F411574

General Info

Members Datasets Scaffolds Average Seq Length
333 217 666 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2527291627|2528202996
Length 323
Sequence GGSTRGSARPGGAASRRGSGPGPSPGPQVDGLVVVDKPAGWTSHDVVARARRILGQRRIGHAGTLDPMATGVLVLGAGRGTRLLGHLALTDKVYDATIRLGRTTTTDDAEGAPVEDRPVDVDADRLTRAMAALTGVLDQVPASVSAVKVGGVRAYARVRAGEVVDLAPRRVTVHRFDLLARRAAGDGAVDPAGTDLEVTVGCSSGTYVRALARDLGAALDCGAHLTALRRTAVGPFDLAGAVTLDTFAELGPRAVTSLTDAVAAGFLRRDVTAEAAADVSHGRRLPPVGRPGTYGVFGPDGTVLALVEETEHAVRSLVVFAPV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 2527291627 Frankia casuarinae Thr Isolate Nodule
202 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
203 2527291629 Frankia sp. BMG5.23 Isolate Nodule
204 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
205 2576861822 Frankia sp. CeD Isolate Nodule
206 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
207 2619618881 Frankia sp. ACN1ag Isolate Unclassified
208 2619619003 Frankia sp. CpI1-P Isolate Nodule
209 2626541554 Frankia sp. AvcI.1 Isolate Nodule
210 2684623036 Frankia sp. CgIM4 Isolate Nodule
211 2710264753 Frankia sp. KB5 Isolate Nodule
212 2773857924 Frankia sp. CgIS1 Isolate Nodule
213 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
214 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
215 637000116 Frankia casuarinae CcI3 Isolate Nodule
216 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
217 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.59
Metatranscriptomes 0.3
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 3.6
Rhizoplane 10.81
Rhizosphere 72.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10023895 3300001990 Bacteria 1937
2 JGI24748J21848_1000351 3300002074 Bacteria 5296
3 JGI24749J21850_1007499 3300002076 Bacteria 1521
4 JGI24744J21845_10000086 3300002077 Bacteria 12040
5 JGI24744J21845_10013649 3300002077 Bacteria 1637
6 Ga0070676_10003661 3300005328 Bacteria 8048
7 Ga0070683_100006135 3300005329 Bacteria 10076
8 Ga0070683_100075063 3300005329 Bacteria 3158
9 Ga0070690_100003633 3300005330 Bacteria 8491
10 Ga0070670_100336159 3300005331 Bacteria 1325
11 Ga0070666_10044488 3300005335 Bacteria 2974
12 Ga0070680_100275249 3300005336 Bacteria 1426
13 Ga0068868_100001612 3300005338 Bacteria 15394
14 Ga0068868_100091118 3300005338 Bacteria 2456
15 Ga0070689_100014452 3300005340 Bacteria 5735
16 Ga0070689_100091390 3300005340 Bacteria 2400
17 Ga0070691_10003048 3300005341 Bacteria 7498
18 Ga0070668_100037521 3300005347 Bacteria 3700
19 Ga0070668_100043990 3300005347 Bacteria 3424
20 Ga0070675_100068485 3300005354 Bacteria 2939
21 Ga0070671_100018630 3300005355 Bacteria 5640
22 Ga0070674_100019719 3300005356 Bacteria 4290
23 Ga0070673_100255923 3300005364 Bacteria 1528
24 Ga0070688_100017086 3300005365 Bacteria 4161
25 Ga0070667_100014416 3300005367 Bacteria 6532
26 Ga0070667_100015680 3300005367 Bacteria 6264
27 Ga0070709_10006216 3300005434 Bacteria 6498
28 Ga0070709_10105303 3300005434 Bacteria 1886
29 Ga0070713_100005627 3300005436 Bacteria 8592
30 Ga0070710_10001814 3300005437 Bacteria 10084
31 Ga0070710_10022931 3300005437 Bacteria 3273
32 Ga0070710_10067886 3300005437 Bacteria 2047
33 Ga0070701_10004102 3300005438 Bacteria 5848
34 Ga0070711_100000712 3300005439 Bacteria 17378
35 Ga0070711_100123082 3300005439 Bacteria 1921
36 Ga0070700_100001425 3300005441 Bacteria 11903
37 Ga0070700_100014418 3300005441 Bacteria 4463
38 Ga0070663_100011821 3300005455 Bacteria 5498
39 Ga0070678_100000696 3300005456 Bacteria 16625
40 Ga0070678_100061866 3300005456 Bacteria 2761
41 Ga0070662_100012159 3300005457 Bacteria 5700
