F411703

General Info

Members Datasets Scaffolds Average Seq Length
334 237 668 243

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100000440|Ga0068859_10000044046
Length 283
Sequence VAGPLVGGAAGPAHQLPRSGPRTSGAEPLRNTNGCKGWARIGSLAVFTEGVVEGSPVGRRVVLGLIALGAAGVAVGAEVEEAVDKVTAPLRRSDPTGLTELIPGTGFEIYTVASSVPHLSAADYQLKVHGLVNQPMTLTLPQLEAMPQTEMTRDFQCVTGWRVSDVHWSGVRLADLLDRVETQPTARAVTFRSFDGLYTESLTIEQARRSDVLVALRMLDGPVSYEHGGPVRLYVAPMYGYKSIKWLGEIELVDQVDPGWWEVRGYDVDAWIGKSNGRDDQPV

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
15 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
28 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
39 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
43 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
44 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
45 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
51 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
54 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
55 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
175 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
176 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 2517572101 Frankia sp. DC12 Isolate Nodule
181 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
182 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
183 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
184 2643221548 Streptomyces sp. Root55 Isolate Unclassified
185 2643221647 Streptomyces sp. Root369 Isolate Unclassified
186 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
187 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
188 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
189 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
190 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
191 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
192 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
193 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
194 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
195 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
196 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
197 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
198 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
199 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
200 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
201 2862574272 Streptomyces sp. AcE210 Isolate Nodule
202 2867428634 Streptomyces sp. RP5T Isolate Unclassified
203 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
204 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
205 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
206 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
207 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
208 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
209 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
210 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
211 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
212 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
213 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
214 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
215 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
216 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
217 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
218 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
219 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
220 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
