F411690

General Info

Members Datasets Scaffolds Average Seq Length
334 222 668 195

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100037254|Ga0070699_1000372544
Length 232
Sequence VRTQIGMVKPSGPRLTSETSQTVTSLSSRNMHITIESRHLDDVVVLVPDIFKDDRGFFSETFRADQFRLLGLPTDFVQDNHSRSAKGVVRGLHFQWDPPMGKLMRVTVGSAFLVAVDIRKGSPTLGKWVGVECSAENRRMVWAPSGFARGFCALSDASEIQYKCTGIYNARAEAAIRWNDRSIGVEWPLTDVTVSEKDRSALSLAEWLASPQAENVRYFKGPELKTVLRDQS

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
150 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.29
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 23.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100037254 3300005518 Bacteria 4208
2 Ga0058861_10079491 3300004800 Bacteria 2151
3 Ga0058862_12746494 3300004803 Bacteria 1113
4 Ga0070658_10941177 3300005327 Unclassified 751
5 Ga0070676_10013340 3300005328 Bacteria 4503
6 Ga0070683_100012527 3300005329 Bacteria 7372
7 Ga0070690_100025632 3300005330 Bacteria 3631
8 Ga0070670_100325920 3300005331 Unclassified 1346
9 Ga0068869_100014371 3300005334 Bacteria 5287
10 Ga0070666_10006047 3300005335 Bacteria 7435
11 Ga0070680_100005068 3300005336 Bacteria 9939
12 Ga0070680_100006932 3300005336 Bacteria 8633
13 Ga0070680_100039398 3300005336 Bacteria 3824
14 Ga0070682_100002756 3300005337 Bacteria 9729
15 Ga0070682_100055351 3300005337 Bacteria 2491
16 Ga0068868_100000708 3300005338 Bacteria 22443
17 Ga0070660_100012397 3300005339 Bacteria 6086
18 Ga0070691_10034587 3300005341 Unclassified 2379
19 Ga0070661_100006823 3300005344 Bacteria 7870
20 Ga0070661_100194220 3300005344 Unclassified 1549
21 Ga0070692_10122122 3300005345 Unclassified 1454
22 Ga0070669_100073672 3300005353 Bacteria 2530
23 Ga0070671_100472205 3300005355 Unclassified 1077
24 Ga0070674_100041825 3300005356 Bacteria 3109
25 Ga0070659_100017539 3300005366 Bacteria 5392
26 Ga0070667_100005565 3300005367 Bacteria 10516
27 Ga0070709_10005284 3300005434 Bacteria 6991
28 Ga0070709_10443306 3300005434 Unclassified 977
29 Ga0070709_10970945 3300005434 Unclassified 675
30 Ga0070714_100046944 3300005435 Bacteria 3666
31 Ga0070714_100047365 3300005435 Bacteria 3652
32 Ga0070714_100049881 3300005435 Bacteria 3563
33 Ga0070714_100478160 3300005435 Unclassified 1186
34 Ga0070713_100041777 3300005436 Unclassified 3738
35 Ga0070713_100157648 3300005436 Bacteria 2024
36 Ga0070713_100158124 3300005436 Unclassified 2021
37 Ga0070713_100720893 3300005436 Unclassified 953
38 Ga0070710_10144066 3300005437 Bacteria 1464
39 Ga0070711_100047756 3300005439 Unclassified 2924
40 Ga0070711_100102471 3300005439 Bacteria 2085
41 Ga0070711_100261671 3300005439 Bacteria 1361
42 Ga0070694_100219219 3300005444 Bacteria 1426
43 Ga0070708_100000844 3300005445 Bacteria 23060
44 Ga0070708_100015371 3300005445 Bacteria 6321
45 Ga0070708_100261052 3300005445 Bacteria 1628
46 Ga0070663_100012365 3300005455 Bacteria 5398
47 Ga0070662_100000990 3300005457 Bacteria 17387
48 Ga0070681_10040999 3300005458 Unclassified 4639
49 Ga0070681_10057672 3300005458 Bacteria 3863
50 Ga0070681_10188590 3300005458 Bacteria 1982
51 Ga0070681_10329081 3300005458 Unclassified 1437
52 Ga0068867_100097664 3300005459 Bacteria 2238
53 Ga0070685_10115432 3300005466 Unclassified 1660
