F411490
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 260 | 267 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0000234|Ga0495583_0000234_90418_91353 |
| Length | 311 |
| Sequence | MTPRDVRLPNFRLPKRTKGLMAWTWWDLIPVAAAVAHLAFVVWIVVGSANRPWWGQLLCGFGYALAISWNVNGVSHNFLHTPYFRSKALNRAFSLLESLAIGFSQTFYTWVHLRHHEGNSDRPGPDGETRDWLSIYRHGKDGQPENVWSYVFLGFFRDSGGSVYQALKARGRDADARWGRIEIAAVAAFAIGMAVIDWRAVLFLLPFYYLGECLSQLNGYYEHFNGDPETPIAWGVSSYDPVYNVTWFNNGHHAEHHFRPAVHWTQLPALRRALVEQQAAQGVHVIGPAHALGFLARANRRPRDAERAVRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 2 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 3 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 4 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 5 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 6 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 7 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 8 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 9 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 10 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 11 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 12 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 13 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 14 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 15 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 16 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 17 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 18 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 19 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 20 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 21 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 22 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 23 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 24 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 25 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 26 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 27 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 28 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 29 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 30 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 31 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 32 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 33 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 34 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 35 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 36 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 37 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 38 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 39 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 40 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 41 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 42 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 43 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 44 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 45 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 46 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 47 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 48 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 49 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 50 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 51 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 52 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 53 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 54 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 55 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 56 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 57 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 58 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 59 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 60 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 61 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 62 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 65 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 66 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 67 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 68 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 69 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 70 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 72 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 78 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 109 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 164 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 165 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 166 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 167 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 222 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 224 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 232 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 233 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 234 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 235 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 236 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 237 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 238 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 