F411705

General Info

Members Datasets Scaffolds Average Seq Length
334 165 668 134

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100818951|Ga0068859_1008189512
Length 134
Sequence MNFKSGFIIAAILTVAFVVPAWTHHSHGNYEDTFMDIEGVVKEVHLVVPHSWIYIEVKDAKGGEAQMWALEATGRTGLTRIGVTPEYVKAGDKVKARCHHLRDGSNGCLLGFLKAKDGTVKDWDGNNAPAPADF

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 35.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100818951 3300005617 Bacteria 1018
2 Ga0065707_10318251 3300005295 Unclassified 971
3 Ga0070676_10620802 3300005328 Bacteria 782
4 Ga0070683_100068948 3300005329 Bacteria 3296
5 Ga0070690_100423903 3300005330 Bacteria 981
6 Ga0070690_100470727 3300005330 Unclassified 935
7 Ga0070677_10149737 3300005333 Unclassified 1085
8 Ga0068869_100016706 3300005334 Bacteria 4952
9 Ga0068869_100660932 3300005334 Unclassified 888
10 Ga0068869_101084292 3300005334 Unclassified 700
11 Ga0068869_101970017 3300005334 Unclassified 524
12 Ga0070666_10001841 3300005335 Bacteria 12923
13 Ga0070666_10113856 3300005335 Bacteria 1872
14 Ga0068868_100319689 3300005338 Bacteria 1322
15 Ga0068868_100411576 3300005338 Bacteria 1169
16 Ga0068868_100526837 3300005338 Bacteria 1038
17 Ga0070660_100108939 3300005339 Bacteria 2202
18 Ga0070692_10793295 3300005345 Unclassified 646
19 Ga0070669_100282674 3300005353 Bacteria 1330
20 Ga0070675_100131920 3300005354 Bacteria 2130
21 Ga0070673_100261792 3300005364 Bacteria 1511
22 Ga0070673_102023146 3300005364 Bacteria 547
23 Ga0070659_100199013 3300005366 Unclassified 1649
24 Ga0070667_100013746 3300005367 Bacteria 6692
25 Ga0070667_100222604 3300005367 Unclassified 1680
26 Ga0070667_101618060 3300005367 Bacteria 609
27 Ga0070709_10527407 3300005434 Unclassified 901
28 Ga0070709_11548611 3300005434 Unclassified 539
29 Ga0070713_101016374 3300005436 Bacteria 800
30 Ga0070710_10535093 3300005437 Unclassified 807
31 Ga0070701_10456563 3300005438 Unclassified 821
32 Ga0070711_100145322 3300005439 Unclassified 1783
33 Ga0070694_101836656 3300005444 Bacteria 517
34 Ga0070708_100172278 3300005445 Bacteria 2021
35 Ga0070678_101662922 3300005456 Unclassified 600
36 Ga0068867_100177621 3300005459 Bacteria 1691
37 Ga0068867_102168846 3300005459 Unclassified 527
38 Ga0070706_101782097 3300005467 Unclassified 560
39 Ga0070707_100005016 3300005468 Bacteria 12401
40 Ga0070707_100217226 3300005468 Unclassified 1863
41 Ga0070684_100087317 3300005535 Bacteria 2769
42 Ga0070697_100999446 3300005536 Bacteria 744
43 Ga0070697_101546080 3300005536 Unclassified 593
44 Ga0068853_100218164 3300005539 Bacteria 1741
45 Ga0070672_100341034 3300005543 Bacteria 1276
46 Ga0070695_100246210 3300005545 Bacteria 1299
47 Ga0070696_100746922 3300005546 Bacteria 801
48 Ga0070693_100097094 3300005547 Unclassified 1788
49 Ga0070665_100129297 3300005548 Bacteria 2528
50 Ga0070665_101502268 3300005548 Unclassified 682
51 Ga0068855_100039926 3300005563 Bacteria 5571
52 Ga0070664_100040054 3300005564 Bacteria 3949
53 Ga0068857_100511155 3300005577 Unclassified 1128
54 Ga0068856_100032631 3300005614 Bacteria 5099
55 Ga0068856_101608850 3300005614 Unclassified 663
56 Ga0068859_100221663 3300005617 Bacteria 1979
57 Ga0068859_100519426 3300005617 Bacteria 1286
58 Ga0068859_101230285 3300005617 Unclassified 825