54 Ga0070706_100000596 3300005467 Bacteria 41836
55 Ga0070707_100000172 3300005468 Bacteria 63116
56 Ga0070698_100171955 3300005471 Bacteria 2107
57 Ga0070679_100108939 3300005530 Bacteria 2756
58 Ga0070679_100113182 3300005530 Unclassified 2699
59 Ga0070679_100205788 3300005530 Unclassified 1932
60 Ga0070679_100756407 3300005530 Bacteria 915
61 Ga0070684_100049587 3300005535 Bacteria 3644
62 Ga0070684_100279818 3300005535 Unclassified 1528
63 Ga0070684_100317038 3300005535 Unclassified 1432
64 Ga0070697_100000142 3300005536 Bacteria 57993
65 Ga0070697_100003538 3300005536 Bacteria 12009
66 Ga0070697_100127956 3300005536 Bacteria 2128
67 Ga0068853_100002713 3300005539 Bacteria 13360
68 Ga0068853_100025122 3300005539 Bacteria 4998
69 Ga0070686_100002509 3300005544 Bacteria 10109
70 Ga0070695_100246909 3300005545 Unclassified 1297
71 Ga0070696_100334598 3300005546 Unclassified 1169
72 Ga0070665_100020508 3300005548 Bacteria 6639
73 Ga0068855_100006579 3300005563 Bacteria 14126
74 Ga0068855_101448733 3300005563 Unclassified 706
75 Ga0070664_100003035 3300005564 Bacteria 13581
76 Ga0068857_100011669 3300005577 Bacteria 7641
77 Ga0068854_100002629 3300005578 Bacteria 11135
78 Ga0068854_100183466 3300005578 Unclassified 1636
79 Ga0068856_100005448 3300005614 Bacteria 12537
80 Ga0068852_100034944 3300005616 Bacteria 4187
81 Ga0068859_100021028 3300005617 Bacteria 6548
82 Ga0068864_100030363 3300005618 Bacteria 4580
83 Ga0068866_10008739 3300005718 Bacteria 4280
84 Ga0068861_100102763 3300005719 Bacteria 2276
85 Ga0068870_10333040 3300005840 Unclassified 968
86 Ga0068858_100001176 3300005842 Bacteria 27115
87 Ga0068860_100008366 3300005843 Bacteria 10302
88 Ga0070717_10018247 3300006028 Bacteria 5475
89 Ga0070717_10263058 3300006028 Bacteria 1526
90 Ga0070717_10439368 3300006028 Unclassified 1175
91 Ga0070717_10627463 3300006028 Bacteria 975
92 Ga0070717_10964683 3300006028 Unclassified 776
93 Ga0070716_100046525 3300006173 Bacteria 2442
94 Ga0070716_100064179 3300006173 Bacteria 2134
95 Ga0070716_100962861 3300006173 Bacteria 672
96 Ga0070712_100008644 3300006175 Bacteria 6412
97 Ga0070712_100021558 3300006175 Bacteria 4233
98 Ga0070712_100025320 3300006175 Bacteria 3943
99 Ga0070712_100349152 3300006175 Bacteria 1210
100 Ga0097621_100006094 3300006237 Bacteria 8536
101 Ga0068871_100350216 3300006358 Bacteria 1306
102 Ga0075430_100184614 3300006846 Bacteria 1734
103 Ga0075431_100002595 3300006847 Bacteria 17458
104 Ga0075433_10424666 3300006852 Unclassified 1172
105 Ga0075434_100047934 3300006871 Bacteria 4240
106 Ga0068865_100035475 3300006881 Bacteria 3355
107 Ga0075436_100118071 3300006914 Unclassified 1854
108 Ga0097620_100021029 3300006931 Bacteria 6548
109 Ga0099795_10018216 3300007788 Bacteria 2253
110 Ga0105250_10125272 3300009092 Unclassified 1058
111 Ga0105240_10004940 3300009093 Bacteria 20045
112 Ga0105240_10403664 3300009093 Bacteria 1539
113 Ga0105245_10018049 3300009098 Bacteria 6164
114 Ga0105245_10138643 3300009098 Unclassified 2289
115 Ga0105247_10002966 3300009101 Bacteria 11261
116 Ga0105247_10056723 3300009101 Unclassified 2420
117 Ga0114129_11254422 3300009147 Bacteria 921
118 Ga0105243_10238870 3300009148 Bacteria 1616
119 Ga0105241_10025524 3300009174 Bacteria 4392