42 Ga0070662_100301749 3300005457 Bacteria 1301
43 Ga0068867_100020513 3300005459 Bacteria 4709
44 Ga0070685_10023028 3300005466 Bacteria 3405
45 Ga0068853_100010034 3300005539 Bacteria 7646
46 Ga0070686_100146302 3300005544 Bacteria 1650
47 Ga0070695_100028173 3300005545 Bacteria 3485
48 Ga0070696_100005555 3300005546 Bacteria 8418
49 Ga0070696_100062970 3300005546 Bacteria 2597
50 Ga0070693_100009952 3300005547 Bacteria 4748
51 Ga0070665_100003013 3300005548 Bacteria 18167
52 Ga0070665_100034419 3300005548 Bacteria 5094
53 Ga0070704_100001564 3300005549 Bacteria 12351
54 Ga0070704_100004396 3300005549 Bacteria 8139
55 Ga0068854_100000630 3300005578 Bacteria 20862
56 Ga0068856_100074022 3300005614 Bacteria 3372
57 Ga0068852_100048786 3300005616 Bacteria 3619
58 Ga0068852_100090611 3300005616 Bacteria 2735
59 Ga0068859_100009213 3300005617 Bacteria 9971
60 Ga0068864_100034058 3300005618 Bacteria 4331
61 Ga0068864_100135070 3300005618 Bacteria 2220
62 Ga0068866_10003121 3300005718 Bacteria 6824
63 Ga0068861_100007409 3300005719 Bacteria 7519
64 Ga0068861_100076311 3300005719 Bacteria 2611
65 Ga0068851_10056506 3300005834 Bacteria 2002
66 Ga0068863_100035405 3300005841 Bacteria 4755
67 Ga0068858_100000003 3300005842 Bacteria 349151
68 Ga0068858_100017227 3300005842 Bacteria 6779
69 Ga0068858_100020438 3300005842 Bacteria 6190
70 Ga0068860_100002676 3300005843 Bacteria 18553
71 Ga0068862_100005303 3300005844 Bacteria 10802
72 Ga0068862_100314180 3300005844 Bacteria 1445
73 Ga0081455_10000939 3300005937 Bacteria 37256
74 Ga0081455_10020091 3300005937 Bacteria 6302
75 Ga0081455_10089439 3300005937 Bacteria 2499
76 Ga0070717_10288273 3300006028 Bacteria 1457
77 Ga0075365_10009858 3300006038 Bacteria 5525
78 Ga0075365_10087467 3300006038 Bacteria 2119
79 Ga0075368_10033408 3300006042 Bacteria 2001
80 Ga0075363_100021343 3300006048 Bacteria 3260
81 Ga0075364_10001593 3300006051 Bacteria 12402
82 Ga0075364_10016056 3300006051 Bacteria 4652
83 Ga0070716_100003614 3300006173 Bacteria 7307
84 Ga0070716_100013484 3300006173 Bacteria 4165
85 Ga0070712_100001885 3300006175 Bacteria 12786
86 Ga0070712_100063424 3300006175 Bacteria 2616
87 Ga0070712_100119577 3300006175 Bacteria 1980
88 Ga0070712_100150262 3300006175 Bacteria 1788
89 Ga0075367_10002622 3300006178 Bacteria 8266
90 Ga0075369_10081380 3300006186 Bacteria 1437
91 Ga0075370_10009137 3300006353 Bacteria 5131
92 Ga0068871_100156360 3300006358 Bacteria 1947
93 Ga0075430_100187081 3300006846 Bacteria 1722
94 Ga0075431_100048264 3300006847 Bacteria 4391
95 Ga0068865_100004475 3300006881 Bacteria 8431
96 Ga0097620_100009214 3300006931 Bacteria 9971
97 Ga0105250_10033787 3300009092 Bacteria 2053
98 Ga0105245_10000983 3300009098 Bacteria 26008
99 Ga0105245_10082743 3300009098 Bacteria 2937
100 Ga0105247_10000014 3300009101 Bacteria 285043
101 Ga0105247_10000452 3300009101 Bacteria 34812
102 Ga0105247_10000570 3300009101 Bacteria 30023
103 Ga0105243_10001753 3300009148 Bacteria 18673
104 Ga0105242_10000909 3300009176 Bacteria 23018
105 Ga0105248_10010646 3300009177 Bacteria 10143
106 Ga0105248_10013379 3300009177 Bacteria 9031
107 Ga0105237_10227027 3300009545 Bacteria 1868
108 Ga0105249_10001452 3300009553 Bacteria 20756
109 Ga0105249_10106276 3300009553 Bacteria 2648
110 Ga0105239_10004193 3300010375 Bacteria 17314
111 Ga0105239_10031861 3300010375 Bacteria 5793
112 Ga0105239_10593469 3300010375 Bacteria 1263
113 Ga0105246_10169455 3300011119 Bacteria 1671
114 Ga0157369_10269171 3300013105 Bacteria 1776
115 Ga0157374_10166241 3300013296 Bacteria 2150
116 Ga0157378_10000869 3300013297 Bacteria 27899
