F411490

General Info

Members Datasets Scaffolds Average Seq Length
333 260 267 291

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000234|Ga0495583_0000234_90418_91353
Length 311
Sequence MTPRDVRLPNFRLPKRTKGLMAWTWWDLIPVAAAVAHLAFVVWIVVGSANRPWWGQLLCGFGYALAISWNVNGVSHNFLHTPYFRSKALNRAFSLLESLAIGFSQTFYTWVHLRHHEGNSDRPGPDGETRDWLSIYRHGKDGQPENVWSYVFLGFFRDSGGSVYQALKARGRDADARWGRIEIAAVAAFAIGMAVIDWRAVLFLLPFYYLGECLSQLNGYYEHFNGDPETPIAWGVSSYDPVYNVTWFNNGHHAEHHFRPAVHWTQLPALRRALVEQQAAQGVHVIGPAHALGFLARANRRPRDAERAVRP

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2519899620 Rhizobium sp. Pop5 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
9 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
10 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
11 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
12 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
13 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
14 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
15 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
18 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
19 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
20 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
21 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
22 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
23 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
24 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
25 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
26 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
27 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
28 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
29 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
30 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
31 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
32 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
33 2791355263 Rhizobium chutanense C5 Isolate Nodule
34 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
35 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
36 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
37 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
38 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
39 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
40 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
41 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
42 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
43 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
44 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
45 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
46 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
47 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
48 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
49 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
50 2936381700 Rhizobium chutanense C16 Isolate Unclassified
51 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
52 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
53 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
54 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
55 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
56 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
57 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
58 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
59 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
109 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
165 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
235 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
249 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
250 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
251 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
252 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
253 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
254 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
255 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
256 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
257 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
258 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
259 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
260 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.18
Metatranscriptomes 0
Isolates 19.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.23
Nodule 8.11
Rhizoplane 1.5
Rhizosphere 42.94
Stem 0
Stem Tuber 0
Unclassified 19.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000004 3300001979 Bacteria 91019
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25162J39368_1000482 3300002737 Bacteria 30484
5 JGI25162J39368_1000526 3300002737 Bacteria 28526
6 JGI25154J39366_1000096 3300002738 Bacteria 79168