120 Ga0105241_10045625 3300009174 Bacteria 3326
121 Ga0105241_10051493 3300009174 Bacteria 3140
122 Ga0105241_10375905 3300009174 Bacteria 1240
123 Ga0105242_10034162 3300009176 Bacteria 4076
124 Ga0105248_10025748 3300009177 Bacteria 6543
125 Ga0105237_10014436 3300009545 Bacteria 8260
126 Ga0105237_10174979 3300009545 Unclassified 2147
127 Ga0105237_10294846 3300009545 Unclassified 1625
128 Ga0105238_10018523 3300009551 Bacteria 7086
129 Ga0105238_10090614 3300009551 Bacteria 3045
130 Ga0105238_10336338 3300009551 Unclassified 1497
131 Ga0105249_10010106 3300009553 Bacteria 8285
132 Ga0099796_10028775 3300010159 Unclassified 1787
133 Ga0105239_10098903 3300010375 Bacteria 3225
134 Ga0105239_10259593 3300010375 Bacteria 1952
135 Ga0105239_10299746 3300010375 Bacteria 1810
136 Ga0105246_10002140 3300011119 Bacteria 11905
137 Ga0157373_10008694 3300013100 Bacteria 7535
138 Ga0157371_10009388 3300013102 Bacteria 7703
139 Ga0157370_10070733 3300013104 Bacteria 3293
140 Ga0157369_10023515 3300013105 Bacteria 6864
141 Ga0157369_10040697 3300013105 Bacteria 5073
142 Ga0157369_10120800 3300013105 Unclassified 2780
143 Ga0157369_10326430 3300013105 Bacteria 1595
144 Ga0157374_10006379 3300013296 Bacteria 10007
145 Ga0157374_10013170 3300013296 Bacteria 7214
146 Ga0157374_10223395 3300013296 Bacteria 1849
147 Ga0157378_10044621 3300013297 Bacteria 3937
148 Ga0163162_10000134 3300013306 Bacteria 67221
149 Ga0163162_10006511 3300013306 Bacteria 11312
150 Ga0157372_10005378 3300013307 Bacteria 13611
151 Ga0157372_11531688 3300013307 Unclassified 768
152 Ga0157375_10003824 3300013308 Bacteria 13057
153 Ga0163163_10050008 3300014325 Bacteria 4116
154 Ga0157379_10005142 3300014968 Bacteria 11229
155 Ga0157376_10049119 3300014969 Bacteria 3493
156 Ga0157376_10213056 3300014969 Bacteria 1785
157 Ga0228598_1000078 3300024227 Bacteria 14931
158 Ga0228598_1008418 3300024227 Bacteria 2083
159 Ga0228598_1026379 3300024227 Unclassified 1143
160 Ga0207656_10129852 3300025321 Unclassified 1180
161 Ga0207682_10089839 3300025893 Unclassified 1330
162 Ga0207642_10051627 3300025899 Bacteria 1861
163 Ga0207710_10002198 3300025900 Bacteria 9171
164 Ga0207688_10217019 3300025901 Bacteria 1151
165 Ga0207680_10014533 3300025903 Bacteria 4078
166 Ga0207647_10031794 3300025904 Bacteria 3395
167 Ga0207699_10639737 3300025906 Unclassified 776
168 Ga0207643_10315634 3300025908 Unclassified 975
169 Ga0207684_10063904 3300025910 Bacteria 3124
170 Ga0207654_10006000 3300025911 Bacteria 6114
171 Ga0207654_10270888 3300025911 Unclassified 1145
172 Ga0207654_10513693 3300025911 Bacteria 847
173 Ga0207707_10060988 3300025912 Bacteria 3281
174 Ga0207707_10180058 3300025912 Bacteria 1845
175 Ga0207707_10297791 3300025912 Unclassified 1395
176 Ga0207707_10405741 3300025912 Bacteria 1169
177 Ga0207707_10646797 3300025912 Bacteria 891
178 Ga0207695_10001361 3300025913 Bacteria 41480
179 Ga0207671_10017039 3300025914 Bacteria 5620
180 Ga0207693_10027852 3300025915 Bacteria 4466
181 Ga0207693_10034039 3300025915 Unclassified 4019
182 Ga0207693_10316799 3300025915 Bacteria 1221
183 Ga0207663_10012201 3300025916 Bacteria 4638
184 Ga0207663_10152792 3300025916 Bacteria 1621
185 Ga0207660_10015138 3300025917 Bacteria 5086
186 Ga0207660_10028431 3300025917 Bacteria 3824