117 Ga0163162_10007993 3300013306 Bacteria 10314
118 Ga0163162_10093763 3300013306 Bacteria 3088
119 Ga0163162_10298380 3300013306 Bacteria 1743
120 Ga0157375_10017806 3300013308 Bacteria 6425
121 Ga0163163_10041720 3300014325 Bacteria 4489
122 Ga0163163_10087283 3300014325 Bacteria 3130
123 Ga0163163_10199257 3300014325 Bacteria 2050
124 Ga0157380_10009816 3300014326 Bacteria 6872
125 Ga0157380_10224905 3300014326 Bacteria 1681
126 Ga0157377_10013612 3300014745 Bacteria 4122
127 Ga0157379_10000205 3300014968 Bacteria 45963
128 Ga0157379_10008443 3300014968 Bacteria 8955
129 Ga0157376_10305753 3300014969 Bacteria 1507
130 Ga0163161_10001565 3300017792 Bacteria 16887
131 Ga0163161_10122405 3300017792 Bacteria 1956
132 Ga0206353_11554476 3300020082 Bacteria 1241
133 Ga0213876_10008087 3300021384 Bacteria 5701
134 Ga0213876_10010465 3300021384 Bacteria 4975
135 Ga0213875_10012625 3300021388 Bacteria 4163
136 Ga0207656_10172930 3300025321 Bacteria 1033
137 Ga0207692_10006901 3300025898 Bacteria 4627
138 Ga0207692_10040716 3300025898 Bacteria 2295
139 Ga0207642_10001379 3300025899 Bacteria 7527
140 Ga0207710_10000020 3300025900 Bacteria 338425
141 Ga0207710_10000031 3300025900 Bacteria 285157
142 Ga0207710_10008331 3300025900 Bacteria 4373
143 Ga0207688_10001946 3300025901 Bacteria 11061
144 Ga0207688_10243074 3300025901 Bacteria 1089
145 Ga0207680_10016799 3300025903 Bacteria 3852
146 Ga0207680_10073718 3300025903 Bacteria 2123
147 Ga0207647_10012047 3300025904 Bacteria 6036
148 Ga0207699_10004507 3300025906 Bacteria 6655
149 Ga0207645_10011696 3300025907 Bacteria 5983
150 Ga0207693_10000944 3300025915 Bacteria 26088
151 Ga0207693_10001502 3300025915 Bacteria 20587
152 Ga0207693_10096896 3300025915 Bacteria 2313
153 Ga0207663_10004353 3300025916 Bacteria 7030
154 Ga0207663_10029163 3300025916 Bacteria 3237
155 Ga0207663_10117942 3300025916 Bacteria 1812
156 Ga0207660_10360850 3300025917 Bacteria 1166
157 Ga0207662_10040680 3300025918 Bacteria 2734
158 Ga0207681_10032772 3300025923 Bacteria 3404
159 Ga0207694_10155539 3300025924 Bacteria 1844
160 Ga0207659_10094540 3300025926 Bacteria 2240
161 Ga0207687_10001805 3300025927 Bacteria 14728
162 Ga0207700_10015784 3300025928 Bacteria 4994
163 Ga0207644_10028854 3300025931 Bacteria 3845
164 Ga0207706_10025637 3300025933 Bacteria 5281
165 Ga0207686_10006851 3300025934 Bacteria 6137
166 Ga0207709_10011119 3300025935 Bacteria 4964
167 Ga0207709_10194400 3300025935 Bacteria 1444
168 Ga0207670_10050246 3300025936 Bacteria 2793
169 Ga0207670_10324561 3300025936 Bacteria 1212
170 Ga0207669_10000374 3300025937 Bacteria 20104
171 Ga0207704_10004065 3300025938 Bacteria 6668
172 Ga0207665_10000595 3300025939 Bacteria 24296
173 Ga0207665_10002059 3300025939 Bacteria 13550
174 Ga0207711_10004209 3300025941 Bacteria 12316
175 Ga0207711_10417210 3300025941 Bacteria 1248
176 Ga0207689_10046832 3300025942 Bacteria 3572
177 Ga0207661_10017285 3300025944 Bacteria 5333
178 Ga0207661_10083404 3300025944 Bacteria 2645
179 Ga0207667_10625253 3300025949 Bacteria 1084
180 Ga0207712_10002257 3300025961 Bacteria 12516
181 Ga0207712_10203871 3300025961 Bacteria 1570
182 Ga0207668_10010066 3300025972 Bacteria 5694
183 Ga0207668_10072620 3300025972 Bacteria 2463
184 Ga0207640_10016563 3300025981 Bacteria 4291
185 Ga0207658_10014508 3300025986 Bacteria 5395
186 Ga0207658_10018592 3300025986 Bacteria 4802
187 Ga0207677_10007291 3300026023 Bacteria 6104
188 Ga0207677_10060563 3300026023 Bacteria 2617
189 Ga0207703_10000006 3300026035 Bacteria 502351
190 Ga0207703_10037015 3300026035 Bacteria 3886
191 Ga0207703_10088555 3300026035 Bacteria 2598