240 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 245 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 246 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 247 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 248 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 249 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 250 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 251 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 252 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 253 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 254 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 255 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 256 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 257 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 258 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 259 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 260 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.18 |
| Metatranscriptomes | 0 |
| Isolates | 19.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.23 |
| Nodule | 8.11 |
| Rhizoplane | 1.5 |
| Rhizosphere | 42.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000004 | 3300001979 | Bacteria | 91019 |
| 2 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 3 | JGI25156J39149_1000014 | 3300002705 | Bacteria | 189257 |
| 4 | JGI25162J39368_1000482 | 3300002737 | Bacteria | 30484 |
| 5 | JGI25162J39368_1000526 | 3300002737 | Bacteria | 28526 |
| 6 | JGI25154J39366_1000096 | 3300002738 | Bacteria | 79168 |
| 7 | JGI25158J39367_1000081 | 3300002739 | Bacteria | 22110 |
| 8 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 9 | JGI25152J39213_1001056 | 3300002773 | Bacteria | 13075 |
| 10 | JGI25159J45721_1001028 | 3300002987 | Bacteria | 11987 |
| 11 | JGI25159J45721_1003346 | 3300002987 | Bacteria | 5718 |
| 12 | JGI25151J46595_10062456 | 3300003187 | Bacteria | 1178 |
| 13 | JGI25165J46597_1000190 | 3300003214 | Bacteria | 91363 |
| 14 | JGI25165J46597_1000328 | 3300003214 | Bacteria | 56610 |
| 15 | JGI25153J46596_10001863 | 3300003215 | Bacteria | 12494 |
| 16 | rootH1_10070844 | 3300003316 | Bacteria | 4162 |
| 17 | rootH2_10017677 | 3300003320 | Bacteria | 13034 |
| 18 | rootL2_10002812 | 3300003322 | Bacteria | 40354 |
| 19 | rootH1_10028475 | 3300003323 | Bacteria | 8871 |
| 20 | rootH1_10031460 | 3300003323 | Bacteria | 7779 |
| 21 | rootH1_10141540 | 3300003323 | Bacteria | 2722 |
| 22 | JGI25160J50197_1000108 | 3300003354 | Bacteria | 77944 |
| 23 | JGI25160J50197_1001507 | 3300003354 | Bacteria | 11576 |
| 24 | JGI25161J50226_1000112 | 3300003374 | Bacteria | 63152 |
| 25 | JGI25161J50226_1000304 | 3300003374 | Bacteria | 27435 |
| 26 | Ga0055526_1002344 | 3300003771 | Bacteria | 12864 |
| 27 | Ga0055526_1002963 | 3300003771 | Bacteria | 11126 |
| 28 | Ga0055526_1021591 | 3300003771 | Bacteria | 2232 |
| 29 | Ga0055524_1000769 | 3300003775 | Bacteria | 21606 |
| 30 | Ga0055524_1006444 | 3300003775 | Bacteria | 5088 |
| 31 | Ga0055536_1000029 | 3300003781 | Bacteria | 157375 |
| 32 | Ga0055536_1000092 | 3300003781 | Bacteria | 77375 |
| 33 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 34 | Ga0055528_1000083 | 3300003790 | Bacteria | 74840 |
| 35 | Ga0055528_1002097 | 3300003790 | Bacteria | 11052 |
| 36 | Ga0055530_10000363 | 3300003791 | Bacteria | 41018 |
| 37 | Ga0055540_1006164 | 3300003792 | Bacteria | 4822 |
| 38 | Ga0055543_1000080 | 3300004625 | Bacteria | 84865 |
| 39 | Ga0055543_1000096 | 3300004625 | Bacteria | 75972 |
| 40 | Ga0065165_1000520 | 3300005262 | Bacteria | 58925 |
| 41 | Ga0065165_1004702 | 3300005262 | Bacteria | 8208 |
| 42 | Ga0065715_10099681 | 3300005293 | Bacteria | 3382 |
| 43 | Ga0070667_100257123 | 3300005367 | Bacteria | 1563 |
| 44 | Ga0070706_100341372 | 3300005467 | Unclassified | 1396 |
| 45 | Ga0070707_100439277 | 3300005468 | Unclassified | 1265 |
| 46 | Ga0070698_100032279 | 3300005471 | Bacteria | 5425 |
| 47 | Ga0070698_100655771 | 3300005471 | Bacteria | 991 |
| 48 | Ga0070699_100141295 | 3300005518 | Unclassified | 2126 |
| 49 | Ga0070697_100014754 | 3300005536 | Bacteria | 6133 |
| 50 | Ga0070665_100142828 | 3300005548 | Bacteria | 2397 |
| 51 | Ga0070665_100304390 | 3300005548 | Bacteria | 1597 |
| 52 | Ga0068854_100053568 | 3300005578 | Bacteria | 2898 |
| 53 | Ga0068856_100011847 | 3300005614 | Bacteria | 8449 |
| 54 | Ga0068856_100754938 | 3300005614 | Bacteria | 993 |
| 55 | Ga0068859_100763709 | 3300005617 | Bacteria | 1055 |
| 56 | Ga0068860_100000083 | 3300005843 | Bacteria | 168189 |
| 57 | Ga0068862_100329128 | 3300005844 | Bacteria | 1412 |
| 58 | Ga0075368_10009610 | 3300006042 | Bacteria | 3481 |
| 59 | Ga0075367_10000873 | 3300006178 | Bacteria | 12073 |
| 60 | Ga0075367_10067525 | 3300006178 | Bacteria | 2144 |
| 61 | Ga0075369_10043729 | 3300006186 | Bacteria | 1923 |
| 62 | Ga0075369_10067742 | 3300006186 | Bacteria | 1568 |
| 63 | Ga0075427_10018532 | 3300006194 | Bacteria | 1093 |
| 64 | Ga0075370_10022364 | 3300006353 | Bacteria | 3471 |
| 65 | Ga0075370_10058719 | 3300006353 | Bacteria | 2188 |
| 66 | Ga0075428_100413919 | 3300006844 | Bacteria | 1444 |
| 67 | Ga0075430_100035181 | 3300006846 | Bacteria | 4250 |
| 68 | Ga0075431_100279188 | 3300006847 | Bacteria | 1691 |