187 Ga0207660_10080249 3300025917 Bacteria 2395
188 Ga0207657_10002571 3300025919 Bacteria 19629
189 Ga0207649_10006274 3300025920 Bacteria 6461
190 Ga0207646_10000306 3300025922 Bacteria 66698
191 Ga0207681_10064218 3300025923 Bacteria 2534
192 Ga0207650_10284932 3300025925 Unclassified 1346
193 Ga0207687_10000444 3300025927 Bacteria 28091
194 Ga0207687_10365036 3300025927 Bacteria 1179
195 Ga0207700_10110466 3300025928 Unclassified 2211
196 Ga0207700_10358470 3300025928 Bacteria 1271
197 Ga0207700_10670795 3300025928 Bacteria 925
198 Ga0207664_10006513 3300025929 Bacteria 8035
199 Ga0207664_10060637 3300025929 Bacteria 3016
200 Ga0207690_10006098 3300025932 Bacteria 7143
201 Ga0207706_10001489 3300025933 Bacteria 23271
202 Ga0207709_10024817 3300025935 Bacteria 3428
203 Ga0207670_10024752 3300025936 Bacteria 3757
204 Ga0207669_10082705 3300025937 Bacteria 2062
205 Ga0207665_10024527 3300025939 Bacteria 3977
206 Ga0207665_10889929 3300025939 Bacteria 706
207 Ga0207711_10005202 3300025941 Bacteria 11017
208 Ga0207661_10041901 3300025944 Bacteria 3607
209 Ga0207679_10009513 3300025945 Bacteria 6231
210 Ga0207667_10001735 3300025949 Bacteria 27414
211 Ga0207667_11200195 3300025949 Unclassified 738
212 Ga0207640_10000430 3300025981 Bacteria 25690
213 Ga0207640_10343177 3300025981 Unclassified 1197
214 Ga0207658_10010461 3300025986 Bacteria 6301
215 Ga0207677_10007761 3300026023 Bacteria 5957
216 Ga0207703_10013901 3300026035 Bacteria 6275
217 Ga0207639_10001651 3300026041 Bacteria 15014
218 Ga0207639_10009131 3300026041 Bacteria 6833
219 Ga0207678_10000039 3300026067 Bacteria 101198
220 Ga0207702_10007551 3300026078 Bacteria 9269
221 Ga0207702_10209260 3300026078 Bacteria 1812
222 Ga0207641_10021439 3300026088 Bacteria 5310
223 Ga0207648_10027174 3300026089 Bacteria 5082
224 Ga0207676_10042174 3300026095 Bacteria 3508
225 Ga0207674_10004235 3300026116 Bacteria 17311
226 Ga0207675_100151493 3300026118 Bacteria 2207
227 Ga0207683_10375196 3300026121 Unclassified 1307
228 Ga0207698_10014284 3300026142 Bacteria 5274
229 Ga0207698_10365325 3300026142 Bacteria 1368
230 Ga0265356_1000176 3300028017 Bacteria 11907
231 Ga0265762_1000198 3300030760 Bacteria 9582
232 Ga0265761_100014 3300030889 Bacteria 5731
233 Ga0265760_10001491 3300031090 Bacteria 6899
234 Ga0265316_10425038 3300031344 Unclassified 955
235 Ga0373929_0002348 3300035085 Bacteria 3478
236 Ga0373934_0108535 3300035086 Unclassified 1125
237 Ga0373923_0097709 3300035111 Unclassified 1292
238 Ga0373932_0232926 3300035112 Unclassified 666
239 Ga0373936_0120367 3300035113 Bacteria 1121
240 Ga0373941_0063310 3300035115 Unclassified 1209
241 Ga0373960_0022175 3300035121 Bacteria 1697
242 Ga0373946_0008974 3300035171 Bacteria 3677
243 Ga0373955_0004500 3300035172 Bacteria 6173
244 Ga0373955_0068411 3300035172 Bacteria 1979
245 Ga0373961_0044237 3300035241 Bacteria 1298
246 Ga0373962_0013439 3300035242 Bacteria 2074
247 Ga0373924_0062388 3300035410 Bacteria 1561
248 Ga0373931_0005304 3300035691 Bacteria 5948
249 Ga0373935_0133673 3300035692 Unclassified 1669
250 Ga0373935_0149916 3300035692 Bacteria 1582
251 Ga0373935_0196084 3300035692 Bacteria 1393
252 Ga0373935_0402521 3300035692 Unclassified 983
253 Ga0373927_0003955 3300035695 Bacteria 10492