7 JGI25158J39367_1000081 3300002739 Bacteria 22110
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25152J39213_1001056 3300002773 Bacteria 13075
10 JGI25159J45721_1001028 3300002987 Bacteria 11987
11 JGI25159J45721_1003346 3300002987 Bacteria 5718
12 JGI25151J46595_10062456 3300003187 Bacteria 1178
13 JGI25165J46597_1000190 3300003214 Bacteria 91363
14 JGI25165J46597_1000328 3300003214 Bacteria 56610
15 JGI25153J46596_10001863 3300003215 Bacteria 12494
16 rootH1_10070844 3300003316 Bacteria 4162
17 rootH2_10017677 3300003320 Bacteria 13034
18 rootL2_10002812 3300003322 Bacteria 40354
19 rootH1_10028475 3300003323 Bacteria 8871
20 rootH1_10031460 3300003323 Bacteria 7779
21 rootH1_10141540 3300003323 Bacteria 2722
22 JGI25160J50197_1000108 3300003354 Bacteria 77944
23 JGI25160J50197_1001507 3300003354 Bacteria 11576
24 JGI25161J50226_1000112 3300003374 Bacteria 63152
25 JGI25161J50226_1000304 3300003374 Bacteria 27435
26 Ga0055526_1002344 3300003771 Bacteria 12864
27 Ga0055526_1002963 3300003771 Bacteria 11126
28 Ga0055526_1021591 3300003771 Bacteria 2232
29 Ga0055524_1000769 3300003775 Bacteria 21606
30 Ga0055524_1006444 3300003775 Bacteria 5088
31 Ga0055536_1000029 3300003781 Bacteria 157375
32 Ga0055536_1000092 3300003781 Bacteria 77375
33 Ga0055528_1000054 3300003790 Bacteria 90334
34 Ga0055528_1000083 3300003790 Bacteria 74840
35 Ga0055528_1002097 3300003790 Bacteria 11052
36 Ga0055530_10000363 3300003791 Bacteria 41018
37 Ga0055540_1006164 3300003792 Bacteria 4822
38 Ga0055543_1000080 3300004625 Bacteria 84865
39 Ga0055543_1000096 3300004625 Bacteria 75972
40 Ga0065165_1000520 3300005262 Bacteria 58925
41 Ga0065165_1004702 3300005262 Bacteria 8208
42 Ga0065715_10099681 3300005293 Bacteria 3382
43 Ga0070667_100257123 3300005367 Bacteria 1563
44 Ga0070706_100341372 3300005467 Unclassified 1396
45 Ga0070707_100439277 3300005468 Unclassified 1265
46 Ga0070698_100032279 3300005471 Bacteria 5425
47 Ga0070698_100655771 3300005471 Bacteria 991
48 Ga0070699_100141295 3300005518 Unclassified 2126
49 Ga0070697_100014754 3300005536 Bacteria 6133
50 Ga0070665_100142828 3300005548 Bacteria 2397
51 Ga0070665_100304390 3300005548 Bacteria 1597
52 Ga0068854_100053568 3300005578 Bacteria 2898
53 Ga0068856_100011847 3300005614 Bacteria 8449
54 Ga0068856_100754938 3300005614 Bacteria 993
55 Ga0068859_100763709 3300005617 Bacteria 1055
56 Ga0068860_100000083 3300005843 Bacteria 168189
57 Ga0068862_100329128 3300005844 Bacteria 1412
58 Ga0075368_10009610 3300006042 Bacteria 3481
59 Ga0075367_10000873 3300006178 Bacteria 12073
60 Ga0075367_10067525 3300006178 Bacteria 2144
61 Ga0075369_10043729 3300006186 Bacteria 1923
62 Ga0075369_10067742 3300006186 Bacteria 1568
63 Ga0075427_10018532 3300006194 Bacteria 1093
64 Ga0075370_10022364 3300006353 Bacteria 3471
65 Ga0075370_10058719 3300006353 Bacteria 2188
66 Ga0075428_100413919 3300006844 Bacteria 1444
67 Ga0075430_100035181 3300006846 Bacteria 4250
68 Ga0075431_100279188 3300006847 Bacteria 1691
69 Ga0075433_10029299 3300006852 Bacteria 4688
70 Ga0075433_10032486 3300006852 Bacteria 4471
71 Ga0075429_100144867 3300006880 Bacteria 2079
72 Ga0097620_100763697 3300006931 Bacteria 1055
73 Ga0105250_10056800 3300009092 Bacteria 1570
74 Ga0105240_10000013 3300009093 Bacteria 483458
75 Ga0114129_10024390 3300009147 Bacteria 8570
76 Ga0114129_10046126 3300009147 Bacteria 6125
77 Ga0114129_10057257 3300009147 Bacteria 5456
78 Ga0105237_10040004 3300009545 Bacteria 4730
79 Ga0123341_1000781 3300009765 Bacteria 21631
80 Ga0123342_1018673 3300009766 Bacteria 5460
81 Ga0105239_10014173 3300010375 Bacteria 8845
82 Ga0105246_10414024 3300011119 Bacteria 1123
83 Ga0157370_10000548 3300013104 Bacteria 46830
84 Ga0157369_10144533 3300013105 Bacteria 2515
85 Ga0182008_10028114 3300014497 Bacteria 2844
86 Ga0157379_10167717 3300014968 Bacteria 1982
87 Ga0157376_10016971 3300014969 Bacteria 5543
88 Ga0182007_10000458 3300015262 Bacteria 24641
89 Ga0209435_100009 3300025206 Bacteria 476614
90 Ga0209436_100009 3300025208 Bacteria 143684
91 Ga0209672_103223 3300025228 Bacteria 3473
92 Ga0207427_103955 3300025231 Bacteria 2732
93 Ga0209437_100057 3300025233 Bacteria 362922
94 Ga0209437_100206 3300025233 Bacteria 115048
95 Ga0209646_1000018 3300025246 Bacteria 476716
96 Ga0209026_1000043 3300025250 Bacteria 269142
97 Ga0209677_101737 3300025253 Bacteria 9076
98 Ga0209759_1000007 3300025256 Bacteria 476614
99 Ga0209129_1006526 3300025258 Bacteria 3740
100 Ga0209233_1000130 3300025261 Bacteria 205687
101 Ga0209233_1000178 3300025261 Bacteria 140956
102 Ga0209233_1000256 3300025261 Bacteria 80855
103 Ga0209455_1009775 3300025272 Bacteria 2491
104 Ga0209673_1000067 3300025273 Bacteria 249077
105 Ga0209673_1000086 3300025273 Bacteria 210101
