0070712_100054103
336 Ga0070658_10007365
337 Ga0070658_10093282
338 Ga0070683_100576661
339 Ga0070683_100919071
340 Ga0070680_100381842
341 Ga0070668_100005609
342 Ga0070675_100250471
343 Ga0070675_100422037
344 Ga0070671_100305437
345 Ga0070714_100268787
346 Ga0070714_100716788
347 Ga0070713_100281586
348 Ga0070713_100558420
349 Ga0070710_10588798
350 Ga0070678_100600066
351 Ga0070678_101164823
352 Ga0070707_101154618
353 Ga0070699_100520281
354 Ga0070672_100084061
355 Ga0070696_100179598
356 Ga0068855_100088837
357 Ga0068855_100454280
358 Ga0068861_100034702
359 Ga0068870_10302595
360 Ga0081455_10158211
361 Ga0081538_10000052
362 Ga0081539_10003742
363 Ga0070717_10076579
364 Ga0070717_10151342
365 Ga0075365_10169646
366 Ga0075365_10338364
367 Ga0075365_10455922
368 Ga0075428_100112702
369 Ga0075430_100334070
370 Ga0075431_100120197
371 Ga0105240_10388468
372 Ga0105240_11389876
373 Ga0111539_10284828
374 Ga0111539_10738832
375 Ga0111539_11855034
376 Ga0105245_10183243
377 Ga0105245_10572474
378 Ga0105245_10610268
379 Ga0105245_10715687
380 Ga0114129_10008110
381 Ga0114129_10271428
382 Ga0114129_10298901
383 Ga0114129_10370870
384 Ga0105243_10267704
385 Ga0105243_10863416
386 Ga0105242_10436754
387 Ga0105242_10516404
388 Ga0105238_10675685
389 Ga0105249_10009089
390 Ga0105239_10196000
391 Ga0105239_10371199
392 Ga0157370_10207460
393 Ga0157369_10014777
394 Ga0157369_10036129
395 Ga0157378_10947120
396 Ga0163162_10074197
397 Ga0163162_10288249
398 Ga0182008_10046156
399 Ga0163161_10711092
400 Ga0206353_10760715
401 Ga0213876_10200639
402 Ga0207642_10117382
403 Ga0207688_10075735
404 Ga0207705_10234369
405 Ga0207695_10088798
406 Ga0207693_10222478
407 Ga0207693_10274696
408 Ga0207663_10224999
409 Ga0207652_10984750
410 Ga0207694_10464775
411 Ga0207659_10198006
412 Ga0207687_10099488
413 Ga0207687_10505718
414 Ga0207687_10920379
415 Ga0207700_10122071
416 Ga0207700_10221188
417 Ga0207664_10304661
418 Ga0207664_11001820
419 Ga0207706_10033158
420 Ga0207686_10290327
421 Ga0207709_10450803
422 Ga0207669_10032792
423 Ga0207669_10203307
424 Ga0207691_10100371
425 Ga0207651_10464865
426 Ga0207712_10005906
427 Ga0207668_10063741
428 Ga0207640_10556553
429 Ga0207678_10996853
430 Ga0207708_10108123
431 Ga0207708_10725247
432 Ga0207675_100002117
433 Ga0207675_100524297
434 Ga0207683_10759450
435 Ga0207428_10532707
436 Ga0268265_10319347
437 Ga0265319_1077692
438 Ga0265319_1143504
439 Ga0265334_10056117
440 Ga0265329_10035141
441 Ga0265327_10157179
442 Ga0307408_100599294
443 Ga0265314_10134199
444 Ga0307405_10329151
445 Ga0307406_10645868
446 Ga0307409_100060823
447 Ga0307409_100680172
448 Ga0307416_100139066
449 Ga0373926_0085021
450 Ga0373944_0033699
451 Ga0373936_0105723
452 Ga0373945_0010130
453 Ga0373945_0014009
454 Ga0373943_0002043
455 Ga0373943_0015268
456 Ga0373946_0020493
457 Ga0373946_0070303
458 Ga0373935_0004692
459 Ga0373927_0094280
460 Ga0373947_0003483
461 Ga0373937_0752347