59 Ga0068864_100151411 3300005618 Bacteria 2101
60 Ga0068864_100822917 3300005618 Unclassified 914
61 Ga0068866_10207662 3300005718 Bacteria 1174
62 Ga0068866_10216143 3300005718 Bacteria 1154
63 Ga0068866_10410076 3300005718 Bacteria 876
64 Ga0068866_11331987 3300005718 Unclassified 523
65 Ga0068851_10103321 3300005834 Unclassified 1514
66 Ga0068863_100015748 3300005841 Bacteria 7261
67 Ga0068863_100495349 3300005841 Unclassified 1203
68 Ga0068863_100782588 3300005841 Unclassified 951
69 Ga0068863_100990756 3300005841 Unclassified 843
70 Ga0068858_100007560 3300005842 Bacteria 10498
71 Ga0068858_100015844 3300005842 Bacteria 7085
72 Ga0068858_100609099 3300005842 Unclassified 1060
73 Ga0068858_100873094 3300005842 Unclassified 879
74 Ga0068858_101244309 3300005842 Unclassified 732
75 Ga0068858_101347235 3300005842 Unclassified 703
76 Ga0068858_101369106 3300005842 Unclassified 697
77 Ga0068860_100001595 3300005843 Bacteria 24356
78 Ga0068860_100075384 3300005843 Unclassified 3208
79 Ga0068860_100300707 3300005843 Unclassified 1572
80 Ga0068860_101064019 3300005843 Unclassified 828
81 Ga0068860_101358076 3300005843 Bacteria 732
82 Ga0081539_10000010 3300005985 Bacteria 484386
83 Ga0081539_10005748 3300005985 Bacteria 12391
84 Ga0097621_100003308 3300006237 Bacteria 11088
85 Ga0097621_100082710 3300006237 Bacteria 2674
86 Ga0097621_100092962 3300006237 Bacteria 2527
87 Ga0097621_100723136 3300006237 Bacteria 918
88 Ga0097621_100885654 3300006237 Unclassified 831
89 Ga0068871_100019085 3300006358 Bacteria 5228
90 Ga0068871_100062697 3300006358 Bacteria 3039
91 Ga0068871_100461779 3300006358 Bacteria 1140
92 Ga0068871_100464011 3300006358 Bacteria 1137
93 Ga0068871_101057737 3300006358 Bacteria 758
94 Ga0075428_100094613 3300006844 Bacteria 3257
95 Ga0075428_100291041 3300006844 Bacteria 1757
96 Ga0075428_100319821 3300006844 Bacteria 1667
97 Ga0075428_100400815 3300006844 Bacteria 1470
98 Ga0075431_100163078 3300006847 Bacteria 2291
99 Ga0075433_10152767 3300006852 Bacteria 2054
100 Ga0075434_100023311 3300006871 Bacteria 6030
101 Ga0075434_100037595 3300006871 Unclassified 4793
102 Ga0075434_100283825 3300006871 Unclassified 1675
103 Ga0075434_101086874 3300006871 Unclassified 813
104 Ga0075434_101727781 3300006871 Unclassified 633
105 Ga0075429_100084436 3300006880 Bacteria 2767
106 Ga0068865_100075015 3300006881 Bacteria 2410
107 Ga0068865_100971692 3300006881 Bacteria 742
108 Ga0075436_100205114 3300006914 Unclassified 1397
109 Ga0075436_100755780 3300006914 Unclassified 722
110 Ga0097620_100221673 3300006931 Bacteria 1979
111 Ga0097620_100519413 3300006931 Bacteria 1286
112 Ga0097620_100818801 3300006931 Bacteria 1018
113 Ga0097620_101230147 3300006931 Unclassified 825
114 Ga0075435_100240781 3300007076 Unclassified 1539
115 Ga0075435_101314882 3300007076 Bacteria 633
116 Ga0099794_10689754 3300007265 Bacteria 543
117 Ga0105240_10434899 3300009093 Bacteria 1471
118 Ga0105240_11298904 3300009093 Bacteria 767
119 Ga0111539_11285148 3300009094 Unclassified 849
120 Ga0111539_11373463 3300009094 Unclassified 820
121 Ga0111539_11603513 3300009094 Unclassified 755
122 Ga0111539_12055219 3300009094 Unclassified 663
123 Ga0105245_10000442 3300009098 Bacteria 38079