| 69 | Ga0075433_10029299 | 3300006852 | Bacteria | 4688 |
| 70 | Ga0075433_10032486 | 3300006852 | Bacteria | 4471 |
| 71 | Ga0075429_100144867 | 3300006880 | Bacteria | 2079 |
| 72 | Ga0097620_100763697 | 3300006931 | Bacteria | 1055 |
| 73 | Ga0105250_10056800 | 3300009092 | Bacteria | 1570 |
| 74 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 75 | Ga0114129_10024390 | 3300009147 | Bacteria | 8570 |
| 76 | Ga0114129_10046126 | 3300009147 | Bacteria | 6125 |
| 77 | Ga0114129_10057257 | 3300009147 | Bacteria | 5456 |
| 78 | Ga0105237_10040004 | 3300009545 | Bacteria | 4730 |
| 79 | Ga0123341_1000781 | 3300009765 | Bacteria | 21631 |
| 80 | Ga0123342_1018673 | 3300009766 | Bacteria | 5460 |
| 81 | Ga0105239_10014173 | 3300010375 | Bacteria | 8845 |
| 82 | Ga0105246_10414024 | 3300011119 | Bacteria | 1123 |
| 83 | Ga0157370_10000548 | 3300013104 | Bacteria | 46830 |
| 84 | Ga0157369_10144533 | 3300013105 | Bacteria | 2515 |
| 85 | Ga0182008_10028114 | 3300014497 | Bacteria | 2844 |
| 86 | Ga0157379_10167717 | 3300014968 | Bacteria | 1982 |
| 87 | Ga0157376_10016971 | 3300014969 | Bacteria | 5543 |
| 88 | Ga0182007_10000458 | 3300015262 | Bacteria | 24641 |
| 89 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 90 | Ga0209436_100009 | 3300025208 | Bacteria | 143684 |
| 91 | Ga0209672_103223 | 3300025228 | Bacteria | 3473 |
| 92 | Ga0207427_103955 | 3300025231 | Bacteria | 2732 |
| 93 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 94 | Ga0209437_100206 | 3300025233 | Bacteria | 115048 |
| 95 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 96 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 97 | Ga0209677_101737 | 3300025253 | Bacteria | 9076 |
| 98 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 99 | Ga0209129_1006526 | 3300025258 | Bacteria | 3740 |
| 100 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 101 | Ga0209233_1000178 | 3300025261 | Bacteria | 140956 |
| 102 | Ga0209233_1000256 | 3300025261 | Bacteria | 80855 |
| 103 | Ga0209455_1009775 | 3300025272 | Bacteria | 2491 |
| 104 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 105 | Ga0209673_1000086 | 3300025273 | Bacteria | 210101 |
| 106 | Ga0209673_1001363 | 3300025273 | Bacteria | 24193 |
| 107 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 108 | Ga0209130_1000108 | 3300025284 | Bacteria | 133733 |
| 109 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 110 | Ga0209025_1002308 | 3300025294 | Bacteria | 20678 |
| 111 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 112 | Ga0209564_1000952 | 3300025295 | Bacteria | 37023 |
| 113 | Ga0209564_1021123 | 3300025295 | Bacteria | 2355 |
| 114 | Ga0209758_1004432 | 3300025297 | Bacteria | 11696 |
| 115 | Ga0209758_1004917 | 3300025297 | Bacteria | 10742 |
| 116 | Ga0209758_1045244 | 3300025297 | Bacteria | 1600 |
| 117 | Ga0209050_1000096 | 3300025298 | Bacteria | 240109 |
| 118 | Ga0209256_1000788 | 3300025299 | Bacteria | 40932 |
| 119 | Ga0209256_1004712 | 3300025299 | Bacteria | 8356 |
| 120 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 121 | Ga0207426_1000082 | 3300025302 | Bacteria | 298939 |
| 122 | Ga0209051_1003708 | 3300025303 | Bacteria | 9855 |
| 123 | Ga0207655_1002550 | 3300025728 | Bacteria | 14580 |
| 124 | Ga0207684_10112349 | 3300025910 | Unclassified | 2332 |
| 125 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 126 | Ga0207671_10003650 | 3300025914 | Bacteria | 15204 |
| 127 | Ga0207694_10006739 | 3300025924 | Bacteria | 8725 |
| 128 | Ga0207640_10145918 | 3300025981 | Bacteria | 1731 |
| 129 | Ga0207658_10209892 | 3300025986 | Bacteria | 1631 |
| 130 | Ga0207702_10023861 | 3300026078 | Bacteria | 5074 |
| 131 | Ga0209371_1002468 | 3300027312 | Bacteria | 10298 |
| 132 | Ga0209813_10010267 | 3300027866 | Bacteria | 2417 |
| 133 | Ga0268266_10018292 | 3300028379 | Bacteria | 5975 |
| 134 | Ga0268266_10027899 | 3300028379 | Bacteria | 4801 |
| 135 | Ga0268265_10315442 | 3300028380 | Bacteria | 1413 |
| 136 | Ga0268264_10000055 | 3300028381 | Bacteria | 314947 |
| 137 | Ga0265337_1006723 | 3300028556 | Bacteria | 4386 |
| 138 | Ga0268256_1003511 | 3300030500 | Bacteria | 7038 |
| 139 | Ga0307511_10016515 | 3300030521 | Bacteria | 7109 |
| 140 | Ga0265327_10002596 | 3300031251 | Bacteria | 18697 |
| 141 | Ga0307513_10038504 | 3300031456 | Bacteria | 5308 |
| 142 | Ga0307513_10412771 | 3300031456 | Bacteria | 1082 |
| 143 | Ga0307510_10008361 | 3300033180 | Bacteria | 12331 |
| 144 | Ga0373935_0016295 | 3300035692 | Bacteria | 4498 |
| 145 | Ga0373937_0015745 | 3300036401 | Bacteria | 6698 |
| 146 | Ga0373925_0064962 | 3300037068 | Bacteria | 2748 |
| 147 | Ga0451800_0516969 | 3300041459 | Bacteria | 1710 |
| 148 | Ga0451839_0023546 | 3300041496 | Bacteria | 2966 |
| 149 | Ga0451847_0519890 | 3300041503 | Bacteria | 5200 |
| 150 | Ga0451851_0391774 | 3300041507 | Bacteria | 3019 |
| 151 | Ga0451843_0727982 | 3300041509 | Bacteria | 4485 |
| 152 | Ga0466970_0014846 | 3300044765 | Bacteria | 4003 |
| 153 | Ga0495629_0011394 | 3300046459 | Bacteria | 6458 |
| 154 | Ga0495638_0000079 | 3300046460 | Bacteria | 157488 |
| 155 | Ga0495638_0000143 | 3300046460 | Bacteria | 113640 |
| 156 | Ga0495638_0000380 | 3300046460 | Bacteria | 55127 |
| 157 | Ga0495651_0149829 | 3300046462 | Bacteria | 1683 |