192 Ga0207703_10402352 3300026035 Bacteria 1271
193 Ga0207639_10032525 3300026041 Bacteria 3840
194 Ga0207678_10005367 3300026067 Bacteria 11478
195 Ga0207678_10016100 3300026067 Bacteria 6566
196 Ga0207708_10000982 3300026075 Bacteria 21374
197 Ga0207708_10004706 3300026075 Bacteria 10034
198 Ga0207702_10009888 3300026078 Bacteria 7996
199 Ga0207702_10058903 3300026078 Bacteria 3270
200 Ga0207641_10016504 3300026088 Bacteria 6047
201 Ga0207648_10000599 3300026089 Bacteria 40518
202 Ga0207648_10006604 3300026089 Bacteria 11518
203 Ga0207675_100001304 3300026118 Bacteria 25007
204 Ga0207675_100018230 3300026118 Bacteria 6545
205 Ga0207675_100111694 3300026118 Bacteria 2579
206 Ga0207683_10001493 3300026121 Bacteria 21105
207 Ga0207683_10011449 3300026121 Bacteria 7571
208 Ga0207698_10037307 3300026142 Bacteria 3578
209 Ga0207698_10080066 3300026142 Bacteria 2630
210 Ga0207698_10081621 3300026142 Bacteria 2611
211 Ga0209813_10046129 3300027866 Bacteria 1345
212 Ga0268266_10011626 3300028379 Bacteria 7642
213 Ga0268266_10065821 3300028379 Bacteria 3133
214 Ga0268265_10011162 3300028380 Bacteria 6070
215 Ga0268264_10018546 3300028381 Bacteria 5691
216 Ga0316575_10000074 3300031665 Bacteria 24489
217 Ga0373939_0013057 3300035114 Bacteria 2130
218 Ga0373931_0211449 3300035691 Bacteria 1163
219 Ga0373931_0258578 3300035691 Bacteria 1061
220 Ga0395898_0016619 3300037466 Bacteria 7521
221 Ga0395905_0060450 3300037471 Bacteria 3543
222 Ga0436364_0811537 3300037853 Bacteria 6327
223 Ga0395901_0007288 3300038443 Bacteria 11163
224 Ga0395901_0014636 3300038443 Bacteria 7972
225 Ga0395901_0167264 3300038443 Bacteria 2308
226 Ga0436365_0259894 3300039437 Bacteria 19688
227 Ga0436365_1469068 3300039437 Bacteria 36678
228 Ga0436365_1852140 3300039437 Bacteria 2241
229 Ga0439465_0013025 3300041413 Bacteria 2598
230 Ga0451791_1120556 3300041451 Bacteria 2866
231 Ga0451793_1009090 3300041452 Bacteria 2436
232 Ga0451807_0721635 3300041486 Bacteria 993
233 Ga0451833_0659992 3300041491 Bacteria 5791
234 Ga0451833_1311115 3300041491 Bacteria 2716
235 Ga0451837_0098191 3300041494 Bacteria 5277
236 Ga0451839_1518640 3300041496 Bacteria 1512
237 Ga0451841_0122922 3300041498 Bacteria 1814
238 Ga0466965_0004402 3300044683 Bacteria 6262
239 Ga0466966_0001426 3300044684 Bacteria 15385
240 Ga0466961_0001731 3300044693 Bacteria 13574
241 Ga0466961_0026757 3300044693 Bacteria 3708
242 Ga0466961_0121585 3300044693 Bacteria 1639
243 Ga0466963_0005495 3300044694 Bacteria 7421
244 Ga0466963_0050646 3300044694 Bacteria 2749
245 Ga0466971_0073593 3300044719 Bacteria 1553
246 Ga0466971_0101475 3300044719 Bacteria 1323
247 Ga0466957_0002495 3300044842 Bacteria 9888
248 Ga0466957_0312488 3300044842 Bacteria 1058
249 Ga0466960_0000201 3300044901 Bacteria 20658
250 Ga0466959_0027800 3300045049 Bacteria 4195
251 Ga0466958_0000266 3300045836 Bacteria 20187
252 Ga0466967_0046450 3300045976 Bacteria 3781
253 Ga0466967_0110407 3300045976 Bacteria 2526
254 Ga0466967_0188959 3300045976 Bacteria 1946
255 Ga0466967_0259349 3300045976 Bacteria 1663
256 Ga0466967_0310557 3300045976 Bacteria 1519
257 Ga0466967_0522168 3300045976 Bacteria 1167
258 Ga0495641_0029305 3300046461 Bacteria 2653
259 Ga0496100_0002100 3300048903 Bacteria 10035
260 Ga0496100_0260438 3300048903 Bacteria 1286
261 Ga0496101_0004249 3300048904 Bacteria 8985
262 Ga0496101_0122104 3300048904 Bacteria 1970
263 Ga0496102_0008056 3300048905 Bacteria 9013
264 Ga0496102_0016396 3300048905 Bacteria 6471
265 Ga0496102_0127508 3300048905 Bacteria 2379
266 Ga0496103_0005646 3300048906 Bacteria 7479