124 Ga0105245_10047772 3300009098 Bacteria 3827
125 Ga0105245_10128441 3300009098 Bacteria 2375
126 Ga0105245_10160841 3300009098 Bacteria 2131
127 Ga0105245_10234336 3300009098 Bacteria 1777
128 Ga0105245_10305997 3300009098 Bacteria 1561
129 Ga0105245_12832731 3300009098 Unclassified 537
130 Ga0105247_10133267 3300009101 Bacteria 1621
131 Ga0114129_10000411 3300009147 Bacteria 50559
132 Ga0114129_10007460 3300009147 Bacteria 15578
133 Ga0114129_10011737 3300009147 Bacteria 12466
134 Ga0114129_10092483 3300009147 Unclassified 4190
135 Ga0114129_10292613 3300009147 Bacteria 2173
136 Ga0114129_11965468 3300009147 Unclassified 708
137 Ga0114129_13304768 3300009147 Unclassified 521
138 Ga0105243_10135224 3300009148 Bacteria 2097
139 Ga0105243_10165579 3300009148 Bacteria 1910
140 Ga0105243_10714921 3300009148 Unclassified 978
141 Ga0105243_12042651 3300009148 Bacteria 608
142 Ga0105241_10011322 3300009174 Bacteria 6539
143 Ga0105241_10041932 3300009174 Bacteria 3460
144 Ga0105242_10090316 3300009176 Plasmid 2576
145 Ga0105242_10194680 3300009176 Bacteria 1797
146 Ga0105242_10262179 3300009176 Unclassified 1561
147 Ga0105242_10336684 3300009176 Bacteria 1389
148 Ga0105242_10337606 3300009176 Bacteria 1388
149 Ga0105248_10002254 3300009177 Bacteria 21370
150 Ga0105248_10065647 3300009177 Bacteria 4075
151 Ga0105248_10380721 3300009177 Unclassified 1589
152 Ga0105248_10472184 3300009177 Bacteria 1414
153 Ga0105237_10284635 3300009545 Bacteria 1656
154 Ga0105238_10185066 3300009551 Bacteria 2059
155 Ga0105249_11075223 3300009553 Bacteria 874
156 Ga0105249_11527816 3300009553 Unclassified 740
157 Ga0105249_12798058 3300009553 Unclassified 559
158 Ga0105239_10040224 3300010375 Bacteria 5123
159 Ga0105246_10099639 3300011119 Bacteria 2112
160 Ga0105246_10425658 3300011119 Bacteria 1109
161 Ga0157374_10608004 3300013296 Unclassified 1103
162 Ga0157374_10887130 3300013296 Unclassified 909
163 Ga0157378_10046996 3300013297 Bacteria 3838
164 Ga0157378_10162820 3300013297 Unclassified 2087
165 Ga0157378_11046472 3300013297 Bacteria 852
166 Ga0157378_11625341 3300013297 Bacteria 692
167 Ga0157378_12173580 3300013297 Unclassified 606
168 Ga0163162_10016994 3300013306 Bacteria 7118
169 Ga0163162_10021741 3300013306 Bacteria 6319
170 Ga0157372_10032654 3300013307 Bacteria 5709
171 Ga0157375_10011323 3300013308 Bacteria 7877
172 Ga0157375_10652683 3300013308 Unclassified 1208
173 Ga0163163_10000715 3300014325 Bacteria 28149
174 Ga0163163_10063607 3300014325 Bacteria 3659
175 Ga0163163_10261197 3300014325 Bacteria 1783
176 Ga0163163_12823161 3300014325 Bacteria 542
177 Ga0157380_10510663 3300014326 Bacteria 1170
178 Ga0157380_13437672 3300014326 Unclassified 507
179 Ga0157379_10019727 3300014968 Bacteria 5957
180 Ga0157379_10025791 3300014968 Bacteria 5225
181 Ga0157379_10269711 3300014968 Bacteria 1547
182 Ga0157379_10601282 3300014968 Bacteria 1027
183 Ga0157379_11184848 3300014968 Unclassified 734
184 Ga0157376_10006191 3300014969 Bacteria 8431
185 Ga0157376_10277287 3300014969 Bacteria 1577
186 Ga0163161_11127707 3300017792 Unclassified 675
187 Ga0207642_10034875 3300025899 Bacteria 2144
188 Ga0207642_10503376 3300025899 Unclassified 742
189 Ga0207642_10630917 3300025899 Bacteria 670