| 158 | Ga0495650_0015488 | 3300046471 | Bacteria | 3907 |
| 159 | Ga0495650_0033200 | 3300046471 | Bacteria | 2299 |
| 160 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 161 | Ga0495662_0016909 | 3300046476 | Bacteria | 3529 |
| 162 | Ga0495594_0002983 | 3300046499 | Bacteria | 8776 |
| 163 | Ga0495607_0123104 | 3300046501 | Bacteria | 1359 |
| 164 | Ga0495583_0000037 | 3300046506 | Bacteria | 244437 |
| 165 | Ga0495583_0000234 | 3300046506 | Bacteria | 92118 |
| 166 | Ga0495583_0000819 | 3300046506 | Bacteria | 38035 |
| 167 | Ga0495606_0236756 | 3300046507 | Bacteria | 1020 |
| 168 | Ga0495610_0048563 | 3300046512 | Bacteria | 2082 |
| 169 | Ga0495616_0000117 | 3300046513 | Bacteria | 70162 |
| 170 | Ga0495620_0002987 | 3300046515 | Bacteria | 9732 |
| 171 | Ga0495631_0033674 | 3300046518 | Bacteria | 2300 |
| 172 | Ga0495632_0001570 | 3300046519 | Bacteria | 18850 |
| 173 | Ga0495637_0005840 | 3300046520 | Bacteria | 6228 |
| 174 | Ga0495643_0001728 | 3300046522 | Bacteria | 18884 |
| 175 | Ga0495643_0111878 | 3300046522 | Unclassified | 1388 |
| 176 | Ga0495648_0014611 | 3300046524 | Bacteria | 5737 |
| 177 | Ga0495654_0003411 | 3300046530 | Bacteria | 9754 |
| 178 | Ga0495609_0002089 | 3300046538 | Bacteria | 12552 |
| 179 | Ga0495597_0003441 | 3300046542 | Bacteria | 9235 |
| 180 | Ga0495597_0061925 | 3300046542 | Bacteria | 1629 |
| 181 | Ga0495622_0037948 | 3300046557 | Bacteria | 2243 |
| 182 | Ga0495633_0003972 | 3300046558 | Bacteria | 9601 |
| 183 | Ga0495633_0049553 | 3300046558 | Bacteria | 1982 |
| 184 | Ga0495668_0054518 | 3300046616 | Bacteria | 2209 |
| 185 | Ga0495668_0134267 | 3300046616 | Bacteria | 1354 |
| 186 | Ga0495611_0011571 | 3300046648 | Bacteria | 3742 |
| 187 | Ga0495635_0092343 | 3300046663 | Bacteria | 2070 |
| 188 | Ga0495661_0001970 | 3300046665 | Bacteria | 16269 |
| 189 | Ga0495657_0045898 | 3300046675 | Bacteria | 2962 |
| 190 | Ga0495669_0000006 | 3300046684 | Bacteria | 190838 |
| 191 | Ga0495669_0000577 | 3300046684 | Bacteria | 16281 |
| 192 | Ga0495670_0004697 | 3300046691 | Bacteria | 6703 |
| 193 | Ga0495671_0029901 | 3300046692 | Bacteria | 2793 |
| 194 | Ga0495589_0002984 | 3300046794 | Bacteria | 9323 |
| 195 | Ga0495660_0016840 | 3300046810 | Bacteria | 4211 |
| 196 | Ga0495604_0157982 | 3300047317 | Bacteria | 1604 |
| 197 | Ga0495672_0004601 | 3300047320 | Bacteria | 11208 |
| 198 | Ga0495672_0026551 | 3300047320 | Bacteria | 3693 |
| 199 | Ga0495683_0003209 | 3300047323 | Bacteria | 9557 |
| 200 | Ga0495687_081322 | 3300047443 | Bacteria | 1268 |
| 201 | Ga0495679_005198 | 3300047446 | Bacteria | 5817 |
| 202 | Ga0495681_0010167 | 3300047470 | Bacteria | 5720 |
| 203 | Ga0495681_0036995 | 3300047470 | Bacteria | 2409 |
| 204 | Ga0495686_0005997 | 3300047472 | Bacteria | 9449 |
| 205 | Ga0496106_0000109 | 3300048909 | Bacteria | 64454 |
| 206 | Ga0496106_0016469 | 3300048909 | Bacteria | 5470 |
| 207 | Ga0496107_0000086 | 3300048910 | Bacteria | 44285 |
| 208 | Ga0496117_0001113 | 3300048920 | Bacteria | 40547 |
| 209 | Ga0496117_0107487 | 3300048920 | Bacteria | 1747 |
| 210 | Ga0496118_0001953 | 3300048921 | Bacteria | 29213 |
| 211 | Ga0496118_0002207 | 3300048921 | Bacteria | 27019 |
| 212 | Ga0496119_0017106 | 3300048922 | Bacteria | 5479 |
| 213 | Ga0496119_0026229 | 3300048922 | Bacteria | 4044 |
| 214 | Ga0496120_0008671 | 3300048923 | Bacteria | 7334 |
| 215 | Ga0496121_0001285 | 3300048924 | Bacteria | 43232 |
| 216 | Ga0496121_0003282 | 3300048924 | Bacteria | 23219 |
| 217 | Ga0496121_0005792 | 3300048924 | Bacteria | 15683 |
| 218 | Ga0496121_0051523 | 3300048924 | Bacteria | 3465 |
| 219 | Ga0496121_0094913 | 3300048924 | Bacteria | 2319 |
| 220 | Ga0496121_0135357 | 3300048924 | Bacteria | 1837 |
| 221 | Ga0496122_0000137 | 3300048925 | Bacteria | 170016 |
| 222 | Ga0496122_0009062 | 3300048925 | Bacteria | 10561 |
| 223 | Ga0496122_0027700 | 3300048925 | Bacteria | 4834 |
| 224 | Ga0496122_0235429 | 3300048925 | Bacteria | 1037 |
| 225 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 226 | Ga0496123_0001624 | 3300048926 | Bacteria | 30272 |
| 227 | Ga0496123_0057103 | 3300048926 | Bacteria | 2544 |
| 228 | Ga0496124_0000715 | 3300048927 | Bacteria | 54340 |
| 229 | Ga0496124_0021779 | 3300048927 | Bacteria | 5896 |
| 230 | Ga0496124_0028471 | 3300048927 | Bacteria | 4998 |
| 231 | Ga0496126_0002676 | 3300048929 | Bacteria | 23569 |
| 232 | Ga0495678_000508 | 3300049459 | Bacteria | 37991 |
| 233 | Ga0501067_0016579 | 3300049583 | Unclassified | 4072 |
| 234 | nmdc:mga0k408_54612_c1 | 3300050493 | Bacteria | 2315 |
| 235 | nmdc:mga06z11_51713_c1 | 3300050494 | Bacteria | 2105 |
| 236 | nmdc:mga04h51_11840_c1 | 3300050495 | Bacteria | 2433 |
| 237 | nmdc:mga07m45_10107_c1 | 3300050496 | Bacteria | 4917 |
| 238 | nmdc:mga05p37_104111_c1 | 3300050507 | Bacteria | 3492 |
| 239 | nmdc:mga05p37_110772_c1 | 3300050507 | Bacteria | 3377 |
| 240 | nmdc:mga05p37_185990_c1 | 3300050507 | Bacteria | 2526 |
| 241 | nmdc:mga0qj67_330310_c1 | 3300050509 | Bacteria | 1234 |
| 242 | nmdc:mga0a205_175898_c1 | 3300050515 | Bacteria | 2036 |
| 243 | nmdc:mga0a205_97685_c1 | 3300050515 | Bacteria | 2836 |
| 244 | nmdc:mga0sz30_13683_c1 | 3300050516 | Bacteria | 1994 |
| 245 | Ga0500610_0082254 | 3300053079 | Bacteria | 1678 |