254 Ga0373933_0124783 3300035724 Unclassified 1615
255 Ga0373933_0681762 3300035724 Bacteria 676
256 Ga0373947_0171090 3300035725 Unclassified 1410
257 Ga0373937_0000038 3300036401 Bacteria 110582
258 Ga0373937_0010476 3300036401 Bacteria 8096
259 Ga0373937_0085607 3300036401 Bacteria 2917
260 Ga0373937_0255482 3300036401 Bacteria 1652
261 Ga0373937_0960600 3300036401 Bacteria 803
262 Ga0316582_0375066 3300036647 Bacteria 979
263 Ga0373925_0006555 3300037068 Bacteria 8557
264 Ga0373925_0311152 3300037068 Bacteria 1273
265 Ga0373925_0560242 3300037068 Bacteria 940
266 Ga0373925_0652217 3300037068 Unclassified 867
267 Ga0395898_0297492 3300037466 Unclassified 1540
268 Ga0436360_0477620 3300039438 Unclassified 992
269 Ga0436361_0531687 3300039447 Bacteria 2491
270 Ga0436362_0418470 3300039453 Bacteria 1626
271 Ga0436362_0476124 3300039453 Unclassified 1176
272 Ga0451577_0005263 3300042876 Bacteria 13299
273 Ga0451577_0057382 3300042876 Unclassified 3471
274 Ga0451577_0696017 3300042876 Bacteria 921
275 Ga0453683_0005396 3300044673 Bacteria 8923
276 Ga0466963_0095548 3300044694 Bacteria 2029
277 Ga0453684_0018791 3300044712 Bacteria 10577
278 Ga0453684_0083918 3300044712 Bacteria 3964
279 Ga0453684_0173472 3300044712 Bacteria 2539
280 Ga0453684_1223327 3300044712 Unclassified 787
281 Ga0466957_0002706 3300044842 Bacteria 9584
282 Ga0466959_0411647 3300045049 Unclassified 918
283 Ga0451576_0008344 3300045051 Bacteria 12174
284 Ga0451576_0244825 3300045051 Bacteria 1873
285 Ga0466958_0519914 3300045836 Bacteria 773
286 Ga0466967_0005461 3300045976 Bacteria 8812
287 Ga0466967_0035817 3300045976 Bacteria 4229
288 Ga0466967_0264819 3300045976 Bacteria 1645
289 Ga0495651_0279750 3300046462 Bacteria 1128
290 Ga0495580_0041541 3300046472 Bacteria 3280
291 Ga0495580_0090694 3300046472 Unclassified 2128
292 Ga0495639_0046541 3300046475 Bacteria 1964
293 Ga0495664_0038911 3300046477 Unclassified 2809
294 Ga0495594_0069030 3300046499 Bacteria 1963
295 Ga0495586_0126437 3300046535 Bacteria 1430
296 Ga0495645_0371671 3300046543 Unclassified 916
297 Ga0495635_0327731 3300046663 Bacteria 1024
298 Ga0495657_0265668 3300046675 Bacteria 1030
299 Ga0495599_0138222 3300046678 Bacteria 1512
300 Ga0495623_0016825 3300046679 Bacteria 4724
301 Ga0495647_0043561 3300046681 Unclassified 1718
302 Ga0495658_0036285 3300046683 Bacteria 2719
303 Ga0495581_0038730 3300047315 Bacteria 2759
304 Ga0495581_0129308 3300047315 Bacteria 1471
305 Ga0495676_0407129 3300047321 Bacteria 902
306 Ga0496100_0044207 3300048903 Bacteria 2852
307 Ga0496101_0071560 3300048904 Bacteria 2543
308 Ga0496102_0003183 3300048905 Bacteria 13917
309 Ga0496102_0835916 3300048905 Bacteria 843
310 Ga0496103_0065441 3300048906 Unclassified 2268
311 Ga0496103_0071164 3300048906 Bacteria 2176
312 Ga0496104_0036315 3300048907 Bacteria 4607
313 Ga0496104_0133498 3300048907 Bacteria 2385
314 Ga0496104_0187156 3300048907 Unclassified 1981
315 Ga0496104_0506986 3300048907 Bacteria 1118
316 Ga0496104_0593367 3300048907 Bacteria 1018
317 Ga0496105_0173490 3300048908 Unclassified 1767
318 Ga0496105_0431444 3300048908 Bacteria 1042
319 Ga0496106_0087117 3300048909 Bacteria 2406
320 Ga0496107_0058314 3300048910 Bacteria 2792