190 Ga0207710_10026150 3300025900 Bacteria 2520
191 Ga0207680_10024839 3300025903 Unclassified 3295
192 Ga0207699_10368509 3300025906 Unclassified 1017
193 Ga0207645_10612978 3300025907 Unclassified 739
194 Ga0207643_10630224 3300025908 Unclassified 691
195 Ga0207654_10060853 3300025911 Bacteria 2207
196 Ga0207654_10064779 3300025911 Bacteria 2150
197 Ga0207654_10148998 3300025911 Bacteria 1500
198 Ga0207695_10260458 3300025913 Bacteria 1632
199 Ga0207663_10142747 3300025916 Bacteria 1670
200 Ga0207646_10026367 3300025922 Bacteria 5304
201 Ga0207646_10299127 3300025922 Unclassified 1454
202 Ga0207646_11220550 3300025922 Unclassified 659
203 Ga0207646_11363387 3300025922 Unclassified 618
204 Ga0207681_10147827 3300025923 Bacteria 1757
205 Ga0207694_10381795 3300025924 Bacteria 1169
206 Ga0207659_10005303 3300025926 Bacteria 7813
207 Ga0207687_10000967 3300025927 Bacteria 19513
208 Ga0207687_10014031 3300025927 Bacteria 5238
209 Ga0207687_10169383 3300025927 Unclassified 1683
210 Ga0207687_11130397 3300025927 Bacteria 673
211 Ga0207700_11492412 3300025928 Unclassified 600
212 Ga0207644_10236060 3300025931 Unclassified 1454
213 Ga0207644_10795496 3300025931 Unclassified 791
214 Ga0207686_10020244 3300025934 Bacteria 3798
215 Ga0207686_10063526 3300025934 Bacteria 2348
216 Ga0207686_10171174 3300025934 Bacteria 1532
217 Ga0207686_10324355 3300025934 Unclassified 1152
218 Ga0207686_10556550 3300025934 Bacteria 897
219 Ga0207709_10156106 3300025935 Bacteria 1586
220 Ga0207709_10169046 3300025935 Bacteria 1532
221 Ga0207670_11080251 3300025936 Bacteria 677
222 Ga0207704_10048646 3300025938 Bacteria 2544
223 Ga0207691_10707325 3300025940 Bacteria 849
224 Ga0207711_10009468 3300025941 Bacteria 8128
225 Ga0207711_10243156 3300025941 Bacteria 1650
226 Ga0207711_10325473 3300025941 Unclassified 1421
227 Ga0207711_10584139 3300025941 Bacteria 1042
228 Ga0207689_10007461 3300025942 Bacteria 9586
229 Ga0207689_10315300 3300025942 Unclassified 1297
230 Ga0207689_10923062 3300025942 Unclassified 737
231 Ga0207689_11099952 3300025942 Unclassified 670
232 Ga0207689_11372347 3300025942 Unclassified 593
233 Ga0207661_10272256 3300025944 Unclassified 1511
234 Ga0207667_10428064 3300025949 Bacteria 1346
235 Ga0207651_10224410 3300025960 Bacteria 1521
236 Ga0207651_10949482 3300025960 Bacteria 767
237 Ga0207651_11155792 3300025960 Unclassified 694
238 Ga0207712_10247064 3300025961 Unclassified 1440
239 Ga0207712_10574862 3300025961 Bacteria 972
240 Ga0207712_10769160 3300025961 Bacteria 845
241 Ga0207658_10032774 3300025986 Unclassified 3701
242 Ga0207658_10618721 3300025986 Bacteria 974
243 Ga0207677_10014439 3300026023 Bacteria 4613
244 Ga0207677_10047991 3300026023 Bacteria 2872
245 Ga0207677_10241374 3300026023 Bacteria 1462
246 Ga0207677_11189433 3300026023 Bacteria 697
247 Ga0207703_10109109 3300026035 Bacteria 2358
248 Ga0207703_10139647 3300026035 Bacteria 2101
249 Ga0207703_10181702 3300026035 Unclassified 1857
250 Ga0207703_10246405 3300026035 Bacteria 1609
251 Ga0207703_10338347 3300026035 Unclassified 1382
252 Ga0207703_10686833 3300026035 Unclassified 973
253 Ga0207639_10708384 3300026041 Bacteria 934
254 Ga0207702_10185368 3300026078 Bacteria 1919
255 Ga0207702_10430523 3300026078 Bacteria 1277