| 246 | Ga0495619_0214182 | 3300053085 | Bacteria | 1334 |
| 247 | Ga0500578_0015853 | 3300053086 | Bacteria | 4838 |
| 248 | Ga0500643_026052 | 3300053087 | Bacteria | 1836 |
| 249 | Ga0500646_0072777 | 3300053090 | Bacteria | 1034 |
| 250 | Ga0500660_110103 | 3300053100 | Bacteria | 1177 |
| 251 | Ga0500554_001979 | 3300053102 | Bacteria | 3976 |
| 252 | Ga0500569_004599 | 3300053109 | Bacteria | 2911 |
| 253 | Ga0500594_0001980 | 3300053118 | Bacteria | 4430 |
| 254 | Ga0500618_000028 | 3300053125 | Bacteria | 140440 |
| 255 | Ga0500618_000053 | 3300053125 | Bacteria | 101079 |
| 256 | Ga0500618_000497 | 3300053125 | Bacteria | 25239 |
| 257 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 258 | Ga0500568_0000074 | 3300053139 | Bacteria | 94957 |
| 259 | Ga0500568_0000307 | 3300053139 | Bacteria | 39094 |
| 260 | Ga0500577_0000155 | 3300053142 | Bacteria | 17094 |
| 261 | Ga0500604_0009098 | 3300053151 | Bacteria | 2643 |
| 262 | Ga0500616_0001534 | 3300053153 | Bacteria | 21730 |
| 263 | Ga0500622_0003453 | 3300053156 | Bacteria | 10540 |
| 264 | Ga0500622_0013879 | 3300053156 | Bacteria | 4338 |
| 265 | Ga0500634_0001650 | 3300053161 | Bacteria | 8842 |
| 266 | Ga0500609_000428 | 3300053731 | Bacteria | 6237 |
| 267 | Ga0466962_0076094 | 3300061719 | Bacteria | 1604 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046501 | Ga0495607_0123104 | Ga0495607_0123104_29_826 | 256 |
| 2 | 3300031251 | Ga0265327_10002596 | Ga0265327_1000259610 | 265 |
| 3 | 3300050493 | nmdc:mga0k408_54612_c1 | nmdc:mga0k408_54612_c1_76_900 | 266 |
| 4 | 3300014969 | Ga0157376_10016971 | Ga0157376_100169712 | 268 |
| 5 | 3300005367 | Ga0070667_100257123 | Ga0070667_1002571231 | 270 |
| 6 | 3300025986 | Ga0207658_10209892 | Ga0207658_102098922 | 270 |
| 7 | 3300025728 | Ga0207655_1002550 | Ga0207655_100255012 | 271 |
| 8 | 3300046471 | Ga0495650_0015488 | Ga0495650_0015488_2849_3706 | 271 |
| 9 | 3300046474 | Ga0495605_0000016 | Ga0495605_0000016_255241_256098 | 271 |
| 10 | 3300046499 | Ga0495594_0002983 | Ga0495594_0002983_1814_2671 | 271 |
| 11 | 3300046506 | Ga0495583_0000819 | Ga0495583_0000819_2279_3136 | 271 |
| 12 | 3300046512 | Ga0495610_0048563 | Ga0495610_0048563_1059_1916 | 271 |
| 13 | 3300046515 | Ga0495620_0002987 | Ga0495620_0002987_6615_7472 | 271 |
| 14 | 3300046524 | Ga0495648_0014611 | Ga0495648_0014611_2851_3708 | 271 |
| 15 | 3300046530 | Ga0495654_0003411 | Ga0495654_0003411_2292_3149 | 271 |
| 16 | 3300046538 | Ga0495609_0002089 | Ga0495609_0002089_2392_3249 | 271 |
| 17 | 3300046542 | Ga0495597_0003441 | Ga0495597_0003441_1968_2825 | 271 |
| 18 | 3300046558 | Ga0495633_0003972 | Ga0495633_0003972_2224_3081 | 271 |
| 19 | 3300046648 | Ga0495611_0011571 | Ga0495611_0011571_1853_2710 | 271 |
| 20 | 3300046665 | Ga0495661_0001970 | Ga0495661_0001970_6132_6989 | 271 |
| 21 | 3300046691 | Ga0495670_0004697 | Ga0495670_0004697_195_1052 | 271 |
| 22 | 3300046692 | Ga0495671_0029901 | Ga0495671_0029901_1844_2701 | 271 |
| 23 | 3300046794 | Ga0495589_0002984 | Ga0495589_0002984_6439_7296 | 271 |
| 24 | 3300046810 | Ga0495660_0016840 | Ga0495660_0016840_491_1348 | 271 |
| 25 | 3300047323 | Ga0495683_0003209 | Ga0495683_0003209_2161_3018 | 271 |
| 26 | 3300047446 | Ga0495679_005198 | Ga0495679_005198_2090_2947 | 271 |
| 27 | 3300047470 | Ga0495681_0010167 | Ga0495681_0010167_2030_2887 | 271 |
| 28 | 3300048925 | Ga0496122_0027700 | Ga0496122_0027700_1388_2245 | 271 |
| 29 | 3300049459 | Ga0495678_000508 | Ga0495678_000508_2215_3072 | 271 |
| 30 | 3300028379 | Ga0268266_10018292 | Ga0268266_100182923 | 272 |
| 31 | 3300041459 | Ga0451800_0516969 | Ga0451800_0516969_687_1532 | 272 |
| 32 | 3300053142 | Ga0500577_0000155 | Ga0500577_0000155_2459_3379 | 272 |
| 33 | 3300009147 | Ga0114129_10057257 | Ga0114129_100572575 | 276 |
| 34 | 3300046462 | Ga0495651_0149829 | Ga0495651_0149829_327_1157 | 276 |
| 35 | 3300046663 | Ga0495635_0092343 | Ga0495635_0092343_437_1267 | 276 |
| 36 | 3300050507 | nmdc:mga05p37_104111_c1 | nmdc:mga05p37_104111_c1_168_1001 | 276 |
| 37 | 3300050515 | nmdc:mga0a205_97685_c1 | nmdc:mga0a205_97685_c1_868_1701 | 276 |
| 38 | 3300049583 | Ga0501067_0016579 | Ga0501067_0016579_503_1342 | 277 |
| 39 | 3300006042 | Ga0075368_10009610 | Ga0075368_100096103 | 282 |
| 40 | 3300006178 | Ga0075367_10000873 | Ga0075367_1000087310 | 282 |
| 41 | 3300006186 | Ga0075369_10043729 | Ga0075369_100437292 | 282 |
| 42 | 3300006353 | Ga0075370_10058719 | Ga0075370_100587192 | 282 |
| 43 | 3300027866 | Ga0209813_10010267 | Ga0209813_100102674 | 282 |
| 44 | 3300048925 | Ga0496122_0009062 | Ga0496122_0009062_7366_8235 | 282 |
| 45 | 3300048926 | Ga0496123_0001624 | Ga0496123_0001624_27095_27964 | 282 |
| 46 | 3300050495 | nmdc:mga04h51_11840_c1 | nmdc:mga04h51_11840_c1_82_990 | 282 |
| 47 | 3300050496 | nmdc:mga07m45_10107_c1 | nmdc:mga07m45_10107_c1_1341_2249 | 282 |
| 48 | 3300050516 | nmdc:mga0sz30_13683_c1 | nmdc:mga0sz30_13683_c1_779_1687 | 282 |
| 49 | 3300003781 | Ga0055536_1000029 | Ga0055536_10000294 | 285 |
| 50 | 3300003781 | Ga0055536_1000092 | Ga0055536_100009232 | 285 |
| 51 | 3300003791 | Ga0055530_10000363 | Ga0055530_100003632 | 285 |
| 52 | 3300025292 | Ga0209676_1000057 | Ga0209676_1000057273 | 285 |
| 53 | 3300025298 | Ga0209050_1000096 | Ga0209050_1000096170 | 285 |