321 Ga0496109_0083654 3300048912 Bacteria 2943
322 Ga0496110_0013719 3300048913 Bacteria 6713
323 Ga0496111_0011490 3300048914 Bacteria 5967
324 Ga0496112_0016685 3300048915 Bacteria 6885
325 Ga0496114_0608264 3300048917 Bacteria 963
326 Ga0496115_0562154 3300048918 Unclassified 911
327 nmdc:mga06r32_22880_c1 3300050510 Bacteria 5780
328 nmdc:mga0n895_34215_c1 3300050512 Bacteria 4889
329 nmdc:mga0rr50_757618_c1 3300050513 Bacteria 829
330 nmdc:mga0a205_441660_c1 3300050515 Unclassified 1162
331 Ga0495601_0006443 3300053077 Bacteria 6867
332 Ga0495612_0344019 3300053078 Unclassified 673
333 Ga0495619_0061799 3300053085 Bacteria 2493
334 Ga0495619_0107945 3300053085 Bacteria 1899
335 Ga0070699_100037254
336 Ga0058861_10079491
337 Ga0058862_12746494
338 Ga0070658_10941177
339 Ga0070676_10013340
340 Ga0070683_100012527
341 Ga0070690_100025632
342 Ga0070670_100325920
343 Ga0068869_100014371
344 Ga0070666_10006047
345 Ga0070680_100005068
346 Ga0070680_100006932
347 Ga0070680_100039398
348 Ga0070682_100002756
349 Ga0070682_100055351
350 Ga0068868_100000708
351 Ga0070660_100012397
352 Ga0070691_10034587
353 Ga0070661_100006823
354 Ga0070661_100194220
355 Ga0070692_10122122
356 Ga0070669_100073672
357 Ga0070671_100472205
358 Ga0070674_100041825
359 Ga0070659_100017539
360 Ga0070667_100005565
361 Ga0070709_10005284
362 Ga0070709_10443306
363 Ga0070709_10970945
364 Ga0070714_100046944
365 Ga0070714_100047365
366 Ga0070714_100049881
367 Ga0070714_100478160
368 Ga0070713_100041777
369 Ga0070713_100157648
370 Ga0070713_100158124
371 Ga0070713_100720893
372 Ga0070710_10144066
373 Ga0070711_100047756
374 Ga0070711_100102471
375 Ga0070711_100261671
376 Ga0070694_100219219
377 Ga0070708_100000844
378 Ga0070708_100015371
379 Ga0070708_100261052
380 Ga0070663_100012365
381 Ga0070662_100000990
382 Ga0070681_10040999
383 Ga0070681_10057672
384 Ga0070681_10188590
385 Ga0070681_10329081
386 Ga0068867_100097664
387 Ga0070685_10115432
388 Ga0070706_100000596
389 Ga0070707_100000172
390 Ga0070698_100171955
391 Ga0070679_100108939
392 Ga0070679_100113182
393 Ga0070679_100205788
394 Ga0070679_100756407
395 Ga0070684_100049587
396 Ga0070684_100279818
397 Ga0070684_100317038
398 Ga0070697_100000142
399 Ga0070697_100003538
400 Ga0070697_100127956
401 Ga0068853_100002713
402 Ga0068853_100025122
403 Ga0070686_100002509
404 Ga0070695_100246909
405 Ga0070696_100334598
406 Ga0070665_100020508
407 Ga0068855_100006579
408 Ga0068855_101448733
409 Ga0070664_100003035
410 Ga0068857_100011669
411 Ga0068854_100002629
412 Ga0068854_100183466
413 Ga0068856_100005448
414 Ga0068852_100034944
415 Ga0068859_100021028
416 Ga0068864_100030363
417 Ga0068866_10008739
418 Ga0068861_100102763
419 Ga0068870_10333040
420 Ga0068858_100001176
421 Ga0068860_100008366
422 Ga0070717_10018247
423 Ga0070717_10263058
424 Ga0070717_10439368
425 Ga0070717_10627463
426 Ga0070717_10964683
427 Ga0070716_100046525
428 Ga0070716_100064179
429 Ga0070716_100962861
430 Ga0070712_100008644
431 Ga0070712_100021558
432 Ga0070712_100025320
433 Ga0070712_100349152
434 Ga0097621_100006094
435 Ga0068871_100350216
436 Ga0075430_100184614
437 Ga0075431_100002595
438 Ga0075433_10424666
439 Ga0075434_100047934
440 Ga0068865_100035475
441 Ga0075436_100118071
442 Ga0097620_100021029