106 Ga0209673_1001363 3300025273 Bacteria 24193
107 Ga0209130_1000031 3300025284 Bacteria 322932
108 Ga0209130_1000108 3300025284 Bacteria 133733
109 Ga0209676_1000057 3300025292 Bacteria 361061
110 Ga0209025_1002308 3300025294 Bacteria 20678
111 Ga0209564_1000092 3300025295 Bacteria 249018
112 Ga0209564_1000952 3300025295 Bacteria 37023
113 Ga0209564_1021123 3300025295 Bacteria 2355
114 Ga0209758_1004432 3300025297 Bacteria 11696
115 Ga0209758_1004917 3300025297 Bacteria 10742
116 Ga0209758_1045244 3300025297 Bacteria 1600
117 Ga0209050_1000096 3300025298 Bacteria 240109
118 Ga0209256_1000788 3300025299 Bacteria 40932
119 Ga0209256_1004712 3300025299 Bacteria 8356
120 Ga0207426_1000042 3300025302 Bacteria 433289
121 Ga0207426_1000082 3300025302 Bacteria 298939
122 Ga0209051_1003708 3300025303 Bacteria 9855
123 Ga0207655_1002550 3300025728 Bacteria 14580
124 Ga0207684_10112349 3300025910 Unclassified 2332
125 Ga0207695_10000044 3300025913 Bacteria 440819
126 Ga0207671_10003650 3300025914 Bacteria 15204
127 Ga0207694_10006739 3300025924 Bacteria 8725
128 Ga0207640_10145918 3300025981 Bacteria 1731
129 Ga0207658_10209892 3300025986 Bacteria 1631
130 Ga0207702_10023861 3300026078 Bacteria 5074
131 Ga0209371_1002468 3300027312 Bacteria 10298
132 Ga0209813_10010267 3300027866 Bacteria 2417
133 Ga0268266_10018292 3300028379 Bacteria 5975
134 Ga0268266_10027899 3300028379 Bacteria 4801
135 Ga0268265_10315442 3300028380 Bacteria 1413
136 Ga0268264_10000055 3300028381 Bacteria 314947
137 Ga0265337_1006723 3300028556 Bacteria 4386
138 Ga0268256_1003511 3300030500 Bacteria 7038
139 Ga0307511_10016515 3300030521 Bacteria 7109
140 Ga0265327_10002596 3300031251 Bacteria 18697
141 Ga0307513_10038504 3300031456 Bacteria 5308
142 Ga0307513_10412771 3300031456 Bacteria 1082
143 Ga0307510_10008361 3300033180 Bacteria 12331
144 Ga0373935_0016295 3300035692 Bacteria 4498
145 Ga0373937_0015745 3300036401 Bacteria 6698
146 Ga0373925_0064962 3300037068 Bacteria 2748
147 Ga0451800_0516969 3300041459 Bacteria 1710
148 Ga0451839_0023546 3300041496 Bacteria 2966
149 Ga0451847_0519890 3300041503 Bacteria 5200
150 Ga0451851_0391774 3300041507 Bacteria 3019
151 Ga0451843_0727982 3300041509 Bacteria 4485
152 Ga0466970_0014846 3300044765 Bacteria 4003
153 Ga0495629_0011394 3300046459 Bacteria 6458
154 Ga0495638_0000079 3300046460 Bacteria 157488
155 Ga0495638_0000143 3300046460 Bacteria 113640
156 Ga0495638_0000380 3300046460 Bacteria 55127
157 Ga0495651_0149829 3300046462 Bacteria 1683
158 Ga0495650_0015488 3300046471 Bacteria 3907
159 Ga0495650_0033200 3300046471 Bacteria 2299
160 Ga0495605_0000016 3300046474 Bacteria 289508
161 Ga0495662_0016909 3300046476 Bacteria 3529
162 Ga0495594_0002983 3300046499 Bacteria 8776
163 Ga0495607_0123104 3300046501 Bacteria 1359
164 Ga0495583_0000037 3300046506 Bacteria 244437
165 Ga0495583_0000234 3300046506 Bacteria 92118
166 Ga0495583_0000819 3300046506 Bacteria 38035
167 Ga0495606_0236756 3300046507 Bacteria 1020
168 Ga0495610_0048563 3300046512 Bacteria 2082
169 Ga0495616_0000117 3300046513 Bacteria 70162
170 Ga0495620_0002987 3300046515 Bacteria 9732
171 Ga0495631_0033674 3300046518 Bacteria 2300
172 Ga0495632_0001570 3300046519 Bacteria 18850
173 Ga0495637_0005840 3300046520 Bacteria 6228
174 Ga0495643_0001728 3300046522 Bacteria 18884
175 Ga0495643_0111878 3300046522 Unclassified 1388
176 Ga0495648_0014611 3300046524 Bacteria 5737
177 Ga0495654_0003411 3300046530 Bacteria 9754
178 Ga0495609_0002089 3300046538 Bacteria 12552
179 Ga0495597_0003441 3300046542 Bacteria 9235
180 Ga0495597_0061925 3300046542 Bacteria 1629
181 Ga0495622_0037948 3300046557 Bacteria 2243
182 Ga0495633_0003972 3300046558 Bacteria 9601
183 Ga0495633_0049553 3300046558 Bacteria 1982
184 Ga0495668_0054518 3300046616 Bacteria 2209
185 Ga0495668_0134267 3300046616 Bacteria 1354
186 Ga0495611_0011571 3300046648 Bacteria 3742
187 Ga0495635_0092343 3300046663 Bacteria 2070
188 Ga0495661_0001970 3300046665 Bacteria 16269
189 Ga0495657_0045898 3300046675 Bacteria 2962
190 Ga0495669_0000006 3300046684 Bacteria 190838
191 Ga0495669_0000577 3300046684 Bacteria 16281
192 Ga0495670_0004697 3300046691 Bacteria 6703
193 Ga0495671_0029901 3300046692 Bacteria 2793
194 Ga0495589_0002984 3300046794 Bacteria 9323
195 Ga0495660_0016840 3300046810 Bacteria 4211
196 Ga0495604_0157982 3300047317 Bacteria 1604
197 Ga0495672_0004601 3300047320 Bacteria 11208
198 Ga0495672_0026551 3300047320 Bacteria 3693
199 Ga0495683_0003209 3300047323 Bacteria 9557
200 Ga0495687_081322 3300047443 Bacteria 1268
201 Ga0495679_005198 3300047446 Bacteria 5817
202 Ga0495681_0010167 3300047470 Bacteria 5720
203 Ga0495681_0036995 3300047470 Bacteria 2409
204 Ga0495686_0005997 3300047472 Bacteria 9449
205 Ga0496106_0000109 3300048909 Bacteria 64454