221 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
222 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
223 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
224 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
225 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
226 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
227 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
228 8002775197 Frankia nepalensis CN7 Isolate Nodule
229 8002784119 Frankia sp. AgB1.9 Isolate Nodule
230 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
231 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
232 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
233 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
234 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
235 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
236 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
237 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.54
Metatranscriptomes 0.6
Isolates 18.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 1.2
Rhizoplane 2.1
Rhizosphere 75.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100000440 3300005617 Bacteria 41783
2 rootH1_10076753 3300003316 Bacteria 4528
3 rootH2_10020050 3300003320 Bacteria 7258
4 JGI25160J50197_1003995 3300003354 Bacteria 6436
5 JGI25160J50197_1008917 3300003354 Bacteria 3770
6 Ga0006562J51391_1065372 3300003578 Bacteria 3630
7 Ga0006562J51391_1065373 3300003578 Bacteria 2760
8 Ga0070681_10377745 3300005458 Bacteria 1328
9 Ga0068862_100001125 3300005844 Bacteria 25386
10 Ga0075363_100027962 3300006048 Bacteria 2897
11 Ga0075363_100220888 3300006048 Bacteria 1086
12 Ga0075367_10006460 3300006178 Bacteria 5926
13 Ga0075369_10076296 3300006186 Bacteria 1481
14 Ga0075428_100199979 3300006844 Bacteria 2161
15 Ga0075429_100107570 3300006880 Bacteria 2437
16 Ga0097620_100000440 3300006931 Bacteria 41783
17 Ga0105249_10004413 3300009553 Bacteria 12164
18 Ga0163163_10006484 3300014325 Bacteria 10242
19 Ga0182008_10009690 3300014497 Bacteria 5188
20 Ga0182007_10003962 3300015262 Bacteria 6838
21 Ga0182005_1007674 3300015265 Bacteria 3223
22 Ga0183367_1010 3300015688 Bacteria 416164
23 Ga0213875_10024863 3300021388 Bacteria 2855
24 Ga0209758_1010281 3300025297 Bacteria 5630
25 Ga0207426_1003796 3300025302 Bacteria 7839
26 Ga0207426_1011354 3300025302 Bacteria 3397
27 Ga0207711_10000049 3300025941 Bacteria 147090
28 Ga0207703_10036327 3300026035 Bacteria 3921
29 Ga0207702_10327788 3300026078 Bacteria 1460
30 Ga0207641_10004054 3300026088 Bacteria 12778
31 Ga0209813_10007682 3300027866 Bacteria 2694
32 Ga0268265_10000157 3300028380 Bacteria 83507
33 Ga0307517_10012108 3300028786 Bacteria 11886
34 Ga0307511_10000282 3300030521 Bacteria 53455
35 Ga0307512_10002276 3300030522 Bacteria 24838
36 Ga0307513_10180211 3300031456 Bacteria 1977
37 Ga0307509_10025002 3300031507 Bacteria 6677
38 Ga0307509_10115764 3300031507 Bacteria 2672
39 Ga0307508_10001243 3300031616 Bacteria 29109
40 Ga0307508_10014612 3300031616 Bacteria 7163
41 Ga0307514_10001618 3300031649 Bacteria 26363
42 Ga0307514_10244184 3300031649 Bacteria 1072
43 Ga0307516_10020133 3300031730 Bacteria 6899
44 Ga0307516_10063450 3300031730 Bacteria 3576
45 Ga0307518_10006487 3300031838 Bacteria 8391
46 Ga0307518_10135407 3300031838 Bacteria 1725
47 Ga0307507_10010824 3300033179 Bacteria 11664
48 Ga0307507_10097890 3300033179 Bacteria 2472
49 Ga0307510_10036461 3300033180 Bacteria 5471
50 Ga0307510_10036516 3300033180 Bacteria 5466
51 Ga0395898_0015108 3300037466 Bacteria 7925