256 Ga0207641_10163519 3300026088 Bacteria 2025
257 Ga0207641_10414725 3300026088 Unclassified 1295
258 Ga0207648_10188565 3300026089 Bacteria 1827
259 Ga0207648_10713349 3300026089 Unclassified 930
260 Ga0207676_10013602 3300026095 Bacteria 5841
261 Ga0207674_10587089 3300026116 Unclassified 1076
262 Ga0207675_101928391 3300026118 Bacteria 609
263 Ga0268266_10905301 3300028379 Unclassified 853
264 Ga0268264_10004712 3300028381 Bacteria 11591
265 Ga0268264_10136866 3300028381 Bacteria 2179
266 Ga0268264_10298120 3300028381 Bacteria 1516
267 Ga0268264_10438773 3300028381 Bacteria 1263
268 Ga0268264_11931776 3300028381 Unclassified 600
269 Ga0373944_0194894 3300035089 Unclassified 731
270 Ga0373939_0142104 3300035114 Bacteria 866
271 Ga0373954_0000315 3300035118 Bacteria 17678
272 Ga0373954_0430556 3300035118 Unclassified 653
273 Ga0373943_0207793 3300035170 Unclassified 1086
274 Ga0373955_0044875 3300035172 Bacteria 2383
275 Ga0373961_0102752 3300035241 Unclassified 927
276 Ga0373931_0014633 3300035691 Bacteria 3838
277 Ga0373935_0847618 3300035692 Unclassified 676
278 Ga0373927_0281133 3300035695 Unclassified 1095
279 Ga0373927_0312874 3300035695 Bacteria 1034
280 Ga0373937_0001248 3300036401 Bacteria 21400
281 Ga0373937_1855766 3300036401 Unclassified 549
282 Ga0373925_0011193 3300037068 Bacteria 6507
283 Ga0373925_0274762 3300037068 Bacteria 1356
284 Ga0242420_110013 3300038996 Bacteria 593
285 Ga0451576_0729834 3300045051 Unclassified 1041
286 Ga0495592_0219572 3300046454 Bacteria 1272
287 Ga0495651_0159685 3300046462 Bacteria 1616
288 Ga0495580_0068472 3300046472 Bacteria 2482
289 Ga0495582_0003912 3300046473 Bacteria 8360
290 Ga0495628_1037116 3300046516 Bacteria 563
291 Ga0495630_0759883 3300046517 Unclassified 741
292 Ga0495666_0177246 3300046526 Bacteria 985
293 Ga0495665_0046460 3300046531 Bacteria 2305
294 Ga0495586_0018415 3300046535 Bacteria 3718
295 Ga0495667_0256744 3300046559 Bacteria 1112
296 Ga0495634_0071398 3300046642 Bacteria 2286
297 Ga0495588_0708326 3300046674 Unclassified 526
298 Ga0495623_0181585 3300046679 Bacteria 1222
299 Ga0495647_0083568 3300046681 Bacteria 1298
300 Ga0495658_0204304 3300046683 Bacteria 1232
301 Ga0495613_0094230 3300046689 Bacteria 2167
302 Ga0495624_0788214 3300046690 Unclassified 562
303 Ga0495636_0161890 3300047318 Unclassified 1009
304 Ga0496100_1526385 3300048903 Bacteria 528
305 Ga0496102_0314623 3300048905 Bacteria 1475
306 Ga0496104_1561271 3300048907 Unclassified 563
307 Ga0496109_0558270 3300048912 Bacteria 1080
308 Ga0496109_0627972 3300048912 Bacteria 1011
309 Ga0496114_0614637 3300048917 Bacteria 958
310 Ga0496114_0733162 3300048917 Bacteria 865
311 nmdc:mga05p37_14373_c1 3300050507 Bacteria 9507
312 nmdc:mga05p37_1600936_c1 3300050507 Unclassified 642
313 nmdc:mga05p37_168361_c1 3300050507 Bacteria 2673
314 nmdc:mga05p37_180987_c1 3300050507 Unclassified 2564
315 nmdc:mga05p37_184740_c1 3300050507 Bacteria 2535
316 nmdc:mga05p37_620551_c1 3300050507 Unclassified 1217
317 nmdc:mga05p37_823068_c1 3300050507 Bacteria 1012
318 nmdc:mga05p37_917927_c1 3300050507 Unclassified 942
319 nmdc:mga05p37_9372_c1 3300050507 Bacteria 11588
320 nmdc:mga09592_46608_c1 3300050508 Bacteria 3652
321 nmdc:mga06r32_1076897_c1 3300050510 Unclassified 754