443 Ga0099795_10018216
444 Ga0105250_10125272
445 Ga0105240_10004940
446 Ga0105240_10403664
447 Ga0105245_10018049
448 Ga0105245_10138643
449 Ga0105247_10002966
450 Ga0105247_10056723
451 Ga0114129_11254422
452 Ga0105243_10238870
453 Ga0105241_10025524
454 Ga0105241_10045625
455 Ga0105241_10051493
456 Ga0105241_10375905
457 Ga0105242_10034162
458 Ga0105248_10025748
459 Ga0105237_10014436
460 Ga0105237_10174979
461 Ga0105237_10294846
462 Ga0105238_10018523
463 Ga0105238_10090614
464 Ga0105238_10336338
465 Ga0105249_10010106
466 Ga0099796_10028775
467 Ga0105239_10098903
468 Ga0105239_10259593
469 Ga0105239_10299746
470 Ga0105246_10002140
471 Ga0157373_10008694
472 Ga0157371_10009388
473 Ga0157370_10070733
474 Ga0157369_10023515
475 Ga0157369_10040697
476 Ga0157369_10120800
477 Ga0157369_10326430
478 Ga0157374_10006379
479 Ga0157374_10013170
480 Ga0157374_10223395
481 Ga0157378_10044621
482 Ga0163162_10000134
483 Ga0163162_10006511
484 Ga0157372_10005378
485 Ga0157372_11531688
486 Ga0157375_10003824
487 Ga0163163_10050008
488 Ga0157379_10005142
489 Ga0157376_10049119
490 Ga0157376_10213056
491 Ga0228598_1000078
492 Ga0228598_1008418
493 Ga0228598_1026379
494 Ga0207656_10129852
495 Ga0207682_10089839
496 Ga0207642_10051627
497 Ga0207710_10002198
498 Ga0207688_10217019
499 Ga0207680_10014533
500 Ga0207647_10031794
501 Ga0207699_10639737
502 Ga0207643_10315634
503 Ga0207684_10063904
504 Ga0207654_10006000
505 Ga0207654_10270888
506 Ga0207654_10513693
507 Ga0207707_10060988
508 Ga0207707_10180058
509 Ga0207707_10297791
510 Ga0207707_10405741
511 Ga0207707_10646797
512 Ga0207695_10001361
513 Ga0207671_10017039
514 Ga0207693_10027852
515 Ga0207693_10034039
516 Ga0207693_10316799
517 Ga0207663_10012201
518 Ga0207663_10152792
519 Ga0207660_10015138
520 Ga0207660_10028431
521 Ga0207660_10080249
522 Ga0207657_10002571
523 Ga0207649_10006274
524 Ga0207646_10000306
525 Ga0207681_10064218
526 Ga0207650_10284932
527 Ga0207687_10000444
528 Ga0207687_10365036
529 Ga0207700_10110466
530 Ga0207700_10358470
531 Ga0207700_10670795
532 Ga0207664_10006513
533 Ga0207664_10060637
534 Ga0207690_10006098
535 Ga0207706_10001489
536 Ga0207709_10024817
537 Ga0207670_10024752
538 Ga0207669_10082705
539 Ga0207665_10024527
540 Ga0207665_10889929
541 Ga0207711_10005202
542 Ga0207661_10041901
543 Ga0207679_10009513
544 Ga0207667_10001735
545 Ga0207667_11200195
546 Ga0207640_10000430
547 Ga0207640_10343177
548 Ga0207658_10010461
549 Ga0207677_10007761
550 Ga0207703_10013901
551 Ga0207639_10001651
552 Ga0207639_10009131
553 Ga0207678_10000039
554 Ga0207702_10007551
555 Ga0207702_10209260
556 Ga0207641_10021439
557 Ga0207648_10027174
558 Ga0207676_10042174
559 Ga0207674_10004235
560 Ga0207675_100151493
561 Ga0207683_10375196
562 Ga0207698_10014284
563 Ga0207698_10365325
564 Ga0265356_1000176
565 Ga0265762_1000198
566 Ga0265761_100014
567 Ga0265760_10001491
568 Ga0265316_10425038
569 Ga0373929_0002348
570 Ga0373934_0108535
571 Ga0373923_0097709
572 Ga0373932_0232926
573 Ga0373936_0120367
574 Ga0373941_0063310
575 Ga0373960_0022175
576 Ga0373946_0008974
577 Ga0373955_0004500
578 Ga0373955_0068411
579 Ga0373961_0044237
580 Ga0373962_0013439
581 Ga0373924_0062388
582 Ga0373931_0005304
583 Ga0373935_0133673
584 Ga0373935_0149916