462 Ga0373925_0009943
463 Ga0373925_0080642
464 Ga0395899_0001001
465 Ga0395899_0105497
466 Ga0395899_0167715
467 Ga0395899_0406256
468 Ga0395900_0003844
469 Ga0395900_0008264
470 Ga0395900_0112617
471 Ga0395900_0123952
472 Ga0395900_0176316
473 Ga0395900_1028189
474 Ga0395900_1629247
475 Ga0395898_0001979
476 Ga0395898_0027037
477 Ga0395898_0085863
478 Ga0395898_0120665
479 Ga0395898_0308992
480 Ga0395898_0782266
481 Ga0395905_0001332
482 Ga0395905_0045938
483 Ga0395905_0180650
484 Ga0395905_0205274
485 Ga0395905_0375486
486 Ga0395905_0384073
487 Ga0395905_0463829
488 Ga0395905_0526615
489 Ga0395901_0001969
490 Ga0395901_0003938
491 Ga0395901_0108816
492 Ga0395901_0161094
493 Ga0395901_0202922
494 Ga0395901_0234138
495 Ga0436365_1037644
496 Ga0436365_1495419
497 Ga0439436_0047213
498 Ga0451804_0344157
499 Ga0439431_0001396
500 Ga0439433_0018899
501 Ga0439448_0200383
502 Ga0439462_0003894
503 Ga0439446_0008374
504 Ga0439434_0003077
505 Ga0439434_0015021
506 Ga0439434_0032239
507 Ga0450918_008115
508 Ga0466969_0098729
509 Ga0466969_0260496
510 Ga0466966_0105348
511 Ga0466961_0044571
512 Ga0466963_0012372
513 Ga0466963_0018004
514 Ga0466963_0067263
515 Ga0466963_0098921
516 Ga0466963_0124090
517 Ga0466963_0136452
518 Ga0466963_0547215
519 Ga0466964_0017632
520 Ga0466971_0004309
521 Ga0466968_0211155
522 Ga0466957_0041581
523 Ga0466957_0101189
524 Ga0466959_0046860
525 Ga0466958_0002117
526 Ga0466967_0010896
527 Ga0466967_0012818
528 Ga0466967_0028314
529 Ga0466967_0042864
530 Ga0466967_0072616
531 Ga0466967_0140204
532 Ga0466967_0148409
533 Ga0466967_0187451
534 Ga0466967_0507405
535 Ga0466967_0551792
536 Ga0495603_0019323
537 Ga0495603_0078408
538 Ga0495629_0015908
539 Ga0495629_0034527
540 Ga0495641_0002836
541 Ga0495641_0046020
542 Ga0495653_0040331
543 Ga0495653_0117005
544 Ga0495653_0160202
545 Ga0495580_0258527
546 Ga0495582_0000188
547 Ga0495582_0179292
548 Ga0495639_0001294
549 Ga0495662_0004283
550 Ga0495585_0071174
551 Ga0495594_0120282
552 Ga0495596_0161092
553 Ga0495607_0107268
554 Ga0495608_0256154
555 Ga0495628_0038975
556 Ga0495630_0031587
557 Ga0495630_0487348
558 Ga0495630_0583956
559 Ga0495652_0166693
560 Ga0495652_0167702
561 Ga0495640_0049723
562 Ga0495586_0119373
563 Ga0495587_0176702
564 Ga0495609_0140242
565 Ga0495656_0049719
566 Ga0495656_0182530
567 Ga0495656_0210914
568 Ga0495634_0056568
569 Ga0495635_0078604
570 Ga0495599_0210044
571 Ga0495646_0057105
572 Ga0495647_0048034
573 Ga0495658_0055559
574 Ga0495613_0340690
575 Ga0495671_0269039
576 Ga0495589_0066908
577 Ga0495600_0002798
578 Ga0495581_0005891
579 Ga0495604_0017247
580 Ga0495674_0009426
581 Ga0495674_0113811
582 Ga0495676_0020705
583 Ga0495676_0138067
584 Ga0495676_0169506
585 Ga0495680_0016102
586 Ga0495684_0003153
587 Ga0495684_0005386
588 Ga0495614_0048339
589 Ga0495614_0302968
590 Ga0496100_0115702
591 Ga0496100_0430668
592 Ga0496101_0202397
593 Ga0496101_0206192
594 Ga0496102_0501643