52 Ga0436364_1354403 3300037853 Bacteria 5613
53 Ga0451791_0121391 3300041451 Bacteria 1183
54 Ga0451795_1292222 3300041456 Bacteria 955
55 Ga0451853_1373677 3300041512 Bacteria 2805
56 Ga0439433_0002479 3300041999 Bacteria 3916
57 Ga0439448_0001387 3300042005 Bacteria 6238
58 Ga0439449_0030014 3300042007 Bacteria 2025
59 Ga0439455_0014697 3300042012 Bacteria 1790
60 Ga0439457_002156 3300042014 Bacteria 5710
61 Ga0439462_0002561 3300042015 Bacteria 4241
62 Ga0450890_017612 3300042127 Bacteria 951
63 Ga0450903_000019 3300042138 Bacteria 31775
64 Ga0450906_000827 3300042145 Bacteria 6839
65 Ga0439459_0036397 3300042438 Bacteria 1027
66 Ga0466969_0008353 3300044656 Bacteria 5489
67 Ga0466969_0071189 3300044656 Bacteria 1672
68 Ga0466965_0002191 3300044683 Bacteria 8214
69 Ga0466965_0117295 3300044683 Bacteria 1372
70 Ga0466966_0009575 3300044684 Bacteria 6412
71 Ga0466966_0033406 3300044684 Bacteria 3331
72 Ga0466966_0040420 3300044684 Bacteria 3002
73 Ga0466961_0003274 3300044693 Bacteria 10085
74 Ga0466961_0166014 3300044693 Bacteria 1374
75 Ga0466963_0008020 3300044694 Bacteria 6321
76 Ga0466971_0001320 3300044719 Bacteria 10367
77 Ga0466970_0000814 3300044765 Bacteria 14993
78 Ga0466957_0026926 3300044842 Bacteria 3413
79 Ga0466958_0046989 3300045836 Bacteria 2605
80 Ga0466967_0049712 3300045976 Bacteria 3668
81 Ga0466967_0148368 3300045976 Bacteria 2189
82 Ga0466967_0367426 3300045976 Bacteria 1395
83 Ga0495617_006160 3300046452 Bacteria 4220
84 Ga0495627_018328 3300046453 Bacteria 2363
85 Ga0495592_0005819 3300046454 Bacteria 9141
86 Ga0495592_0025121 3300046454 Bacteria 4523
87 Ga0495603_0032096 3300046455 Bacteria 3160
88 Ga0495603_0068827 3300046455 Bacteria 2082
89 Ga0495590_0067596 3300046457 Bacteria 1252
90 Ga0495629_0011077 3300046459 Bacteria 6551
91 Ga0495629_0355745 3300046459 Bacteria 998
92 Ga0495629_0367076 3300046459 Bacteria 980
93 Ga0495638_0125152 3300046460 Bacteria 1515
94 Ga0495651_0002049 3300046462 Bacteria 15572
95 Ga0495582_0010809 3300046473 Bacteria 5025
96 Ga0495582_0018333 3300046473 Bacteria 3829
97 Ga0495605_0024929 3300046474 Bacteria 3122
98 Ga0495605_0025142 3300046474 Bacteria 3105
99 Ga0495662_0000555 3300046476 Bacteria 17128
100 Ga0495662_0039472 3300046476 Bacteria 2280
101 Ga0495664_0006957 3300046477 Bacteria 6263
102 Ga0495585_0177982 3300046492 Bacteria 1095
103 Ga0495594_0014420 3300046499 Bacteria 4142
104 Ga0495594_0056599 3300046499 Bacteria 2164
105 Ga0495594_0057483 3300046499 Bacteria 2148
106 Ga0495594_0252966 3300046499 Bacteria 1003
107 Ga0495596_0012463 3300046500 Bacteria 3640
108 Ga0495607_0130607 3300046501 Bacteria 1307
109 Ga0495607_0161741 3300046501 Bacteria 1137
110 Ga0495606_0012092 3300046507 Bacteria 6963
111 Ga0495610_0030685 3300046512 Bacteria 2813
112 Ga0495618_0080646 3300046514 Bacteria 2076
113 Ga0495628_0030012 3300046516 Bacteria 4404
114 Ga0495628_0080920 3300046516 Bacteria 2523
115 Ga0495631_0003284 3300046518 Bacteria 8892
116 Ga0495643_0010303 3300046522 Bacteria 5757
117 Ga0495644_0108230 3300046523 Bacteria 1054
118 Ga0495648_0027884 3300046524 Bacteria 3772
119 Ga0495642_0032078 3300046528 Bacteria 2107
120 Ga0495652_0142135 3300046529 Bacteria 1886
121 Ga0495654_0034365 3300046530 Bacteria 2558
122 Ga0495640_0030795 3300046533 Bacteria 3837
123 Ga0495640_0046325 3300046533 Bacteria 3013
124 Ga0495586_0108577 3300046535 Bacteria 1543
125 Ga0495587_0008974 3300046536 Bacteria 6416
126 Ga0495609_0033910 3300046538 Bacteria 2315
127 Ga0495597_0056049 3300046542 Bacteria 1727