267 Ga0496103_0311014 3300048906 Bacteria 1013
268 Ga0496104_0101283 3300048907 Bacteria 2757
269 Ga0496104_0467013 3300048907 Bacteria 1173
270 Ga0496105_0343505 3300048908 Bacteria 1193
271 Ga0496105_0573299 3300048908 Bacteria 879
272 Ga0496106_0001341 3300048909 Bacteria 18465
273 Ga0496107_0000392 3300048910 Bacteria 23713
274 Ga0496108_0004384 3300048911 Bacteria 11359
275 Ga0496108_0064994 3300048911 Bacteria 3074
276 Ga0496108_0224233 3300048911 Bacteria 1633
277 Ga0496109_0006296 3300048912 Bacteria 9991
278 Ga0496110_0026899 3300048913 Bacteria 4927
279 Ga0496110_0030117 3300048913 Bacteria 4676
280 Ga0496110_0080650 3300048913 Bacteria 2900
281 Ga0496110_0254894 3300048913 Bacteria 1597
282 Ga0496111_0027988 3300048914 Bacteria 3993
283 Ga0496111_0065228 3300048914 Bacteria 2643
284 Ga0496112_0034049 3300048915 Bacteria 4956
285 Ga0496112_0208258 3300048915 Bacteria 1913
286 Ga0496113_0057338 3300048916 Bacteria 2927
287 Ga0496113_0157241 3300048916 Bacteria 1796
288 Ga0496114_0000934 3300048917 Bacteria 21866
289 Ga0496114_0142199 3300048917 Bacteria 2078
290 Ga0496115_0010115 3300048918 Bacteria 7036
291 Ga0496119_0000643 3300048922 Bacteria 47066
292 Ga0496119_0082953 3300048922 Bacteria 1842
293 Ga0496120_0000699 3300048923 Bacteria 49187
294 Ga0496121_0015267 3300048924 Bacteria 8067
295 Ga0496126_0000665 3300048929 Bacteria 63606
296 Ga0496126_0003010 3300048929 Bacteria 21871
297 Ga0501034_0313419 3300049571 Bacteria 1503
298 Ga0501068_0152145 3300049584 Bacteria 1454
299 nmdc:mga03n38_16039_c1 3300050490 Bacteria 2907
300 nmdc:mga03n38_23375_c1 3300050490 Bacteria 2514
301 nmdc:mga00v17_31140_c1 3300050491 Bacteria 3144
302 nmdc:mga00v17_6778_c1 3300050491 Bacteria 6087
303 nmdc:mga0yw44_245821_c1 3300050492 Bacteria 1190
304 nmdc:mga06z11_7107_c1 3300050494 Bacteria 3572
305 nmdc:mga04h51_26731_c1 3300050495 Bacteria 1787
306 nmdc:mga07m45_180368_c1 3300050496 Bacteria 1228
307 nmdc:mga07m45_2024_c1 3300050496 Bacteria 9406
308 nmdc:mga0qj67_65570_c1 3300050509 Bacteria 2891
309 nmdc:mga06r32_86_c3 3300050510 Bacteria 8125
310 nmdc:mga08y16_404065_c1 3300050511 Bacteria 1397
311 nmdc:mga0sz30_150684_c1 3300050516 Bacteria 1029
312 nmdc:mga0sz30_31116_c2 3300050516 Bacteria 1663
313 nmdc:mga0sz30_47535_c1 3300050516 Bacteria 1813
314 nmdc:mga0sz30_9892_c1 3300050516 Bacteria 3640
315 Ga0500568_0002215 3300053139 Bacteria 11675
316 Ga0466962_0117624 3300061719 Bacteria 1281
317 2528202996 2527291627 Bacteria 5309833
318 2515854166 2515154155 Bacteria 7985436
319 2528213327 2527291629 Bacteria 5267418
320 2546947766 2546825537 Bacteria 5389291
321 2579750052 2576861822 Bacteria 5004595
322 2579853170 2579778521 Bacteria 7624758
323 2619855823 2619618881 Bacteria 7521104
324 2620348265 2619619003 Bacteria 7619552
325 2626635316 2626541554 Bacteria 7741902
326 2686543351 2684623036 Bacteria 5199090
327 2710602315 2710264753 Bacteria 5455564
328 2774864519 2773857924 Bacteria 5256821
329 2842138343 2842134933 Bacteria 5847019
330 2870629848 2870628048 Bacteria 3696012
331 637880879 637000116 Bacteria 5433628
332 8054917904 8054913762 Bacteria 7713009
333 8054921423 8054920844 Bacteria 7068637
334 JGI24737J22298_10023895
335 JGI24748J21848_1000351
336 JGI24749J21850_1007499
337 JGI24744J21845_10000086
338 JGI24744J21845_10013649
339 Ga0070676_10003661
340 Ga0070683_100006135
341 Ga0070683_100075063
342 Ga0070690_100003633
343 Ga0070670_100336159
344 Ga0070666_10044488
345 Ga0070680_100275249
346 Ga0068868_100001612
347 Ga0068868_100091118
348 Ga0070689_100014452
349 Ga0070689_100091390
350 Ga0070691_10003048
351 Ga0070668_100037521