322 nmdc:mga08y16_1075665_c1 3300050511 Unclassified 780
323 nmdc:mga08y16_253667_c1 3300050511 Bacteria 1817
324 nmdc:mga0n895_1134597_c1 3300050512 Bacteria 758
325 nmdc:mga0n895_1720851_c1 3300050512 Unclassified 589
326 nmdc:mga0n895_211182_c1 3300050512 Bacteria 1971
327 nmdc:mga0n895_277958_c1 3300050512 Unclassified 1698
328 nmdc:mga0n895_54147_c1 3300050512 Plasmid 3945
329 nmdc:mga0n895_7687_c1 3300050512 Bacteria 9273
330 nmdc:mga0rr50_1306699_c1 3300050513 Bacteria 615
331 nmdc:mga0rr50_282615_c1 3300050513 Bacteria 1385
332 nmdc:mga0rr50_28464_c1 3300050513 Bacteria 3928
333 nmdc:mga08x19_598478_c1 3300050514 Unclassified 781
334 nmdc:mga0a205_117221_c1 3300050515 Bacteria 2561
335 Ga0068859_100818951
336 Ga0065707_10318251
337 Ga0070676_10620802
338 Ga0070683_100068948
339 Ga0070690_100423903
340 Ga0070690_100470727
341 Ga0070677_10149737
342 Ga0068869_100016706
343 Ga0068869_100660932
344 Ga0068869_101084292
345 Ga0068869_101970017
346 Ga0070666_10001841
347 Ga0070666_10113856
348 Ga0068868_100319689
349 Ga0068868_100411576
350 Ga0068868_100526837
351 Ga0070660_100108939
352 Ga0070692_10793295
353 Ga0070669_100282674
354 Ga0070675_100131920
355 Ga0070673_100261792
356 Ga0070673_102023146
357 Ga0070659_100199013
358 Ga0070667_100013746
359 Ga0070667_100222604
360 Ga0070667_101618060
361 Ga0070709_10527407
362 Ga0070709_11548611
363 Ga0070713_101016374
364 Ga0070710_10535093
365 Ga0070701_10456563
366 Ga0070711_100145322
367 Ga0070694_101836656
368 Ga0070708_100172278
369 Ga0070678_101662922
370 Ga0068867_100177621
371 Ga0068867_102168846
372 Ga0070706_101782097
373 Ga0070707_100005016
374 Ga0070707_100217226
375 Ga0070684_100087317
376 Ga0070697_100999446
377 Ga0070697_101546080
378 Ga0068853_100218164
379 Ga0070672_100341034
380 Ga0070695_100246210
381 Ga0070696_100746922
382 Ga0070693_100097094
383 Ga0070665_100129297
384 Ga0070665_101502268
385 Ga0068855_100039926
386 Ga0070664_100040054
387 Ga0068857_100511155
388 Ga0068856_100032631
389 Ga0068856_101608850
390 Ga0068859_100221663
391 Ga0068859_100519426
392 Ga0068859_101230285
393 Ga0068864_100151411
394 Ga0068864_100822917
395 Ga0068866_10207662
396 Ga0068866_10216143
397 Ga0068866_10410076
398 Ga0068866_11331987
399 Ga0068851_10103321
400 Ga0068863_100015748
401 Ga0068863_100495349
402 Ga0068863_100782588
403 Ga0068863_100990756
404 Ga0068858_100007560
405 Ga0068858_100015844
406 Ga0068858_100609099
407 Ga0068858_100873094
408 Ga0068858_101244309
409 Ga0068858_101347235
410 Ga0068858_101369106
411 Ga0068860_100001595
412 Ga0068860_100075384
413 Ga0068860_100300707
414 Ga0068860_101064019
415 Ga0068860_101358076
416 Ga0081539_10000010
417 Ga0081539_10005748
418 Ga0097621_100003308
419 Ga0097621_100082710
420 Ga0097621_100092962
421 Ga0097621_100723136
422 Ga0097621_100885654
423 Ga0068871_100019085
424 Ga0068871_100062697
425 Ga0068871_100461779
426 Ga0068871_100464011
427 Ga0068871_101057737
428 Ga0075428_100094613
429 Ga0075428_100291041
430 Ga0075428_100319821
431 Ga0075428_100400815
432 Ga0075431_100163078
433 Ga0075433_10152767
434 Ga0075434_100023311
435 Ga0075434_100037595
436 Ga0075434_100283825
437 Ga0075434_101086874
438 Ga0075434_101727781
439 Ga0075429_100084436
440 Ga0068865_100075015