128 Ga0495645_0006416 3300046543 Bacteria 8162
129 Ga0495622_0018203 3300046557 Bacteria 3271
130 Ga0495667_0021045 3300046559 Bacteria 4400
131 Ga0495667_0180602 3300046559 Bacteria 1354
132 Ga0495668_0020654 3300046616 Bacteria 3785
133 Ga0495668_0121231 3300046616 Bacteria 1431
134 Ga0495634_0007416 3300046642 Bacteria 8244
135 Ga0495634_0058143 3300046642 Bacteria 2578
136 Ga0495625_0010090 3300046660 Bacteria 7848
137 Ga0495625_0036252 3300046660 Bacteria 3626
138 Ga0495625_0141935 3300046660 Bacteria 1620
139 Ga0495625_0384936 3300046660 Bacteria 879
140 Ga0495635_0004385 3300046663 Bacteria 9772
141 Ga0495635_0061075 3300046663 Bacteria 2589
142 Ga0495661_0083312 3300046665 Bacteria 1839
143 Ga0495588_0012558 3300046674 Bacteria 4007
144 Ga0495657_0000739 3300046675 Bacteria 29139
145 Ga0495657_0001088 3300046675 Bacteria 23837
146 Ga0495657_0015584 3300046675 Bacteria 5556
147 Ga0495623_0099012 3300046679 Bacteria 1778
148 Ga0495646_0000319 3300046680 Bacteria 24783
149 Ga0495658_0020711 3300046683 Bacteria 3456
150 Ga0495613_0001029 3300046689 Bacteria 21264
151 Ga0495613_0052324 3300046689 Bacteria 3008
152 Ga0495613_0053182 3300046689 Bacteria 2980
153 Ga0495613_0256467 3300046689 Bacteria 1219
154 Ga0495624_0045499 3300046690 Bacteria 2793
155 Ga0495624_0132115 3300046690 Bacteria 1530
156 Ga0495671_0005994 3300046692 Bacteria 7066
157 Ga0495671_0144494 3300046692 Bacteria 1159
158 Ga0495649_0119528 3300046694 Bacteria 1394
159 Ga0495649_0328939 3300046694 Bacteria 775
160 Ga0495589_0015768 3300046794 Bacteria 3884
161 Ga0495589_0019914 3300046794 Bacteria 3432
162 Ga0495589_0024196 3300046794 Bacteria 3087
163 Ga0495589_0028707 3300046794 Bacteria 2806
164 Ga0495589_0132873 3300046794 Bacteria 1194
165 Ga0495600_0013822 3300046809 Bacteria 5083
166 Ga0495600_0194495 3300046809 Bacteria 1303
167 Ga0495581_0002352 3300047315 Bacteria 10665
168 Ga0495581_0023677 3300047315 Bacteria 3558
169 Ga0495604_0000932 3300047317 Bacteria 24349
170 Ga0495604_0008324 3300047317 Bacteria 8202
171 Ga0495636_0018538 3300047318 Bacteria 2793
172 Ga0495636_0019896 3300047318 Bacteria 2702
173 Ga0495636_0054238 3300047318 Bacteria 1684
174 Ga0495636_0058331 3300047318 Bacteria 1627
175 Ga0495636_0067960 3300047318 Bacteria 1517
176 Ga0495676_0005486 3300047321 Bacteria 11632
177 Ga0495676_0014770 3300047321 Bacteria 6973
178 Ga0495676_0030377 3300047321 Bacteria 4586
179 Ga0495680_0087677 3300047322 Bacteria 2340
180 Ga0495683_0020349 3300047323 Bacteria 3423
181 Ga0495687_000423 3300047443 Bacteria 52313
182 Ga0495687_006335 3300047443 Bacteria 7285
183 Ga0495687_015940 3300047443 Bacteria 3796
184 Ga0495687_113899 3300047443 Bacteria 989
185 Ga0495675_0009266 3300047444 Bacteria 6125
186 Ga0495685_007740 3300047447 Bacteria 3556
187 Ga0495685_010509 3300047447 Bacteria 3105
188 Ga0495685_012112 3300047447 Bacteria 2917
189 Ga0495685_017006 3300047447 Bacteria 2487
190 Ga0495681_0007577 3300047470 Bacteria 6905
191 Ga0495681_0019923 3300047470 Bacteria 3649
192 Ga0495684_0059843 3300047471 Bacteria 2900
193 Ga0495686_0131802 3300047472 Bacteria 1481
194 Ga0495686_0181448 3300047472 Bacteria 1219
195 Ga0495593_0000694 3300047673 Bacteria 19439
196 Ga0495593_0026961 3300047673 Bacteria 3166
197 Ga0495614_0011230 3300048089 Bacteria 3942
198 Ga0495614_0029544 3300048089 Bacteria 2359
199 Ga0495626_0168428 3300048091 Bacteria 914
200 Ga0496104_0357459 3300048907 Bacteria 1373
201 Ga0496105_0060597 3300048908 Bacteria 3123
202 Ga0496112_0019198 3300048915 Bacteria 6447
203 Ga0496113_0648973 3300048916 Bacteria 844