206 Ga0496106_0016469 3300048909 Bacteria 5470
207 Ga0496107_0000086 3300048910 Bacteria 44285
208 Ga0496117_0001113 3300048920 Bacteria 40547
209 Ga0496117_0107487 3300048920 Bacteria 1747
210 Ga0496118_0001953 3300048921 Bacteria 29213
211 Ga0496118_0002207 3300048921 Bacteria 27019
212 Ga0496119_0017106 3300048922 Bacteria 5479
213 Ga0496119_0026229 3300048922 Bacteria 4044
214 Ga0496120_0008671 3300048923 Bacteria 7334
215 Ga0496121_0001285 3300048924 Bacteria 43232
216 Ga0496121_0003282 3300048924 Bacteria 23219
217 Ga0496121_0005792 3300048924 Bacteria 15683
218 Ga0496121_0051523 3300048924 Bacteria 3465
219 Ga0496121_0094913 3300048924 Bacteria 2319
220 Ga0496121_0135357 3300048924 Bacteria 1837
221 Ga0496122_0000137 3300048925 Bacteria 170016
222 Ga0496122_0009062 3300048925 Bacteria 10561
223 Ga0496122_0027700 3300048925 Bacteria 4834
224 Ga0496122_0235429 3300048925 Bacteria 1037
225 Ga0496123_0000022 3300048926 Bacteria 361832
226 Ga0496123_0001624 3300048926 Bacteria 30272
227 Ga0496123_0057103 3300048926 Bacteria 2544
228 Ga0496124_0000715 3300048927 Bacteria 54340
229 Ga0496124_0021779 3300048927 Bacteria 5896
230 Ga0496124_0028471 3300048927 Bacteria 4998
231 Ga0496126_0002676 3300048929 Bacteria 23569
232 Ga0495678_000508 3300049459 Bacteria 37991
233 Ga0501067_0016579 3300049583 Unclassified 4072
234 nmdc:mga0k408_54612_c1 3300050493 Bacteria 2315
235 nmdc:mga06z11_51713_c1 3300050494 Bacteria 2105
236 nmdc:mga04h51_11840_c1 3300050495 Bacteria 2433
237 nmdc:mga07m45_10107_c1 3300050496 Bacteria 4917
238 nmdc:mga05p37_104111_c1 3300050507 Bacteria 3492
239 nmdc:mga05p37_110772_c1 3300050507 Bacteria 3377
240 nmdc:mga05p37_185990_c1 3300050507 Bacteria 2526
241 nmdc:mga0qj67_330310_c1 3300050509 Bacteria 1234
242 nmdc:mga0a205_175898_c1 3300050515 Bacteria 2036
243 nmdc:mga0a205_97685_c1 3300050515 Bacteria 2836
244 nmdc:mga0sz30_13683_c1 3300050516 Bacteria 1994
245 Ga0500610_0082254 3300053079 Bacteria 1678
246 Ga0495619_0214182 3300053085 Bacteria 1334
247 Ga0500578_0015853 3300053086 Bacteria 4838
248 Ga0500643_026052 3300053087 Bacteria 1836
249 Ga0500646_0072777 3300053090 Bacteria 1034
250 Ga0500660_110103 3300053100 Bacteria 1177
251 Ga0500554_001979 3300053102 Bacteria 3976
252 Ga0500569_004599 3300053109 Bacteria 2911
253 Ga0500594_0001980 3300053118 Bacteria 4430
254 Ga0500618_000028 3300053125 Bacteria 140440
255 Ga0500618_000053 3300053125 Bacteria 101079
256 Ga0500618_000497 3300053125 Bacteria 25239
257 Ga0500559_0000005 3300053136 Bacteria 230231
258 Ga0500568_0000074 3300053139 Bacteria 94957
259 Ga0500568_0000307 3300053139 Bacteria 39094
260 Ga0500577_0000155 3300053142 Bacteria 17094
261 Ga0500604_0009098 3300053151 Bacteria 2643
262 Ga0500616_0001534 3300053153 Bacteria 21730
263 Ga0500622_0003453 3300053156 Bacteria 10540
264 Ga0500622_0013879 3300053156 Bacteria 4338
265 Ga0500634_0001650 3300053161 Bacteria 8842
266 Ga0500609_000428 3300053731 Bacteria 6237
267 Ga0466962_0076094 3300061719 Bacteria 1604

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0123104 Ga0495607_0123104_29_826 256
2 3300031251 Ga0265327_10002596 Ga0265327_1000259610 265
3 3300050493 nmdc:mga0k408_54612_c1 nmdc:mga0k408_54612_c1_76_900 266
4 3300014969 Ga0157376_10016971 Ga0157376_100169712 268
5 3300005367 Ga0070667_100257123 Ga0070667_1002571231 270
6 3300025986 Ga0207658_10209892 Ga0207658_102098922 270
7 3300025728 Ga0207655_1002550 Ga0207655_100255012 271
8 3300046471 Ga0495650_0015488 Ga0495650_0015488_2849_3706 271
9 3300046474 Ga0495605_0000016 Ga0495605_0000016_255241_256098 271
10 3300046499 Ga0495594_0002983 Ga0495594_0002983_1814_2671 271
11 3300046506 Ga0495583_0000819 Ga0495583_0000819_2279_3136 271
12 3300046512 Ga0495610_0048563 Ga0495610_0048563_1059_1916 271
13 3300046515 Ga0495620_0002987 Ga0495620_0002987_6615_7472 271
14 3300046524 Ga0495648_0014611 Ga0495648_0014611_2851_3708 271
15 3300046530 Ga0495654_0003411 Ga0495654_0003411_2292_3149 271
16 3300046538 Ga0495609_0002089 Ga0495609_0002089_2392_3249 271
17 3300046542 Ga0495597_0003441 Ga0495597_0003441_1968_2825 271
18 3300046558 Ga0495633_0003972 Ga0495633_0003972_2224_3081 271
19 3300046648 Ga0495611_0011571 Ga0495611_0011571_1853_2710 271
20 3300046665 Ga0495661_0001970 Ga0495661_0001970_6132_6989 271
21 3300046691 Ga0495670_0004697 Ga0495670_0004697_195_1052 271
22 3300046692 Ga0495671_0029901 Ga0495671_0029901_1844_2701 271
23 3300046794 Ga0495589_0002984 Ga0495589_0002984_6439_7296 271
24 3300046810 Ga0495660_0016840 Ga0495660_0016840_491_1348 271
25 3300047323 Ga0495683_0003209 Ga0495683_0003209_2161_3018 271
26 3300047446 Ga0495679_005198 Ga0495679_005198_2090_2947 271
27 3300047470 Ga0495681_0010167 Ga0495681_0010167_2030_2887 271
28 3300048925 Ga0496122_0027700 Ga0496122_0027700_1388_2245 271