| 54 | 3300025303 | Ga0209051_1003708 | Ga0209051_10037083 | 285 |
| 55 | 3300035692 | Ga0373935_0016295 | Ga0373935_0016295_1288_2193 | 285 |
| 56 | 3300037068 | Ga0373925_0064962 | Ga0373925_0064962_1728_2633 | 285 |
| 57 | 3300046471 | Ga0495650_0033200 | Ga0495650_0033200_818_1732 | 285 |
| 58 | 3300048929 | Ga0496126_0002676 | Ga0496126_0002676_17637_18557 | 285 |
| 59 | 3300005293 | Ga0065715_10099681 | Ga0065715_100996812 | 286 |
| 60 | 3300005467 | Ga0070706_100341372 | Ga0070706_1003413722 | 286 |
| 61 | 3300005468 | Ga0070707_100439277 | Ga0070707_1004392771 | 286 |
| 62 | 3300005471 | Ga0070698_100032279 | Ga0070698_1000322795 | 286 |
| 63 | 3300005471 | Ga0070698_100655771 | Ga0070698_1006557711 | 286 |
| 64 | 3300005518 | Ga0070699_100141295 | Ga0070699_1001412951 | 286 |
| 65 | 3300005536 | Ga0070697_100014754 | Ga0070697_1000147542 | 286 |
| 66 | 3300005617 | Ga0068859_100763709 | Ga0068859_1007637091 | 286 |
| 67 | 3300006194 | Ga0075427_10018532 | Ga0075427_100185322 | 286 |
| 68 | 3300006844 | Ga0075428_100413919 | Ga0075428_1004139192 | 286 |
| 69 | 3300006846 | Ga0075430_100035181 | Ga0075430_1000351813 | 286 |
| 70 | 3300006847 | Ga0075431_100279188 | Ga0075431_1002791882 | 286 |
| 71 | 3300006852 | Ga0075433_10029299 | Ga0075433_100292993 | 286 |
| 72 | 3300006852 | Ga0075433_10032486 | Ga0075433_100324865 | 286 |
| 73 | 3300006880 | Ga0075429_100144867 | Ga0075429_1001448673 | 286 |
| 74 | 3300006931 | Ga0097620_100763697 | Ga0097620_1007636971 | 286 |
| 75 | 3300009147 | Ga0114129_10046126 | Ga0114129_100461266 | 286 |
| 76 | 3300011119 | Ga0105246_10414024 | Ga0105246_104140242 | 286 |
| 77 | 3300025910 | Ga0207684_10112349 | Ga0207684_101123493 | 286 |
| 78 | 3300036401 | Ga0373937_0015745 | Ga0373937_0015745_5705_6589 | 286 |
| 79 | 3300050507 | nmdc:mga05p37_110772_c1 | nmdc:mga05p37_110772_c1_1799_2683 | 286 |
| 80 | 3300050507 | nmdc:mga05p37_185990_c1 | nmdc:mga05p37_185990_c1_1617_2501 | 286 |
| 81 | 3300050509 | nmdc:mga0qj67_330310_c1 | nmdc:mga0qj67_330310_c1_80_964 | 286 |
| 82 | 3300050515 | nmdc:mga0a205_175898_c1 | nmdc:mga0a205_175898_c1_634_1518 | 286 |
| 83 | 3300053125 | Ga0500618_000028 | Ga0500618_000028_104616_105476 | 286 |
| 84 | iso_pu_bacteria | 2510917022 | 2511134240 | 286 |
| 85 | iso_pu_bacteria | 2510917030 | 2511198071 | 286 |
| 86 | iso_pu_bacteria | 2513237088 | 2513594953 | 286 |
| 87 | iso_pu_bacteria | 2519899620 | 2520375389 | 286 |
| 88 | iso_pu_bacteria | 2524023209 | 2524458517 | 286 |
| 89 | iso_pu_bacteria | 2582581298 | 2585222205 | 286 |
| 90 | iso_pu_bacteria | 2582581307 | 2585271729 | 286 |
| 91 | iso_pu_bacteria | 2582581308 | 2585279888 | 286 |
| 92 | iso_pu_bacteria | 2582581315 | 2585326565 | 286 |
| 93 | iso_pu_bacteria | 2582581316 | 2585334089 | 286 |
| 94 | iso_pu_bacteria | 2585427527 | 2585531708 | 286 |
| 95 | iso_pu_bacteria | 2585427529 | 2585544842 | 286 |
| 96 | iso_pu_bacteria | 2585427530 | 2585551345 | 286 |
| 97 | iso_pu_bacteria | 2585427531 | 2585563031 | 286 |
| 98 | iso_pu_bacteria | 2585427608 | 2585902895 | 286 |
| 99 | iso_pu_bacteria | 2585427609 | 2585907246 | 286 |
| 100 | iso_pu_bacteria | 2585428125 | 2587982760 | 286 |
| 101 | iso_pu_bacteria | 2615840626 | 2616306681 | 286 |
| 102 | iso_pu_bacteria | 2615840698 | 2616557537 | 286 |
| 103 | iso_pu_bacteria | 2617270742 | 2617386009 | 286 |
| 104 | iso_pu_bacteria | 2643221643 | 2644242177 | 286 |
| 105 | iso_pu_bacteria | 2667528174 | 2671113434 | 286 |
| 106 | iso_pu_bacteria | 2718218233 | 2720618062 | 286 |
| 107 | iso_pu_bacteria | 2718218235 | 2720629052 | 286 |
| 108 | iso_pu_bacteria | 2718218269 | 2720773126 | 286 |
| 109 | iso_pu_bacteria | 2721755819 | 2724093155 | 286 |
| 110 | iso_pu_bacteria | 2724679232 | 2725952796 | 286 |
| 111 | iso_pu_bacteria | 2775507266 | 2778178670 | 286 |
| 112 | iso_pu_bacteria | 2791355259 | 2793316755 | 286 |
| 113 | iso_pu_bacteria | 2791355263 | 2793343273 | 286 |
| 114 | iso_pu_bacteria | 2818991448 | 2819611280 | 286 |
| 115 | iso_pu_bacteria | 2818991453 | 2819638775 | 286 |
| 116 | iso_pu_bacteria | 2838029111 | 2838030977 | 286 |
| 117 | iso_pu_bacteria | 2838042994 | 2838046611 | 286 |
| 118 | iso_pu_bacteria | 2842298080 | 2842300224 | 286 |
| 119 | iso_pu_bacteria | 2842311132 | 2842317113 | 286 |
| 120 | iso_pu_bacteria | 2842357229 | 2842359135 | 286 |
| 121 | iso_pu_bacteria | 2842475841 | 2842477709 | 286 |
| 122 | iso_pu_bacteria | 2842482326 | 2842485014 | 286 |
| 123 | iso_pu_bacteria | 2842502639 | 2842504419 | 286 |
| 124 | iso_pu_bacteria | 2842509118 | 2842511662 | 286 |
| 125 | iso_pu_bacteria | 2852387548 | 2852391745 | 286 |
| 126 | iso_pu_bacteria | 2904578770 | 2904583646 | 286 |
| 127 | iso_pu_bacteria | 2919100787 | 2919102750 | 286 |
| 128 | iso_pu_bacteria | 2919119836 | 2919124787 | 286 |
| 129 | iso_pu_bacteria | 2919408235 | 2919411109 | 286 |
| 130 | iso_pu_bacteria | 2936381700 | 2936384222 | 286 |
| 131 | iso_pu_bacteria | 3002141150 | 3002143831 | 286 |
| 132 | iso_pu_bacteria | 3005416602 | 3005421579 | 286 |
| 133 | iso_pu_bacteria | 3005445848 | 3005451643 | 286 |
| 134 | iso_pu_bacteria | 8005314921 | 8005319718 | 286 |
| 135 | iso_pu_bacteria | 8005484373 | 8005490341 | 286 |
| 136 | iso_pu_bacteria | 8005497431 | 8005502330 | 286 |