585 Ga0373935_0196084
586 Ga0373935_0402521
587 Ga0373927_0003955
588 Ga0373933_0124783
589 Ga0373933_0681762
590 Ga0373947_0171090
591 Ga0373937_0000038
592 Ga0373937_0010476
593 Ga0373937_0085607
594 Ga0373937_0255482
595 Ga0373937_0960600
596 Ga0316582_0375066
597 Ga0373925_0006555
598 Ga0373925_0311152
599 Ga0373925_0560242
600 Ga0373925_0652217
601 Ga0395898_0297492
602 Ga0436360_0477620
603 Ga0436361_0531687
604 Ga0436362_0418470
605 Ga0436362_0476124
606 Ga0451577_0005263
607 Ga0451577_0057382
608 Ga0451577_0696017
609 Ga0453683_0005396
610 Ga0466963_0095548
611 Ga0453684_0018791
612 Ga0453684_0083918
613 Ga0453684_0173472
614 Ga0453684_1223327
615 Ga0466957_0002706
616 Ga0466959_0411647
617 Ga0451576_0008344
618 Ga0451576_0244825
619 Ga0466958_0519914
620 Ga0466967_0005461
621 Ga0466967_0035817
622 Ga0466967_0264819
623 Ga0495651_0279750
624 Ga0495580_0041541
625 Ga0495580_0090694
626 Ga0495639_0046541
627 Ga0495664_0038911
628 Ga0495594_0069030
629 Ga0495586_0126437
630 Ga0495645_0371671
631 Ga0495635_0327731
632 Ga0495657_0265668
633 Ga0495599_0138222
634 Ga0495623_0016825
635 Ga0495647_0043561
636 Ga0495658_0036285
637 Ga0495581_0038730
638 Ga0495581_0129308
639 Ga0495676_0407129
640 Ga0496100_0044207
641 Ga0496101_0071560
642 Ga0496102_0003183
643 Ga0496102_0835916
644 Ga0496103_0065441
645 Ga0496103_0071164
646 Ga0496104_0036315
647 Ga0496104_0133498
648 Ga0496104_0187156
649 Ga0496104_0506986
650 Ga0496104_0593367
651 Ga0496105_0173490
652 Ga0496105_0431444
653 Ga0496106_0087117
654 Ga0496107_0058314
655 Ga0496109_0083654
656 Ga0496110_0013719
657 Ga0496111_0011490
658 Ga0496112_0016685
659 Ga0496114_0608264
660 Ga0496115_0562154
661 nmdc:mga06r32_22880_c1
662 nmdc:mga0n895_34215_c1
663 nmdc:mga0rr50_757618_c1
664 nmdc:mga0a205_441660_c1
665 Ga0495601_0006443
666 Ga0495612_0344019
667 Ga0495619_0061799
668 Ga0495619_0107945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

37

206

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9618 3 175
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.956 1 178
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9536 1 177
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9526 1 177
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9517 3 177
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9513 4 177 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9508 1 175 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9457 4 184 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9402 1 175 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9396 3 178 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7I8MQ24-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.99 1 190 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7C7HWV2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9879 42 177 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A4U9HCF6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9877 45 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A381QBB3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9869 15 177 GO:0000271
GO:0005829
GO:0008830
AF-A0A533YIC1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9859 22 195 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map