441 Ga0068865_100971692
442 Ga0075436_100205114
443 Ga0075436_100755780
444 Ga0097620_100221673
445 Ga0097620_100519413
446 Ga0097620_100818801
447 Ga0097620_101230147
448 Ga0075435_100240781
449 Ga0075435_101314882
450 Ga0099794_10689754
451 Ga0105240_10434899
452 Ga0105240_11298904
453 Ga0111539_11285148
454 Ga0111539_11373463
455 Ga0111539_11603513
456 Ga0111539_12055219
457 Ga0105245_10000442
458 Ga0105245_10047772
459 Ga0105245_10128441
460 Ga0105245_10160841
461 Ga0105245_10234336
462 Ga0105245_10305997
463 Ga0105245_12832731
464 Ga0105247_10133267
465 Ga0114129_10000411
466 Ga0114129_10007460
467 Ga0114129_10011737
468 Ga0114129_10092483
469 Ga0114129_10292613
470 Ga0114129_11965468
471 Ga0114129_13304768
472 Ga0105243_10135224
473 Ga0105243_10165579
474 Ga0105243_10714921
475 Ga0105243_12042651
476 Ga0105241_10011322
477 Ga0105241_10041932
478 Ga0105242_10090316
479 Ga0105242_10194680
480 Ga0105242_10262179
481 Ga0105242_10336684
482 Ga0105242_10337606
483 Ga0105248_10002254
484 Ga0105248_10065647
485 Ga0105248_10380721
486 Ga0105248_10472184
487 Ga0105237_10284635
488 Ga0105238_10185066
489 Ga0105249_11075223
490 Ga0105249_11527816
491 Ga0105249_12798058
492 Ga0105239_10040224
493 Ga0105246_10099639
494 Ga0105246_10425658
495 Ga0157374_10608004
496 Ga0157374_10887130
497 Ga0157378_10046996
498 Ga0157378_10162820
499 Ga0157378_11046472
500 Ga0157378_11625341
501 Ga0157378_12173580
502 Ga0163162_10016994
503 Ga0163162_10021741
504 Ga0157372_10032654
505 Ga0157375_10011323
506 Ga0157375_10652683
507 Ga0163163_10000715
508 Ga0163163_10063607
509 Ga0163163_10261197
510 Ga0163163_12823161
511 Ga0157380_10510663
512 Ga0157380_13437672
513 Ga0157379_10019727
514 Ga0157379_10025791
515 Ga0157379_10269711
516 Ga0157379_10601282
517 Ga0157379_11184848
518 Ga0157376_10006191
519 Ga0157376_10277287
520 Ga0163161_11127707
521 Ga0207642_10034875
522 Ga0207642_10503376
523 Ga0207642_10630917
524 Ga0207710_10026150
525 Ga0207680_10024839
526 Ga0207699_10368509
527 Ga0207645_10612978
528 Ga0207643_10630224
529 Ga0207654_10060853
530 Ga0207654_10064779
531 Ga0207654_10148998
532 Ga0207695_10260458
533 Ga0207663_10142747
534 Ga0207646_10026367
535 Ga0207646_10299127
536 Ga0207646_11220550
537 Ga0207646_11363387
538 Ga0207681_10147827
539 Ga0207694_10381795
540 Ga0207659_10005303
541 Ga0207687_10000967
542 Ga0207687_10014031
543 Ga0207687_10169383
544 Ga0207687_11130397
545 Ga0207700_11492412
546 Ga0207644_10236060
547 Ga0207644_10795496
548 Ga0207686_10020244
549 Ga0207686_10063526
550 Ga0207686_10171174
551 Ga0207686_10324355
552 Ga0207686_10556550
553 Ga0207709_10156106
554 Ga0207709_10169046
555 Ga0207670_11080251
556 Ga0207704_10048646
557 Ga0207691_10707325
558 Ga0207711_10009468
559 Ga0207711_10243156
560 Ga0207711_10325473
561 Ga0207711_10584139
562 Ga0207689_10007461
563 Ga0207689_10315300
564 Ga0207689_10923062
565 Ga0207689_11099952
566 Ga0207689_11372347
567 Ga0207661_10272256
568 Ga0207667_10428064
569 Ga0207651_10224410
570 Ga0207651_10949482
571 Ga0207651_11155792
572 Ga0207712_10247064
573 Ga0207712_10574862
574 Ga0207712_10769160
575 Ga0207658_10032774
576 Ga0207658_10618721
577 Ga0207677_10014439
578 Ga0207677_10047991
579 Ga0207677_10241374
580 Ga0207677_11189433
581 Ga0207703_10109109