29 3300049459 Ga0495678_000508 Ga0495678_000508_2215_3072 271
30 3300028379 Ga0268266_10018292 Ga0268266_100182923 272
31 3300041459 Ga0451800_0516969 Ga0451800_0516969_687_1532 272
32 3300053142 Ga0500577_0000155 Ga0500577_0000155_2459_3379 272
33 3300009147 Ga0114129_10057257 Ga0114129_100572575 276
34 3300046462 Ga0495651_0149829 Ga0495651_0149829_327_1157 276
35 3300046663 Ga0495635_0092343 Ga0495635_0092343_437_1267 276
36 3300050507 nmdc:mga05p37_104111_c1 nmdc:mga05p37_104111_c1_168_1001 276
37 3300050515 nmdc:mga0a205_97685_c1 nmdc:mga0a205_97685_c1_868_1701 276
38 3300049583 Ga0501067_0016579 Ga0501067_0016579_503_1342 277
39 3300006042 Ga0075368_10009610 Ga0075368_100096103 282
40 3300006178 Ga0075367_10000873 Ga0075367_1000087310 282
41 3300006186 Ga0075369_10043729 Ga0075369_100437292 282
42 3300006353 Ga0075370_10058719 Ga0075370_100587192 282
43 3300027866 Ga0209813_10010267 Ga0209813_100102674 282
44 3300048925 Ga0496122_0009062 Ga0496122_0009062_7366_8235 282
45 3300048926 Ga0496123_0001624 Ga0496123_0001624_27095_27964 282
46 3300050495 nmdc:mga04h51_11840_c1 nmdc:mga04h51_11840_c1_82_990 282
47 3300050496 nmdc:mga07m45_10107_c1 nmdc:mga07m45_10107_c1_1341_2249 282
48 3300050516 nmdc:mga0sz30_13683_c1 nmdc:mga0sz30_13683_c1_779_1687 282
49 3300003781 Ga0055536_1000029 Ga0055536_10000294 285
50 3300003781 Ga0055536_1000092 Ga0055536_100009232 285
51 3300003791 Ga0055530_10000363 Ga0055530_100003632 285
52 3300025292 Ga0209676_1000057 Ga0209676_1000057273 285
53 3300025298 Ga0209050_1000096 Ga0209050_1000096170 285
54 3300025303 Ga0209051_1003708 Ga0209051_10037083 285
55 3300035692 Ga0373935_0016295 Ga0373935_0016295_1288_2193 285
56 3300037068 Ga0373925_0064962 Ga0373925_0064962_1728_2633 285
57 3300046471 Ga0495650_0033200 Ga0495650_0033200_818_1732 285
58 3300048929 Ga0496126_0002676 Ga0496126_0002676_17637_18557 285
59 3300005293 Ga0065715_10099681 Ga0065715_100996812 286
60 3300005467 Ga0070706_100341372 Ga0070706_1003413722 286
61 3300005468 Ga0070707_100439277 Ga0070707_1004392771 286
62 3300005471 Ga0070698_100032279 Ga0070698_1000322795 286
63 3300005471 Ga0070698_100655771 Ga0070698_1006557711 286
64 3300005518 Ga0070699_100141295 Ga0070699_1001412951 286
65 3300005536 Ga0070697_100014754 Ga0070697_1000147542 286
66 3300005617 Ga0068859_100763709 Ga0068859_1007637091 286
67 3300006194 Ga0075427_10018532 Ga0075427_100185322 286
68 3300006844 Ga0075428_100413919 Ga0075428_1004139192 286
69 3300006846 Ga0075430_100035181 Ga0075430_1000351813 286
70 3300006847 Ga0075431_100279188 Ga0075431_1002791882 286
71 3300006852 Ga0075433_10029299 Ga0075433_100292993 286
72 3300006852 Ga0075433_10032486 Ga0075433_100324865 286
73 3300006880 Ga0075429_100144867 Ga0075429_1001448673 286
74 3300006931 Ga0097620_100763697 Ga0097620_1007636971 286
75 3300009147 Ga0114129_10046126 Ga0114129_100461266 286
76 3300011119 Ga0105246_10414024 Ga0105246_104140242 286
77 3300025910 Ga0207684_10112349 Ga0207684_101123493 286
78 3300036401 Ga0373937_0015745 Ga0373937_0015745_5705_6589 286
79 3300050507 nmdc:mga05p37_110772_c1 nmdc:mga05p37_110772_c1_1799_2683 286
80 3300050507 nmdc:mga05p37_185990_c1 nmdc:mga05p37_185990_c1_1617_2501 286
81 3300050509 nmdc:mga0qj67_330310_c1 nmdc:mga0qj67_330310_c1_80_964 286
82 3300050515 nmdc:mga0a205_175898_c1 nmdc:mga0a205_175898_c1_634_1518 286
83 3300053125 Ga0500618_000028 Ga0500618_000028_104616_105476 286
84 iso_pu_bacteria 2510917022 2511134240 286
85 iso_pu_bacteria 2510917030 2511198071 286
86 iso_pu_bacteria 2513237088 2513594953 286
87 iso_pu_bacteria 2519899620 2520375389 286
88 iso_pu_bacteria 2524023209 2524458517 286
89 iso_pu_bacteria 2582581298 2585222205 286
90 iso_pu_bacteria 2582581307 2585271729 286
91 iso_pu_bacteria 2582581308 2585279888 286
92 iso_pu_bacteria 2582581315 2585326565 286
93 iso_pu_bacteria 2582581316 2585334089 286
94 iso_pu_bacteria 2585427527 2585531708 286
95 iso_pu_bacteria 2585427529 2585544842 286
96 iso_pu_bacteria 2585427530 2585551345 286
97 iso_pu_bacteria 2585427531 2585563031 286
98 iso_pu_bacteria 2585427608 2585902895 286
99 iso_pu_bacteria 2585427609 2585907246 286
100 iso_pu_bacteria 2585428125 2587982760 286
101 iso_pu_bacteria 2615840626 2616306681 286
102 iso_pu_bacteria 2615840698 2616557537 286
103 iso_pu_bacteria 2617270742 2617386009 286
104 iso_pu_bacteria 2643221643 2644242177 286
105 iso_pu_bacteria 2667528174 2671113434 286
106 iso_pu_bacteria 2718218233 2720618062 286
107 iso_pu_bacteria 2718218235 2720629052 286
108 iso_pu_bacteria 2718218269 2720773126 286
109 iso_pu_bacteria 2721755819 2724093155 286
110 iso_pu_bacteria 2724679232 2725952796 286
111 iso_pu_bacteria 2775507266 2778178670 286
112 iso_pu_bacteria 2791355259 2793316755 286