595 Ga0496103_0555540
596 Ga0496104_0028693
597 Ga0496104_0045050
598 Ga0496105_0036006
599 Ga0496105_0058421
600 Ga0496107_0305446
601 Ga0496109_0663425
602 Ga0496110_0505891
603 Ga0496112_0105384
604 Ga0496112_0875150
605 Ga0496114_0012447
606 Ga0496115_0013002
607 Ga0496115_0206822
608 Ga0501031_0013368
609 Ga0501036_0001744
610 Ga0501036_0030133
611 Ga0501036_0032924
612 Ga0501036_0577218
613 Ga0501037_0090694
614 Ga0501038_0019252
615 Ga0501038_0064801
616 Ga0501039_0052131
617 Ga0501040_0003374
618 Ga0501041_0008373
619 Ga0501041_0017590
620 Ga0501042_0002775
621 Ga0501042_0423649
622 Ga0501046_0009021
623 Ga0501047_0155223
624 Ga0501047_0470892
625 Ga0501048_0014047
626 Ga0501068_0060141
627 Ga0501069_0460595
628 Ga0501070_0000243
629 Ga0501071_0056359
630 Ga0501072_0036061
631 Ga0501072_0333156
632 Ga0501074_0047598
633 Ga0501074_0091589
634 Ga0501075_0003847
635 Ga0501075_0325119
636 Ga0501076_0006202
637 Ga0501076_0351974
638 Ga0501077_0144336
639 Ga0501077_0197080
640 Ga0501079_0004754
641 Ga0501079_0022819
642 Ga0501079_0266505
643 Ga0501080_0074901
644 Ga0501081_0002201
645 Ga0501083_0050666
646 Ga0501035_0006981
647 Ga0501035_0055123
648 Ga0501045_0056303
649 Ga0501045_0628686
650 nmdc:mga0yw44_548056_c1
651 nmdc:mga05p37_1108117_c1
652 nmdc:mga05p37_14915_c1
653 nmdc:mga05p37_389437_c1
654 nmdc:mga0qj67_307362_c1
655 nmdc:mga06r32_114642_c1
656 nmdc:mga08y16_754954_c1
657 nmdc:mga0n895_949635_c1
658 Ga0495601_0072465
659 Ga0495612_0120624
660 Ga0495595_0000856
661 Ga0495595_0006153
662 Ga0495619_0000619
663 Ga0501084_0000453
664 Ga0590075_012087
665 Ga0501082_0008768
666 Ga0466962_0007355
667 Ga0530510_0010362
668 Ga0530510_0026006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

15

205

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9041 2 223
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9009 1 223
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8971 1 223
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8964 2 223
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.8923 7 211
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8969 2 223 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8893 2 223 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8404 4 219 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8128 4 219 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7623 5 142 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1F2XQP2-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9926 9 161 GO:0005829
GO:0010124
AF-A0A7V9TAG5-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9891 1 73 GO:0005829
GO:0010124
AF-A0A1Q6XFD7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9851 1 146 GO:0005829
GO:0010124
AF-A0A1F3B225-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9818 4 166 GO:0005829
GO:0010124
AF-A0A4V2A861-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9812 5 83 GO:0005829
GO:0010124

Map