352 Ga0070668_100043990
353 Ga0070675_100068485
354 Ga0070671_100018630
355 Ga0070674_100019719
356 Ga0070673_100255923
357 Ga0070688_100017086
358 Ga0070667_100014416
359 Ga0070667_100015680
360 Ga0070709_10006216
361 Ga0070709_10105303
362 Ga0070713_100005627
363 Ga0070710_10001814
364 Ga0070710_10022931
365 Ga0070710_10067886
366 Ga0070701_10004102
367 Ga0070711_100000712
368 Ga0070711_100123082
369 Ga0070700_100001425
370 Ga0070700_100014418
371 Ga0070663_100011821
372 Ga0070678_100000696
373 Ga0070678_100061866
374 Ga0070662_100012159
375 Ga0070662_100301749
376 Ga0068867_100020513
377 Ga0070685_10023028
378 Ga0068853_100010034
379 Ga0070686_100146302
380 Ga0070695_100028173
381 Ga0070696_100005555
382 Ga0070696_100062970
383 Ga0070693_100009952
384 Ga0070665_100003013
385 Ga0070665_100034419
386 Ga0070704_100001564
387 Ga0070704_100004396
388 Ga0068854_100000630
389 Ga0068856_100074022
390 Ga0068852_100048786
391 Ga0068852_100090611
392 Ga0068859_100009213
393 Ga0068864_100034058
394 Ga0068864_100135070
395 Ga0068866_10003121
396 Ga0068861_100007409
397 Ga0068861_100076311
398 Ga0068851_10056506
399 Ga0068863_100035405
400 Ga0068858_100000003
401 Ga0068858_100017227
402 Ga0068858_100020438
403 Ga0068860_100002676
404 Ga0068862_100005303
405 Ga0068862_100314180
406 Ga0081455_10000939
407 Ga0081455_10020091
408 Ga0081455_10089439
409 Ga0070717_10288273
410 Ga0075365_10009858
411 Ga0075365_10087467
412 Ga0075368_10033408
413 Ga0075363_100021343
414 Ga0075364_10001593
415 Ga0075364_10016056
416 Ga0070716_100003614
417 Ga0070716_100013484
418 Ga0070712_100001885
419 Ga0070712_100063424
420 Ga0070712_100119577
421 Ga0070712_100150262
422 Ga0075367_10002622
423 Ga0075369_10081380
424 Ga0075370_10009137
425 Ga0068871_100156360
426 Ga0075430_100187081
427 Ga0075431_100048264
428 Ga0068865_100004475
429 Ga0097620_100009214
430 Ga0105250_10033787
431 Ga0105245_10000983
432 Ga0105245_10082743
433 Ga0105247_10000014
434 Ga0105247_10000452
435 Ga0105247_10000570
436 Ga0105243_10001753
437 Ga0105242_10000909
438 Ga0105248_10010646
439 Ga0105248_10013379
440 Ga0105237_10227027
441 Ga0105249_10001452
442 Ga0105249_10106276
443 Ga0105239_10004193
444 Ga0105239_10031861
445 Ga0105239_10593469
446 Ga0105246_10169455
447 Ga0157369_10269171
448 Ga0157374_10166241
449 Ga0157378_10000869
450 Ga0163162_10007993
451 Ga0163162_10093763
452 Ga0163162_10298380
453 Ga0157375_10017806
454 Ga0163163_10041720
455 Ga0163163_10087283
456 Ga0163163_10199257
457 Ga0157380_10009816
458 Ga0157380_10224905
459 Ga0157377_10013612
460 Ga0157379_10000205
461 Ga0157379_10008443
462 Ga0157376_10305753
463 Ga0163161_10001565
464 Ga0163161_10122405
465 Ga0206353_11554476
466 Ga0213876_10008087
467 Ga0213876_10010465
468 Ga0213875_10012625
469 Ga0207656_10172930
470 Ga0207692_10006901
471 Ga0207692_10040716
472 Ga0207642_10001379
473 Ga0207710_10000020
474 Ga0207710_10000031
475 Ga0207710_10008331
476 Ga0207688_10001946
477 Ga0207688_10243074
478 Ga0207680_10016799
479 Ga0207680_10073718
480 Ga0207647_10012047
481 Ga0207699_10004507
482 Ga0207645_10011696
483 Ga0207693_10000944
484 Ga0207693_10001502
485 Ga0207693_10096896
486 Ga0207663_10004353
487 Ga0207663_10029163
488 Ga0207663_10117942
489 Ga0207660_10360850
490 Ga0207662_10040680
491 Ga0207681_10032772
492 Ga0207694_10155539
493 Ga0207659_10094540
494 Ga0207687_10001805
495 Ga0207700_10015784
496 Ga0207644_10028854
497 Ga0207706_10025637
498 Ga0207686_10006851
499 Ga0207709_10011119
500 Ga0207709_10194400
501 Ga0207670_10050246
502 Ga0207670_10324561
503 Ga0207669_10000374
504 Ga0207704_10004065
505 Ga0207665_10000595