204 Ga0496116_0000136 3300048919 Bacteria 153155
205 Ga0496117_0023099 3300048920 Bacteria 4969
206 Ga0496117_0027189 3300048920 Bacteria 4463
207 Ga0496118_0004558 3300048921 Bacteria 16341
208 Ga0496118_0021242 3300048921 Bacteria 5722
209 Ga0496119_0008426 3300048922 Bacteria 9055
210 Ga0495678_036500 3300049459 Bacteria 2005
211 Ga0501032_0092775 3300049569 Bacteria 2003
212 Ga0501032_0144558 3300049569 Bacteria 1566
213 Ga0501033_0017012 3300049570 Bacteria 5496
214 Ga0501034_0002462 3300049571 Bacteria 22323
215 Ga0501034_0342559 3300049571 Bacteria 1424
216 Ga0501034_0352835 3300049571 Bacteria 1399
217 Ga0501034_0561969 3300049571 Bacteria 1049
218 Ga0501036_0001792 3300049572 Bacteria 16674
219 Ga0501036_0255308 3300049572 Bacteria 1469
220 Ga0501038_0003499 3300049574 Bacteria 14625
221 Ga0501038_0087597 3300049574 Bacteria 2615
222 Ga0501038_0148913 3300049574 Bacteria 1909
223 Ga0501039_0012162 3300049575 Bacteria 6563
224 Ga0501039_0016795 3300049575 Bacteria 5609
225 Ga0501041_0014299 3300049577 Bacteria 4712
226 Ga0501042_0021380 3300049578 Bacteria 4509
227 Ga0501043_0009054 3300049579 Bacteria 7832
228 Ga0501046_0006604 3300049580 Bacteria 10245
229 Ga0501046_0041345 3300049580 Bacteria 3679
230 Ga0501047_0145517 3300049581 Bacteria 2247
231 Ga0501047_0187348 3300049581 Bacteria 1934
232 Ga0501047_0342829 3300049581 Bacteria 1331
233 Ga0501048_0035428 3300049582 Bacteria 3593
234 Ga0501048_0411464 3300049582 Bacteria 967
235 Ga0501070_0001779 3300049586 Bacteria 19037
236 Ga0501072_0009803 3300049588 Bacteria 7284
237 Ga0501073_0233047 3300049589 Bacteria 1272
238 Ga0501074_0017222 3300049590 Bacteria 5243
239 Ga0501074_0325248 3300049590 Bacteria 1092
240 Ga0501075_0006420 3300049591 Bacteria 8094
241 Ga0501075_0347239 3300049591 Bacteria 1131
242 Ga0501076_0036707 3300049592 Bacteria 3841
243 Ga0501077_0007745 3300049593 Bacteria 6628
244 Ga0501079_0013393 3300049741 Bacteria 6255
245 Ga0501080_0054616 3300049742 Bacteria 3719
246 Ga0501080_0138332 3300049742 Bacteria 2252
247 Ga0501081_0057498 3300049743 Bacteria 2689
248 Ga0501083_0028144 3300049744 Bacteria 3876
249 Ga0501035_0032373 3300049822 Bacteria 4757
250 Ga0501035_0051923 3300049822 Bacteria 3669
251 Ga0501044_0001242 3300049823 Bacteria 30258
252 Ga0501044_0006543 3300049823 Bacteria 12861
253 Ga0501044_0159254 3300049823 Bacteria 2235
254 Ga0501044_0310363 3300049823 Bacteria 1504
255 nmdc:mga03n38_32078_c1 3300050490 Bacteria 2222
256 nmdc:mga06z11_3676_c1 3300050494 Bacteria 5957
257 nmdc:mga04h51_46571_c1 3300050495 Bacteria 1438
258 nmdc:mga07m45_122003_c1 3300050496 Bacteria 1505
259 nmdc:mga06r32_573228_c1 3300050510 Bacteria 1101
260 nmdc:mga0sz30_81086_c1 3300050516 Bacteria 1404
261 Ga0495655_0024806 3300053083 Bacteria 1396
262 Ga0500644_0052377 3300053088 Bacteria 1405
263 Ga0500640_026254 3300053095 Bacteria 2537
264 Ga0500560_001992 3300053107 Bacteria 3764
265 Ga0500572_007510 3300053111 Bacteria 2527
266 Ga0500600_0075242 3300053149 Bacteria 1841
267 Ga0501084_0005209 3300054114 Bacteria 10640
268 Ga0501084_0231717 3300054114 Bacteria 1559
269 Ga0466962_0000329 3300061719 Bacteria 20345
270 Ga0466962_0047890 3300061719 Bacteria 2043
271 Ga0530510_0005238 3300061734 Bacteria 8954
272 2517762034 2517572101 Bacteria 6884336
273 2585303793 2582581313 Bacteria 10042643
274 2585315528 2582581314 Bacteria 11452267
275 2616695861 2616644814 Bacteria 11555299
276 2643759989 2643221548 Bacteria 8053412
277 2644268261 2643221647 Bacteria 10741251
278 2644438480 2643221678 Bacteria 9540101