| 137 | iso_pu_bacteria | 8005542996 | 8005548708 | 286 |
| 138 | iso_pu_bacteria | 8005619151 | 8005624664 | 286 |
| 139 | iso_pu_bacteria | 8005645114 | 8005646991 | 286 |
| 140 | iso_pu_bacteria | 8005668836 | 8005673757 | 286 |
| 141 | iso_pu_bacteria | 8005682033 | 8005688145 | 286 |
| 142 | iso_pu_bacteria | 8018150411 | 8018151222 | 286 |
| 143 | iso_pu_bacteria | 8024486573 | 8024488947 | 286 |
| 144 | iso_pu_bacteria | 8046767195 | 8046767271 | 286 |
| 145 | iso_pu_bacteria | 8054460903 | 8054465113 | 286 |
| 146 | iso_pu_bacteria | 8057575449 | 8057581661 | 286 |
| 147 | 3300028556 | Ga0265337_1006723 | Ga0265337_10067234 | 287 |
| 148 | 3300046460 | Ga0495638_0000380 | Ga0495638_0000380_45850_46803 | 287 |
| 149 | 3300046513 | Ga0495616_0000117 | Ga0495616_0000117_37808_38761 | 287 |
| 150 | 3300046519 | Ga0495632_0001570 | Ga0495632_0001570_8459_9412 | 287 |
| 151 | 3300046522 | Ga0495643_0111878 | Ga0495643_0111878_138_1091 | 287 |
| 152 | 3300046616 | Ga0495668_0054518 | Ga0495668_0054518_652_1605 | 287 |
| 153 | 3300048924 | Ga0496121_0135357 | Ga0496121_0135357_699_1607 | 287 |
| 154 | 3300053100 | Ga0500660_110103 | Ga0500660_110103_116_1069 | 287 |
| 155 | 3300053125 | Ga0500618_000497 | Ga0500618_000497_19723_20634 | 287 |
| 156 | 3300053731 | Ga0500609_000428 | Ga0500609_000428_929_1882 | 287 |
| 157 | iso_pu_bacteria | 2582581280 | 2585154214 | 289 |
| 158 | iso_pu_bacteria | 2582581293 | 2585197833 | 289 |
| 159 | iso_pu_bacteria | 2643221552 | 2643781040 | 289 |
| 160 | 3300001979 | JGI24740J21852_10000004 | JGI24740J21852_1000000446 | 290 |
| 161 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_100000449 | 290 |
| 162 | 3300002705 | JGI25156J39149_1000014 | JGI25156J39149_1000014131 | 290 |
| 163 | 3300002737 | JGI25162J39368_1000482 | JGI25162J39368_100048223 | 290 |
| 164 | 3300002737 | JGI25162J39368_1000526 | JGI25162J39368_10005264 | 290 |
| 165 | 3300002738 | JGI25154J39366_1000096 | JGI25154J39366_100009659 | 290 |
| 166 | 3300002739 | JGI25158J39367_1000081 | JGI25158J39367_10000816 | 290 |
| 167 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_1000005214 | 290 |
| 168 | 3300002773 | JGI25152J39213_1001056 | JGI25152J39213_10010567 | 290 |
| 169 | 3300002987 | JGI25159J45721_1001028 | JGI25159J45721_10010282 | 290 |
| 170 | 3300002987 | JGI25159J45721_1003346 | JGI25159J45721_10033466 | 290 |
| 171 | 3300003187 | JGI25151J46595_10062456 | JGI25151J46595_100624562 | 290 |
| 172 | 3300003214 | JGI25165J46597_1000190 | JGI25165J46597_100019019 | 290 |
| 173 | 3300003214 | JGI25165J46597_1000328 | JGI25165J46597_100032843 | 290 |
| 174 | 3300003215 | JGI25153J46596_10001863 | JGI25153J46596_100018637 | 290 |
| 175 | 3300003316 | rootH1_10070844 | rootH1_100708442 | 290 |
| 176 | 3300003320 | rootH2_10017677 | rootH2_1001767712 | 290 |
| 177 | 3300003322 | rootL2_10002812 | rootL2_1000281236 | 290 |
| 178 | 3300003323 | rootH1_10028475 | rootH1_100284754 | 290 |
| 179 | 3300003323 | rootH1_10031460 | rootH1_100314604 | 290 |
| 180 | 3300003323 | rootH1_10141540 | rootH1_101415403 | 290 |
| 181 | 3300003354 | JGI25160J50197_1000108 | JGI25160J50197_100010831 | 290 |
| 182 | 3300003354 | JGI25160J50197_1001507 | JGI25160J50197_10015077 | 290 |
| 183 | 3300003374 | JGI25161J50226_1000112 | JGI25161J50226_100011231 | 290 |
| 184 | 3300003374 | JGI25161J50226_1000304 | JGI25161J50226_100030414 | 290 |
| 185 | 3300003771 | Ga0055526_1002344 | Ga0055526_10023444 | 290 |
| 186 | 3300003771 | Ga0055526_1002963 | Ga0055526_10029639 | 290 |
| 187 | 3300003771 | Ga0055526_1021591 | Ga0055526_10215913 | 290 |
| 188 | 3300003775 | Ga0055524_1000769 | Ga0055524_100076919 | 290 |
| 189 | 3300003775 | Ga0055524_1006444 | Ga0055524_10064445 | 290 |
| 190 | 3300003790 | Ga0055528_1000054 | Ga0055528_10000549 | 290 |
| 191 | 3300003790 | Ga0055528_1000083 | Ga0055528_100008348 | 290 |
| 192 | 3300003790 | Ga0055528_1002097 | Ga0055528_10020975 | 290 |
| 193 | 3300003792 | Ga0055540_1006164 | Ga0055540_10061644 | 290 |
| 194 | 3300004625 | Ga0055543_1000080 | Ga0055543_100008056 | 290 |
| 195 | 3300004625 | Ga0055543_1000096 | Ga0055543_10000968 | 290 |
| 196 | 3300005262 | Ga0065165_1000520 | Ga0065165_100052038 | 290 |
| 197 | 3300005262 | Ga0065165_1004702 | Ga0065165_10047026 | 290 |
| 198 | 3300005548 | Ga0070665_100142828 | Ga0070665_1001428283 | 290 |
| 199 | 3300005548 | Ga0070665_100304390 | Ga0070665_1003043903 | 290 |
| 200 | 3300005578 | Ga0068854_100053568 | Ga0068854_1000535683 | 290 |
| 201 | 3300005614 | Ga0068856_100011847 | Ga0068856_1000118473 | 290 |
| 202 | 3300005614 | Ga0068856_100754938 | Ga0068856_1007549382 | 290 |
| 203 | 3300005843 | Ga0068860_100000083 | Ga0068860_100000083119 | 290 |
| 204 | 3300005844 | Ga0068862_100329128 | Ga0068862_1003291282 | 290 |
| 205 | 3300006178 | Ga0075367_10067525 | Ga0075367_100675253 | 290 |
| 206 | 3300006186 | Ga0075369_10067742 | Ga0075369_100677423 | 290 |
| 207 | 3300006353 | Ga0075370_10022364 | Ga0075370_100223644 | 290 |
| 208 | 3300009092 | Ga0105250_10056800 | Ga0105250_100568003 | 290 |
| 209 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013269 | 290 |
| 210 | 3300009147 | Ga0114129_10024390 | Ga0114129_1002439010 | 290 |
| 211 | 3300009545 | Ga0105237_10040004 | Ga0105237_100400045 | 290 |