506 Ga0207665_10002059
507 Ga0207711_10004209
508 Ga0207711_10417210
509 Ga0207689_10046832
510 Ga0207661_10017285
511 Ga0207661_10083404
512 Ga0207667_10625253
513 Ga0207712_10002257
514 Ga0207712_10203871
515 Ga0207668_10010066
516 Ga0207668_10072620
517 Ga0207640_10016563
518 Ga0207658_10014508
519 Ga0207658_10018592
520 Ga0207677_10007291
521 Ga0207677_10060563
522 Ga0207703_10000006
523 Ga0207703_10037015
524 Ga0207703_10088555
525 Ga0207703_10402352
526 Ga0207639_10032525
527 Ga0207678_10005367
528 Ga0207678_10016100
529 Ga0207708_10000982
530 Ga0207708_10004706
531 Ga0207702_10009888
532 Ga0207702_10058903
533 Ga0207641_10016504
534 Ga0207648_10000599
535 Ga0207648_10006604
536 Ga0207675_100001304
537 Ga0207675_100018230
538 Ga0207675_100111694
539 Ga0207683_10001493
540 Ga0207683_10011449
541 Ga0207698_10037307
542 Ga0207698_10080066
543 Ga0207698_10081621
544 Ga0209813_10046129
545 Ga0268266_10011626
546 Ga0268266_10065821
547 Ga0268265_10011162
548 Ga0268264_10018546
549 Ga0316575_10000074
550 Ga0373939_0013057
551 Ga0373931_0211449
552 Ga0373931_0258578
553 Ga0395898_0016619
554 Ga0395905_0060450
555 Ga0436364_0811537
556 Ga0395901_0007288
557 Ga0395901_0014636
558 Ga0395901_0167264
559 Ga0436365_0259894
560 Ga0436365_1469068
561 Ga0436365_1852140
562 Ga0439465_0013025
563 Ga0451791_1120556
564 Ga0451793_1009090
565 Ga0451807_0721635
566 Ga0451833_0659992
567 Ga0451833_1311115
568 Ga0451837_0098191
569 Ga0451839_1518640
570 Ga0451841_0122922
571 Ga0466965_0004402
572 Ga0466966_0001426
573 Ga0466961_0001731
574 Ga0466961_0026757
575 Ga0466961_0121585
576 Ga0466963_0005495
577 Ga0466963_0050646
578 Ga0466971_0073593
579 Ga0466971_0101475
580 Ga0466957_0002495
581 Ga0466957_0312488
582 Ga0466960_0000201
583 Ga0466959_0027800
584 Ga0466958_0000266
585 Ga0466967_0046450
586 Ga0466967_0110407
587 Ga0466967_0188959
588 Ga0466967_0259349
589 Ga0466967_0310557
590 Ga0466967_0522168
591 Ga0495641_0029305
592 Ga0496100_0002100
593 Ga0496100_0260438
594 Ga0496101_0004249
595 Ga0496101_0122104
596 Ga0496102_0008056
597 Ga0496102_0016396
598 Ga0496102_0127508
599 Ga0496103_0005646
600 Ga0496103_0311014
601 Ga0496104_0101283
602 Ga0496104_0467013
603 Ga0496105_0343505
604 Ga0496105_0573299
605 Ga0496106_0001341
606 Ga0496107_0000392
607 Ga0496108_0004384
608 Ga0496108_0064994
609 Ga0496108_0224233
610 Ga0496109_0006296
611 Ga0496110_0026899
612 Ga0496110_0030117
613 Ga0496110_0080650
614 Ga0496110_0254894
615 Ga0496111_0027988
616 Ga0496111_0065228
617 Ga0496112_0034049
618 Ga0496112_0208258
619 Ga0496113_0057338
620 Ga0496113_0157241
621 Ga0496114_0000934
622 Ga0496114_0142199
623 Ga0496115_0010115
624 Ga0496119_0000643
625 Ga0496119_0082953
626 Ga0496120_0000699
627 Ga0496121_0015267
628 Ga0496126_0000665
629 Ga0496126_0003010
630 Ga0501034_0313419
631 Ga0501068_0152145
632 nmdc:mga03n38_16039_c1
633 nmdc:mga03n38_23375_c1
634 nmdc:mga00v17_31140_c1
635 nmdc:mga00v17_6778_c1
636 nmdc:mga0yw44_245821_c1
637 nmdc:mga06z11_7107_c1
638 nmdc:mga04h51_26731_c1
639 nmdc:mga07m45_180368_c1
640 nmdc:mga07m45_2024_c1
641 nmdc:mga0qj67_65570_c1
642 nmdc:mga06r32_86_c3
643 nmdc:mga08y16_404065_c1
644 nmdc:mga0sz30_150684_c1
645 nmdc:mga0sz30_31116_c2
646 nmdc:mga0sz30_47535_c1
647 nmdc:mga0sz30_9892_c1
648 Ga0500568_0002215
649 Ga0466962_0117624
650 2528202996
651 2515854166
652 2528213327
653 2546947766
654 2579750052
655 2579853170
656 2619855823
657 2620348265
658 2626635316
659 2686543351
660 2710602315
661 2774864519
662 2842138343
663 2870629848
664 637880879
665 8054917904
666 8054921423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01509