279 2644460315 2643221682 Bacteria 6743283
280 2785345514 2784746763 Bacteria 9783172
281 2785367368 2784746768 Bacteria 10036182
282 2786668419 2786546132 Bacteria 10419719
283 2793983704 2791355406 Bacteria 11364898
284 2808847879 2808606359 Bacteria 9866990
285 2808918626 2808606375 Bacteria 9466072
286 2811847159 2808606982 Bacteria 7791042
287 2812360111 2811994879 Bacteria 9313447
288 2812482169 2811994917 Bacteria 7761064
289 2819696600 2818991463 Bacteria 7948711
290 2852637913 2852635781 Bacteria 8251373
291 2862180484 2862178590 Bacteria 8583590
292 2862289417 2862281513 Bacteria 9621493
293 2862583482 2862574272 Bacteria 10567477
294 2867431678 2867428634 Bacteria 9590268
295 2877683180 2877676314 Bacteria 9512378
296 2912725907 2912723979 Bacteria 8557534
297 2912759076 2912757875 Bacteria 7940295
298 2919473688 2919468124 Bacteria 9133025
299 2946065775 2946064051 Bacteria 8957905
300 2946074125 2946072368 Bacteria 8999607
301 2947231619 2947224130 Bacteria 9938529
302 2954010837 2954002825 Bacteria 9173742
303 2954388394 2954380949 Bacteria 10050426
304 2954674695 2954673503 Bacteria 9685905
305 2954689438 2954682443 Bacteria 9862841
306 2954699209 2954691527 Bacteria 10720516
307 2954703009 2954701450 Bacteria 10834262
308 2954718165 2954711539 Bacteria 10867210
309 2954720708 2954711539 Bacteria 10867210
310 2954728133 2954721474 Bacteria 10456478
311 2954730257 2954721474 Bacteria 10456478
312 2954731780 2954731030 Bacteria 10243860
313 2954733674 2954731030 Bacteria 10243860
314 2954747029 2954740390 Bacteria 10229294
315 2954748974 2954740390 Bacteria 10229294
316 2954750492 2954749733 Bacteria 10366972
317 2954752558 2954749733 Bacteria 10366972
318 2954766143 2954759201 Bacteria 9358192
319 2966604199 2966598605 Bacteria 7676064
320 2990062709 2990059506 Bacteria 9321252
321 2997454126 2997451912 Bacteria 8492419
322 2997601833 2997600082 Bacteria 9896405
323 3003001138 3002998708 Bacteria 11715108
324 3006398508 3006393351 Bacteria 6615579
325 8002779706 8002775197 Bacteria 10728764
326 8002785549 8002784119 Bacteria 9788632
327 8008580553 8008574985 Bacteria 7815457
328 8025530883 8025530807 Bacteria 8495698
329 8047900082 8047893842 Bacteria 11723082
330 8048131129 8048127548 Bacteria 11053136
331 8048358846 8048356638 Bacteria 11044339
332 8048377029 8048369669 Bacteria 11666822
333 8048386084 8048379754 Bacteria 11877923
334 8048412114 8048406513 Bacteria 8936924
335 Ga0068859_100000440
336 rootH1_10076753
337 rootH2_10020050
338 JGI25160J50197_1003995
339 JGI25160J50197_1008917
340 Ga0006562J51391_1065372
341 Ga0006562J51391_1065373
342 Ga0070681_10377745
343 Ga0068862_100001125
344 Ga0075363_100027962
345 Ga0075363_100220888
346 Ga0075367_10006460
347 Ga0075369_10076296
348 Ga0075428_100199979
349 Ga0075429_100107570
350 Ga0097620_100000440
351 Ga0105249_10004413
352 Ga0163163_10006484
353 Ga0182008_10009690
354 Ga0182007_10003962
355 Ga0182005_1007674
356 Ga0183367_1010
357 Ga0213875_10024863
358 Ga0209758_1010281
359 Ga0207426_1003796
360 Ga0207426_1011354
361 Ga0207711_10000049
362 Ga0207703_10036327
363 Ga0207702_10327788
364 Ga0207641_10004054
365 Ga0209813_10007682
366 Ga0268265_10000157
367 Ga0307517_10012108
368 Ga0307511_10000282
369 Ga0307512_10002276
370 Ga0307513_10180211
371 Ga0307509_10025002
372 Ga0307509_10115764
373 Ga0307508_10001243
374 Ga0307508_10014612
375 Ga0307514_10001618
376 Ga0307514_10244184
377 Ga0307516_10020133
378 Ga0307516_10063450
379 Ga0307518_10006487
380 Ga0307518_10135407
381 Ga0307507_10010824