113 iso_pu_bacteria 2791355263 2793343273 286
114 iso_pu_bacteria 2818991448 2819611280 286
115 iso_pu_bacteria 2818991453 2819638775 286
116 iso_pu_bacteria 2838029111 2838030977 286
117 iso_pu_bacteria 2838042994 2838046611 286
118 iso_pu_bacteria 2842298080 2842300224 286
119 iso_pu_bacteria 2842311132 2842317113 286
120 iso_pu_bacteria 2842357229 2842359135 286
121 iso_pu_bacteria 2842475841 2842477709 286
122 iso_pu_bacteria 2842482326 2842485014 286
123 iso_pu_bacteria 2842502639 2842504419 286
124 iso_pu_bacteria 2842509118 2842511662 286
125 iso_pu_bacteria 2852387548 2852391745 286
126 iso_pu_bacteria 2904578770 2904583646 286
127 iso_pu_bacteria 2919100787 2919102750 286
128 iso_pu_bacteria 2919119836 2919124787 286
129 iso_pu_bacteria 2919408235 2919411109 286
130 iso_pu_bacteria 2936381700 2936384222 286
131 iso_pu_bacteria 3002141150 3002143831 286
132 iso_pu_bacteria 3005416602 3005421579 286
133 iso_pu_bacteria 3005445848 3005451643 286
134 iso_pu_bacteria 8005314921 8005319718 286
135 iso_pu_bacteria 8005484373 8005490341 286
136 iso_pu_bacteria 8005497431 8005502330 286
137 iso_pu_bacteria 8005542996 8005548708 286
138 iso_pu_bacteria 8005619151 8005624664 286
139 iso_pu_bacteria 8005645114 8005646991 286
140 iso_pu_bacteria 8005668836 8005673757 286
141 iso_pu_bacteria 8005682033 8005688145 286
142 iso_pu_bacteria 8018150411 8018151222 286
143 iso_pu_bacteria 8024486573 8024488947 286
144 iso_pu_bacteria 8046767195 8046767271 286
145 iso_pu_bacteria 8054460903 8054465113 286
146 iso_pu_bacteria 8057575449 8057581661 286
147 3300028556 Ga0265337_1006723 Ga0265337_10067234 287
148 3300046460 Ga0495638_0000380 Ga0495638_0000380_45850_46803 287
149 3300046513 Ga0495616_0000117 Ga0495616_0000117_37808_38761 287
150 3300046519 Ga0495632_0001570 Ga0495632_0001570_8459_9412 287
151 3300046522 Ga0495643_0111878 Ga0495643_0111878_138_1091 287
152 3300046616 Ga0495668_0054518 Ga0495668_0054518_652_1605 287
153 3300048924 Ga0496121_0135357 Ga0496121_0135357_699_1607 287
154 3300053100 Ga0500660_110103 Ga0500660_110103_116_1069 287
155 3300053125 Ga0500618_000497 Ga0500618_000497_19723_20634 287
156 3300053731 Ga0500609_000428 Ga0500609_000428_929_1882 287
157 iso_pu_bacteria 2582581280 2585154214 289
158 iso_pu_bacteria 2582581293 2585197833 289
159 iso_pu_bacteria 2643221552 2643781040 289
160 3300001979 JGI24740J21852_10000004 JGI24740J21852_1000000446 290
161 3300002704 JGI25155J39150_1000004 JGI25155J39150_100000449 290
162 3300002705 JGI25156J39149_1000014 JGI25156J39149_1000014131 290
163 3300002737 JGI25162J39368_1000482 JGI25162J39368_100048223 290
164 3300002737 JGI25162J39368_1000526 JGI25162J39368_10005264 290
165 3300002738 JGI25154J39366_1000096 JGI25154J39366_100009659 290
166 3300002739 JGI25158J39367_1000081 JGI25158J39367_10000816 290
167 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005214 290
168 3300002773 JGI25152J39213_1001056 JGI25152J39213_10010567 290
169 3300002987 JGI25159J45721_1001028 JGI25159J45721_10010282 290
170 3300002987 JGI25159J45721_1003346 JGI25159J45721_10033466 290
171 3300003187 JGI25151J46595_10062456 JGI25151J46595_100624562 290
172 3300003214 JGI25165J46597_1000190 JGI25165J46597_100019019 290
173 3300003214 JGI25165J46597_1000328 JGI25165J46597_100032843 290
174 3300003215 JGI25153J46596_10001863 JGI25153J46596_100018637 290
175 3300003316 rootH1_10070844 rootH1_100708442 290
176 3300003320 rootH2_10017677 rootH2_1001767712 290
177 3300003322 rootL2_10002812 rootL2_1000281236 290
178 3300003323 rootH1_10028475 rootH1_100284754 290
179 3300003323 rootH1_10031460 rootH1_100314604 290
180 3300003323 rootH1_10141540 rootH1_101415403 290
181 3300003354 JGI25160J50197_1000108 JGI25160J50197_100010831 290
182 3300003354 JGI25160J50197_1001507 JGI25160J50197_10015077 290
183 3300003374 JGI25161J50226_1000112 JGI25161J50226_100011231 290
184 3300003374 JGI25161J50226_1000304 JGI25161J50226_100030414 290
185 3300003771 Ga0055526_1002344 Ga0055526_10023444 290
186 3300003771 Ga0055526_1002963 Ga0055526_10029639 290
187 3300003771 Ga0055526_1021591 Ga0055526_10215913 290
188 3300003775 Ga0055524_1000769 Ga0055524_100076919 290
189 3300003775 Ga0055524_1006444 Ga0055524_10064445 290
190 3300003790 Ga0055528_1000054 Ga0055528_10000549 290
191 3300003790 Ga0055528_1000083 Ga0055528_100008348 290
192 3300003790 Ga0055528_1002097 Ga0055528_10020975 290
193 3300003792 Ga0055540_1006164 Ga0055540_10061644 290
194 3300004625 Ga0055543_1000080 Ga0055543_100008056 290
195 3300004625 Ga0055543_1000096 Ga0055543_10000968 290
196 3300005262 Ga0065165_1000520 Ga0065165_100052038 290
197 3300005262 Ga0065165_1004702 Ga0065165_10047026 290
198 3300005548 Ga0070665_100142828 Ga0070665_1001428283 290
199 3300005548 Ga0070665_100304390 Ga0070665_1003043903 290