TruB_N

TruB family pseudouridylate synthase (N terminal domain)

51

208

0.98

PF09142

TruB_C

tRNA Pseudouridine synthase II, C terminal

266

321

0.98

PF16198

TruB_C_2

tRNA pseudouridylate synthase B C-terminal domain

209

262

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.8868 1 247
1sgv-assembly2.cif.gz_B structure of trna psi55 pseudouridine synthase (trub) 0.8702 2 248
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.863 1 247
1sgv-assembly2.cif.gz_B structure of trna psi55 pseudouridine synthase (trub) 0.847 2 248
1k8w-assembly1.cif.gz_A crystal structure of the e. coli pseudouridine synthase trub bound to a t stem-loop rna 0.8361 1 244
ID Description Score Start End Superfamily
1s71A02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9799 184 244 2.30.130.10
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9559 2 54 3.30.2350.10
1s71A02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9349 184 244 2.30.130.10
af_P9WHP7_7_227_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9108 5 182 3.30.2350.10
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8766 2 54 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A1E3R793-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9479 1 250 GO:0003723
GO:0031119
GO:0160148
GO:1990481
AF-A0A7W1K6K3-F1-model_v4 tRNA pseudouridine(55) synthase TruB 0.9432 181 244 GO:0001522
GO:0003723
GO:0009982
AF-A0A1S2WME6-F1-model_v4 deleted 0.9424 4 250
AF-A0A1H3X031-F1-model_v4 deleted 0.9402 3 250
AF-A0A3E0I0D3-F1-model_v4 tRNA pseudouridine synthase B (EC 5.4.99.25) (tRNA pseudouridine(55) synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase) 0.9366 3 245 GO:0003723
GO:0031119
GO:0160148
GO:1990481

Map