382 Ga0307507_10097890
383 Ga0307510_10036461
384 Ga0307510_10036516
385 Ga0395898_0015108
386 Ga0436364_1354403
387 Ga0451791_0121391
388 Ga0451795_1292222
389 Ga0451853_1373677
390 Ga0439433_0002479
391 Ga0439448_0001387
392 Ga0439449_0030014
393 Ga0439455_0014697
394 Ga0439457_002156
395 Ga0439462_0002561
396 Ga0450890_017612
397 Ga0450903_000019
398 Ga0450906_000827
399 Ga0439459_0036397
400 Ga0466969_0008353
401 Ga0466969_0071189
402 Ga0466965_0002191
403 Ga0466965_0117295
404 Ga0466966_0009575
405 Ga0466966_0033406
406 Ga0466966_0040420
407 Ga0466961_0003274
408 Ga0466961_0166014
409 Ga0466963_0008020
410 Ga0466971_0001320
411 Ga0466970_0000814
412 Ga0466957_0026926
413 Ga0466958_0046989
414 Ga0466967_0049712
415 Ga0466967_0148368
416 Ga0466967_0367426
417 Ga0495617_006160
418 Ga0495627_018328
419 Ga0495592_0005819
420 Ga0495592_0025121
421 Ga0495603_0032096
422 Ga0495603_0068827
423 Ga0495590_0067596
424 Ga0495629_0011077
425 Ga0495629_0355745
426 Ga0495629_0367076
427 Ga0495638_0125152
428 Ga0495651_0002049
429 Ga0495582_0010809
430 Ga0495582_0018333
431 Ga0495605_0024929
432 Ga0495605_0025142
433 Ga0495662_0000555
434 Ga0495662_0039472
435 Ga0495664_0006957
436 Ga0495585_0177982
437 Ga0495594_0014420
438 Ga0495594_0056599
439 Ga0495594_0057483
440 Ga0495594_0252966
441 Ga0495596_0012463
442 Ga0495607_0130607
443 Ga0495607_0161741
444 Ga0495606_0012092
445 Ga0495610_0030685
446 Ga0495618_0080646
447 Ga0495628_0030012
448 Ga0495628_0080920
449 Ga0495631_0003284
450 Ga0495643_0010303
451 Ga0495644_0108230
452 Ga0495648_0027884
453 Ga0495642_0032078
454 Ga0495652_0142135
455 Ga0495654_0034365
456 Ga0495640_0030795
457 Ga0495640_0046325
458 Ga0495586_0108577
459 Ga0495587_0008974
460 Ga0495609_0033910
461 Ga0495597_0056049
462 Ga0495645_0006416
463 Ga0495622_0018203
464 Ga0495667_0021045
465 Ga0495667_0180602
466 Ga0495668_0020654
467 Ga0495668_0121231
468 Ga0495634_0007416
469 Ga0495634_0058143
470 Ga0495625_0010090
471 Ga0495625_0036252
472 Ga0495625_0141935
473 Ga0495625_0384936
474 Ga0495635_0004385
475 Ga0495635_0061075
476 Ga0495661_0083312
477 Ga0495588_0012558
478 Ga0495657_0000739
479 Ga0495657_0001088
480 Ga0495657_0015584
481 Ga0495623_0099012
482 Ga0495646_0000319
483 Ga0495658_0020711
484 Ga0495613_0001029
485 Ga0495613_0052324
486 Ga0495613_0053182
487 Ga0495613_0256467
488 Ga0495624_0045499
489 Ga0495624_0132115
490 Ga0495671_0005994
491 Ga0495671_0144494
492 Ga0495649_0119528
493 Ga0495649_0328939
494 Ga0495589_0015768
495 Ga0495589_0019914
496 Ga0495589_0024196
497 Ga0495589_0028707
498 Ga0495589_0132873
499 Ga0495600_0013822
500 Ga0495600_0194495
501 Ga0495581_0002352
502 Ga0495581_0023677
503 Ga0495604_0000932
504 Ga0495604_0008324
505 Ga0495636_0018538
506 Ga0495636_0019896
507 Ga0495636_0054238
508 Ga0495636_0058331
509 Ga0495636_0067960
510 Ga0495676_0005486
511 Ga0495676_0014770
512 Ga0495676_0030377
513 Ga0495680_0087677
514 Ga0495683_0020349
515 Ga0495687_000423
516 Ga0495687_006335
517 Ga0495687_015940
518 Ga0495687_113899
519 Ga0495675_0009266
520 Ga0495685_007740
521 Ga0495685_010509
522 Ga0495685_012112
523 Ga0495685_017006
524 Ga0495681_0007577
525 Ga0495681_0019923
526 Ga0495684_0059843
527 Ga0495686_0131802
528 Ga0495686_0181448
529 Ga0495593_0000694
530 Ga0495593_0026961
531 Ga0495614_0011230
532 Ga0495614_0029544
533 Ga0495626_0168428
534 Ga0496104_0357459
535 Ga0496105_0060597
536 Ga0496112_0019198
537 Ga0496113_0648973
538 Ga0496116_0000136
539 Ga0496117_0023099
540 Ga0496117_0027189
541 Ga0496118_0004558
542 Ga0496118_0021242
543 Ga0496119_0008426