200 3300005578 Ga0068854_100053568 Ga0068854_1000535683 290
201 3300005614 Ga0068856_100011847 Ga0068856_1000118473 290
202 3300005614 Ga0068856_100754938 Ga0068856_1007549382 290
203 3300005843 Ga0068860_100000083 Ga0068860_100000083119 290
204 3300005844 Ga0068862_100329128 Ga0068862_1003291282 290
205 3300006178 Ga0075367_10067525 Ga0075367_100675253 290
206 3300006186 Ga0075369_10067742 Ga0075369_100677423 290
207 3300006353 Ga0075370_10022364 Ga0075370_100223644 290
208 3300009092 Ga0105250_10056800 Ga0105250_100568003 290
209 3300009093 Ga0105240_10000013 Ga0105240_10000013269 290
210 3300009147 Ga0114129_10024390 Ga0114129_1002439010 290
211 3300009545 Ga0105237_10040004 Ga0105237_100400045 290
212 3300009765 Ga0123341_1000781 Ga0123341_10007818 290
213 3300009766 Ga0123342_1018673 Ga0123342_10186733 290
214 3300010375 Ga0105239_10014173 Ga0105239_100141736 290
215 3300013104 Ga0157370_10000548 Ga0157370_1000054834 290
216 3300013105 Ga0157369_10144533 Ga0157369_101445333 290
217 3300014497 Ga0182008_10028114 Ga0182008_100281143 290
218 3300014968 Ga0157379_10167717 Ga0157379_101677172 290
219 3300015262 Ga0182007_10000458 Ga0182007_100004588 290
220 3300025206 Ga0209435_100009 Ga0209435_100009210 290
221 3300025208 Ga0209436_100009 Ga0209436_10000921 290
222 3300025228 Ga0209672_103223 Ga0209672_1032234 290
223 3300025231 Ga0207427_103955 Ga0207427_1039552 290
224 3300025233 Ga0209437_100057 Ga0209437_100057254 290
225 3300025233 Ga0209437_100206 Ga0209437_10020626 290
226 3300025246 Ga0209646_1000018 Ga0209646_1000018210 290
227 3300025250 Ga0209026_1000043 Ga0209026_1000043210 290
228 3300025253 Ga0209677_101737 Ga0209677_1017374 290
229 3300025256 Ga0209759_1000007 Ga0209759_1000007210 290
230 3300025258 Ga0209129_1006526 Ga0209129_10065262 290
231 3300025261 Ga0209233_1000130 Ga0209233_100013056 290
232 3300025261 Ga0209233_1000178 Ga0209233_100017854 290
233 3300025261 Ga0209233_1000256 Ga0209233_100025659 290
234 3300025272 Ga0209455_1009775 Ga0209455_10097752 290
235 3300025273 Ga0209673_1000067 Ga0209673_1000067223 290
236 3300025273 Ga0209673_1000086 Ga0209673_1000086167 290
237 3300025273 Ga0209673_1001363 Ga0209673_100136312 290
238 3300025284 Ga0209130_1000031 Ga0209130_1000031224 290
239 3300025284 Ga0209130_1000108 Ga0209130_100010876 290
240 3300025294 Ga0209025_1002308 Ga0209025_100230817 290
241 3300025295 Ga0209564_1000092 Ga0209564_1000092223 290
242 3300025295 Ga0209564_1000952 Ga0209564_10009527 290
243 3300025295 Ga0209564_1021123 Ga0209564_10211232 290
244 3300025297 Ga0209758_1004432 Ga0209758_10044328 290
245 3300025297 Ga0209758_1004917 Ga0209758_10049176 290
246 3300025297 Ga0209758_1045244 Ga0209758_10452441 290
247 3300025299 Ga0209256_1000788 Ga0209256_100078831 290
248 3300025299 Ga0209256_1004712 Ga0209256_10047125 290
249 3300025302 Ga0207426_1000042 Ga0207426_1000042186 290
250 3300025302 Ga0207426_1000082 Ga0207426_1000082221 290
251 3300025913 Ga0207695_10000044 Ga0207695_10000044227 290
252 3300025914 Ga0207671_10003650 Ga0207671_1000365013 290
253 3300025924 Ga0207694_10006739 Ga0207694_100067394 290
254 3300025981 Ga0207640_10145918 Ga0207640_101459182 290
255 3300026078 Ga0207702_10023861 Ga0207702_100238613 290
256 3300027312 Ga0209371_1002468 Ga0209371_10024684 290
257 3300028379 Ga0268266_10027899 Ga0268266_100278996 290
258 3300028380 Ga0268265_10315442 Ga0268265_103154422 290
259 3300028381 Ga0268264_10000055 Ga0268264_10000055253 290
260 3300030500 Ga0268256_1003511 Ga0268256_10035116 290
261 3300030521 Ga0307511_10016515 Ga0307511_100165157 290
262 3300031456 Ga0307513_10038504 Ga0307513_100385041 290
263 3300031456 Ga0307513_10412771 Ga0307513_104127712 290
264 3300033180 Ga0307510_10008361 Ga0307510_100083616 290
265 3300041496 Ga0451839_0023546 Ga0451839_0023546_522_1394 290
266 3300041503 Ga0451847_0519890 Ga0451847_0519890_3763_4635 290
267 3300041507 Ga0451851_0391774 Ga0451851_0391774_1314_2186 290
268 3300041509 Ga0451843_0727982 Ga0451843_0727982_2251_3123 290
269 3300044765 Ga0466970_0014846 Ga0466970_0014846_1537_2409 290
270 3300046459 Ga0495629_0011394 Ga0495629_0011394_1704_2576 290
271 3300046460 Ga0495638_0000079 Ga0495638_0000079_122549_123466 290
272 3300046460 Ga0495638_0000143 Ga0495638_0000143_39606_40478 290
273 3300046476 Ga0495662_0016909 Ga0495662_0016909_2108_2980 290
274 3300046506 Ga0495583_0000037 Ga0495583_0000037_3886_4824 290
275 3300046506 Ga0495583_0000234 Ga0495583_0000234_90418_91353 290
276 3300046507 Ga0495606_0236756 Ga0495606_0236756_66_941 290
277 3300046518 Ga0495631_0033674 Ga0495631_0033674_1195_2067 290
278 3300046520 Ga0495637_0005840 Ga0495637_0005840_549_1469 290
279 3300046522 Ga0495643_0001728 Ga0495643_0001728_16495_17370 290
280 3300046542 Ga0495597_0061925 Ga0495597_0061925_637_1512 290