582 Ga0207703_10139647
583 Ga0207703_10181702
584 Ga0207703_10246405
585 Ga0207703_10338347
586 Ga0207703_10686833
587 Ga0207639_10708384
588 Ga0207702_10185368
589 Ga0207702_10430523
590 Ga0207641_10163519
591 Ga0207641_10414725
592 Ga0207648_10188565
593 Ga0207648_10713349
594 Ga0207676_10013602
595 Ga0207674_10587089
596 Ga0207675_101928391
597 Ga0268266_10905301
598 Ga0268264_10004712
599 Ga0268264_10136866
600 Ga0268264_10298120
601 Ga0268264_10438773
602 Ga0268264_11931776
603 Ga0373944_0194894
604 Ga0373939_0142104
605 Ga0373954_0000315
606 Ga0373954_0430556
607 Ga0373943_0207793
608 Ga0373955_0044875
609 Ga0373961_0102752
610 Ga0373931_0014633
611 Ga0373935_0847618
612 Ga0373927_0281133
613 Ga0373927_0312874
614 Ga0373937_0001248
615 Ga0373937_1855766
616 Ga0373925_0011193
617 Ga0373925_0274762
618 Ga0242420_110013
619 Ga0451576_0729834
620 Ga0495592_0219572
621 Ga0495651_0159685
622 Ga0495580_0068472
623 Ga0495582_0003912
624 Ga0495628_1037116
625 Ga0495630_0759883
626 Ga0495666_0177246
627 Ga0495665_0046460
628 Ga0495586_0018415
629 Ga0495667_0256744
630 Ga0495634_0071398
631 Ga0495588_0708326
632 Ga0495623_0181585
633 Ga0495647_0083568
634 Ga0495658_0204304
635 Ga0495613_0094230
636 Ga0495624_0788214
637 Ga0495636_0161890
638 Ga0496100_1526385
639 Ga0496102_0314623
640 Ga0496104_1561271
641 Ga0496109_0558270
642 Ga0496109_0627972
643 Ga0496114_0614637
644 Ga0496114_0733162
645 nmdc:mga05p37_14373_c1
646 nmdc:mga05p37_1600936_c1
647 nmdc:mga05p37_168361_c1
648 nmdc:mga05p37_180987_c1
649 nmdc:mga05p37_184740_c1
650 nmdc:mga05p37_620551_c1
651 nmdc:mga05p37_823068_c1
652 nmdc:mga05p37_917927_c1
653 nmdc:mga05p37_9372_c1
654 nmdc:mga09592_46608_c1
655 nmdc:mga06r32_1076897_c1
656 nmdc:mga08y16_1075665_c1
657 nmdc:mga08y16_253667_c1
658 nmdc:mga0n895_1134597_c1
659 nmdc:mga0n895_1720851_c1
660 nmdc:mga0n895_211182_c1
661 nmdc:mga0n895_277958_c1
662 nmdc:mga0n895_54147_c1
663 nmdc:mga0n895_7687_c1
664 nmdc:mga0rr50_1306699_c1
665 nmdc:mga0rr50_282615_c1
666 nmdc:mga0rr50_28464_c1
667 nmdc:mga08x19_598478_c1
668 nmdc:mga0a205_117221_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

11

110

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8544 50 73
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.801 37 70
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7979 37 70
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.785 36 70
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7843 37 70
ID Description Score Start End Superfamily
5w8mB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8544 50 73 3.60.21.10
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8299 41 73 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8207 35 94 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7855 33 114 2.40.50.140
af_Q95Y97_40_169_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7621 34 114 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A317HSD9-F1-model_v4 Uncharacterized protein 0.986 24 133
AF-A0A6L8BE25-F1-model_v4 Uncharacterized protein 0.9659 23 121
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9637 30 119
AF-A0A6I4SV82-F1-model_v4 Uncharacterized protein 0.9631 30 119
AF-A0A7X4JF88-F1-model_v4 Uncharacterized protein 0.96 24 130

Map