544 Ga0495678_036500
545 Ga0501032_0092775
546 Ga0501032_0144558
547 Ga0501033_0017012
548 Ga0501034_0002462
549 Ga0501034_0342559
550 Ga0501034_0352835
551 Ga0501034_0561969
552 Ga0501036_0001792
553 Ga0501036_0255308
554 Ga0501038_0003499
555 Ga0501038_0087597
556 Ga0501038_0148913
557 Ga0501039_0012162
558 Ga0501039_0016795
559 Ga0501041_0014299
560 Ga0501042_0021380
561 Ga0501043_0009054
562 Ga0501046_0006604
563 Ga0501046_0041345
564 Ga0501047_0145517
565 Ga0501047_0187348
566 Ga0501047_0342829
567 Ga0501048_0035428
568 Ga0501048_0411464
569 Ga0501070_0001779
570 Ga0501072_0009803
571 Ga0501073_0233047
572 Ga0501074_0017222
573 Ga0501074_0325248
574 Ga0501075_0006420
575 Ga0501075_0347239
576 Ga0501076_0036707
577 Ga0501077_0007745
578 Ga0501079_0013393
579 Ga0501080_0054616
580 Ga0501080_0138332
581 Ga0501081_0057498
582 Ga0501083_0028144
583 Ga0501035_0032373
584 Ga0501035_0051923
585 Ga0501044_0001242
586 Ga0501044_0006543
587 Ga0501044_0159254
588 Ga0501044_0310363
589 nmdc:mga03n38_32078_c1
590 nmdc:mga06z11_3676_c1
591 nmdc:mga04h51_46571_c1
592 nmdc:mga07m45_122003_c1
593 nmdc:mga06r32_573228_c1
594 nmdc:mga0sz30_81086_c1
595 Ga0495655_0024806
596 Ga0500644_0052377
597 Ga0500640_026254
598 Ga0500560_001992
599 Ga0500572_007510
600 Ga0500600_0075242
601 Ga0501084_0005209
602 Ga0501084_0231717
603 Ga0466962_0000329
604 Ga0466962_0047890
605 Ga0530510_0005238
606 2517762034
607 2585303793
608 2585315528
609 2616695861
610 2643759989
611 2644268261
612 2644438480
613 2644460315
614 2785345514
615 2785367368
616 2786668419
617 2793983704
618 2808847879
619 2808918626
620 2811847159
621 2812360111
622 2812482169
623 2819696600
624 2852637913
625 2862180484
626 2862289417
627 2862583482
628 2867431678
629 2877683180
630 2912725907
631 2912759076
632 2919473688
633 2946065775
634 2946074125
635 2947231619
636 2954010837
637 2954388394
638 2954674695
639 2954689438
640 2954699209
641 2954703009
642 2954718165
643 2954720708
644 2954728133
645 2954730257
646 2954731780
647 2954733674
648 2954747029
649 2954748974
650 2954750492
651 2954752558
652 2954766143
653 2966604199
654 2990062709
655 2997454126
656 2997601833
657 3003001138
658 3006398508
659 8002779706
660 8002785549
661 8008580553
662 8025530883
663 8047900082
664 8048131129
665 8048358846
666 8048377029
667 8048386084
668 8048412114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

113

261

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9185 74 215
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9076 69 215
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8951 52 211
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8943 52 211
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8779 65 211
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9103 69 215 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8923 63 206 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8863 73 205 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8625 65 211 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8574 56 216 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A661J4Q2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9585 57 222 GO:0016491
AF-A0A832WPZ1-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9561 74 214
AF-A0A535MCU9-F1-model_v4 Oxidoreductase 0.9558 57 217 GO:0016020
AF-A0A7W1WRH5-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9528 76 219 GO:0016491
AF-A0A5E4LA99-F1-model_v4 Sulfoxide reductase catalytic subunit YedY (EC 1.8.-.-) 0.9527 57 219 GO:0016491

Map