281 3300046557 Ga0495622_0037948 Ga0495622_0037948_1035_1907 290
282 3300046558 Ga0495633_0049553 Ga0495633_0049553_124_999 290
283 3300046616 Ga0495668_0134267 Ga0495668_0134267_384_1304 290
284 3300046675 Ga0495657_0045898 Ga0495657_0045898_1951_2823 290
285 3300046684 Ga0495669_0000006 Ga0495669_0000006_84640_85557 290
286 3300046684 Ga0495669_0000577 Ga0495669_0000577_1575_2495 290
287 3300047317 Ga0495604_0157982 Ga0495604_0157982_462_1334 290
288 3300047320 Ga0495672_0004601 Ga0495672_0004601_7667_8539 290
289 3300047320 Ga0495672_0026551 Ga0495672_0026551_881_1798 290
290 3300047443 Ga0495687_081322 Ga0495687_081322_230_1105 290
291 3300047470 Ga0495681_0036995 Ga0495681_0036995_86_1021 290
292 3300047472 Ga0495686_0005997 Ga0495686_0005997_6385_7305 290
293 3300048909 Ga0496106_0000109 Ga0496106_0000109_36925_37797 290
294 3300048909 Ga0496106_0016469 Ga0496106_0016469_3753_4688 290
295 3300048910 Ga0496107_0000086 Ga0496107_0000086_3533_4468 290
296 3300048920 Ga0496117_0001113 Ga0496117_0001113_19493_20365 290
297 3300048920 Ga0496117_0107487 Ga0496117_0107487_639_1514 290
298 3300048921 Ga0496118_0001953 Ga0496118_0001953_1649_2521 290
299 3300048921 Ga0496118_0002207 Ga0496118_0002207_2714_3586 290
300 3300048922 Ga0496119_0017106 Ga0496119_0017106_3036_3908 290
301 3300048922 Ga0496119_0026229 Ga0496119_0026229_1951_2823 290
302 3300048923 Ga0496120_0008671 Ga0496120_0008671_1751_2623 290
303 3300048924 Ga0496121_0001285 Ga0496121_0001285_2654_3589 290
304 3300048924 Ga0496121_0003282 Ga0496121_0003282_20379_21251 290
305 3300048924 Ga0496121_0005792 Ga0496121_0005792_7609_8484 290
306 3300048924 Ga0496121_0051523 Ga0496121_0051523_1926_2801 290
307 3300048924 Ga0496121_0094913 Ga0496121_0094913_41_916 290
308 3300048925 Ga0496122_0000137 Ga0496122_0000137_114935_115807 290
309 3300048925 Ga0496122_0235429 Ga0496122_0235429_60_935 290
310 3300048926 Ga0496123_0000022 Ga0496123_0000022_52733_53605 290
311 3300048926 Ga0496123_0057103 Ga0496123_0057103_1389_2264 290
312 3300048927 Ga0496124_0000715 Ga0496124_0000715_38958_39830 290
313 3300048927 Ga0496124_0021779 Ga0496124_0021779_3488_4360 290
314 3300048927 Ga0496124_0028471 Ga0496124_0028471_1761_2633 290
315 3300050494 nmdc:mga06z11_51713_c1 nmdc:mga06z11_51713_c1_1122_1994 290
316 3300053079 Ga0500610_0082254 Ga0500610_0082254_429_1301 290
317 3300053085 Ga0495619_0214182 Ga0495619_0214182_129_1001 290
318 3300053086 Ga0500578_0015853 Ga0500578_0015853_654_1529 290
319 3300053087 Ga0500643_026052 Ga0500643_026052_568_1494 290
320 3300053090 Ga0500646_0072777 Ga0500646_0072777_116_988 290
321 3300053102 Ga0500554_001979 Ga0500554_001979_623_1543 290
322 3300053109 Ga0500569_004599 Ga0500569_004599_367_1239 290
323 3300053118 Ga0500594_0001980 Ga0500594_0001980_581_1453 290
324 3300053125 Ga0500618_000053 Ga0500618_000053_98509_99444 290
325 3300053136 Ga0500559_0000005 Ga0500559_0000005_94583_95503 290
326 3300053139 Ga0500568_0000074 Ga0500568_0000074_19965_20837 290
327 3300053139 Ga0500568_0000307 Ga0500568_0000307_1705_2577 290
328 3300053151 Ga0500604_0009098 Ga0500604_0009098_1116_1988 290
329 3300053153 Ga0500616_0001534 Ga0500616_0001534_4399_5274 290
330 3300053156 Ga0500622_0003453 Ga0500622_0003453_2016_2891 290
331 3300053156 Ga0500622_0013879 Ga0500622_0013879_755_1675 290
332 3300053161 Ga0500634_0001650 Ga0500634_0001650_4692_5567 290
333 3300061719 Ga0466962_0076094 Ga0466962_0076094_233_1105 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

51

289

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.6908 7 249
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.6734 6 249
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.5892 7 249
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.5794 6 249
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.4111 4 278
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6132 19 270 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5758 19 270 3.30.40.10
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3534 9 168 1.20.120.1760
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.35 5 186 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.3411 5 186 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2V7YL53-F1-model_v4 Fatty acid desaturase 0.9923 1 278 GO:0016020
GO:0042284
GO:0046513
AF-A0A2V5T3R0-F1-model_v4 Fatty acid desaturase 0.9922 1 279 GO:0016020
GO:0042284
GO:0046513
AF-A0A2R7QY42-F1-model_v4 deleted 0.9918 184 277
AF-A0A2W5YJD6-F1-model_v4 Fatty acid desaturase 0.9904 1 279 GO:0016020
GO:0042284
GO:0046513
AF-A0A5C1W8Y5-F1-model_v4 Fatty acid desaturase 0.9902 1 283 GO:0006629
GO:0016020

Feature Viewer

pLDDT pTM Quality
93.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map