| 212 | 3300009765 | Ga0123341_1000781 | Ga0123341_10007818 | 290 |
| 213 | 3300009766 | Ga0123342_1018673 | Ga0123342_10186733 | 290 |
| 214 | 3300010375 | Ga0105239_10014173 | Ga0105239_100141736 | 290 |
| 215 | 3300013104 | Ga0157370_10000548 | Ga0157370_1000054834 | 290 |
| 216 | 3300013105 | Ga0157369_10144533 | Ga0157369_101445333 | 290 |
| 217 | 3300014497 | Ga0182008_10028114 | Ga0182008_100281143 | 290 |
| 218 | 3300014968 | Ga0157379_10167717 | Ga0157379_101677172 | 290 |
| 219 | 3300015262 | Ga0182007_10000458 | Ga0182007_100004588 | 290 |
| 220 | 3300025206 | Ga0209435_100009 | Ga0209435_100009210 | 290 |
| 221 | 3300025208 | Ga0209436_100009 | Ga0209436_10000921 | 290 |
| 222 | 3300025228 | Ga0209672_103223 | Ga0209672_1032234 | 290 |
| 223 | 3300025231 | Ga0207427_103955 | Ga0207427_1039552 | 290 |
| 224 | 3300025233 | Ga0209437_100057 | Ga0209437_100057254 | 290 |
| 225 | 3300025233 | Ga0209437_100206 | Ga0209437_10020626 | 290 |
| 226 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018210 | 290 |
| 227 | 3300025250 | Ga0209026_1000043 | Ga0209026_1000043210 | 290 |
| 228 | 3300025253 | Ga0209677_101737 | Ga0209677_1017374 | 290 |
| 229 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007210 | 290 |
| 230 | 3300025258 | Ga0209129_1006526 | Ga0209129_10065262 | 290 |
| 231 | 3300025261 | Ga0209233_1000130 | Ga0209233_100013056 | 290 |
| 232 | 3300025261 | Ga0209233_1000178 | Ga0209233_100017854 | 290 |
| 233 | 3300025261 | Ga0209233_1000256 | Ga0209233_100025659 | 290 |
| 234 | 3300025272 | Ga0209455_1009775 | Ga0209455_10097752 | 290 |
| 235 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067223 | 290 |
| 236 | 3300025273 | Ga0209673_1000086 | Ga0209673_1000086167 | 290 |
| 237 | 3300025273 | Ga0209673_1001363 | Ga0209673_100136312 | 290 |
| 238 | 3300025284 | Ga0209130_1000031 | Ga0209130_1000031224 | 290 |
| 239 | 3300025284 | Ga0209130_1000108 | Ga0209130_100010876 | 290 |
| 240 | 3300025294 | Ga0209025_1002308 | Ga0209025_100230817 | 290 |
| 241 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092223 | 290 |
| 242 | 3300025295 | Ga0209564_1000952 | Ga0209564_10009527 | 290 |
| 243 | 3300025295 | Ga0209564_1021123 | Ga0209564_10211232 | 290 |
| 244 | 3300025297 | Ga0209758_1004432 | Ga0209758_10044328 | 290 |
| 245 | 3300025297 | Ga0209758_1004917 | Ga0209758_10049176 | 290 |
| 246 | 3300025297 | Ga0209758_1045244 | Ga0209758_10452441 | 290 |
| 247 | 3300025299 | Ga0209256_1000788 | Ga0209256_100078831 | 290 |
| 248 | 3300025299 | Ga0209256_1004712 | Ga0209256_10047125 | 290 |
| 249 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042186 | 290 |
| 250 | 3300025302 | Ga0207426_1000082 | Ga0207426_1000082221 | 290 |
| 251 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044227 | 290 |
| 252 | 3300025914 | Ga0207671_10003650 | Ga0207671_1000365013 | 290 |
| 253 | 3300025924 | Ga0207694_10006739 | Ga0207694_100067394 | 290 |
| 254 | 3300025981 | Ga0207640_10145918 | Ga0207640_101459182 | 290 |
| 255 | 3300026078 | Ga0207702_10023861 | Ga0207702_100238613 | 290 |
| 256 | 3300027312 | Ga0209371_1002468 | Ga0209371_10024684 | 290 |
| 257 | 3300028379 | Ga0268266_10027899 | Ga0268266_100278996 | 290 |
| 258 | 3300028380 | Ga0268265_10315442 | Ga0268265_103154422 | 290 |
| 259 | 3300028381 | Ga0268264_10000055 | Ga0268264_10000055253 | 290 |
| 260 | 3300030500 | Ga0268256_1003511 | Ga0268256_10035116 | 290 |
| 261 | 3300030521 | Ga0307511_10016515 | Ga0307511_100165157 | 290 |
| 262 | 3300031456 | Ga0307513_10038504 | Ga0307513_100385041 | 290 |
| 263 | 3300031456 | Ga0307513_10412771 | Ga0307513_104127712 | 290 |
| 264 | 3300033180 | Ga0307510_10008361 | Ga0307510_100083616 | 290 |
| 265 | 3300041496 | Ga0451839_0023546 | Ga0451839_0023546_522_1394 | 290 |
| 266 | 3300041503 | Ga0451847_0519890 | Ga0451847_0519890_3763_4635 | 290 |
| 267 | 3300041507 | Ga0451851_0391774 | Ga0451851_0391774_1314_2186 | 290 |
| 268 | 3300041509 | Ga0451843_0727982 | Ga0451843_0727982_2251_3123 | 290 |
| 269 | 3300044765 | Ga0466970_0014846 | Ga0466970_0014846_1537_2409 | 290 |
| 270 | 3300046459 | Ga0495629_0011394 | Ga0495629_0011394_1704_2576 | 290 |
| 271 | 3300046460 | Ga0495638_0000079 | Ga0495638_0000079_122549_123466 | 290 |
| 272 | 3300046460 | Ga0495638_0000143 | Ga0495638_0000143_39606_40478 | 290 |
| 273 | 3300046476 | Ga0495662_0016909 | Ga0495662_0016909_2108_2980 | 290 |
| 274 | 3300046506 | Ga0495583_0000037 | Ga0495583_0000037_3886_4824 | 290 |
| 275 | 3300046506 | Ga0495583_0000234 | Ga0495583_0000234_90418_91353 | 290 |
| 276 | 3300046507 | Ga0495606_0236756 | Ga0495606_0236756_66_941 | 290 |
| 277 | 3300046518 | Ga0495631_0033674 | Ga0495631_0033674_1195_2067 | 290 |
| 278 | 3300046520 | Ga0495637_0005840 | Ga0495637_0005840_549_1469 | 290 |
| 279 | 3300046522 | Ga0495643_0001728 | Ga0495643_0001728_16495_17370 | 290 |
| 280 | 3300046542 | Ga0495597_0061925 | Ga0495597_0061925_637_1512 | 290 |
| 281 | 3300046557 | Ga0495622_0037948 | Ga0495622_0037948_1035_1907 | 290 |
| 282 | 3300046558 | Ga0495633_0049553 | Ga0495633_0049553_124_999 | 290 |
| 283 | 3300046616 | Ga0495668_0134267 | Ga0495668_0134267_384_1304 | 290 |
| 284 | 3300046675 | Ga0495657_0045898 | Ga0495657_0045898_1951_2823 | 290 |
| 285 | 3300046684 | Ga0495669_0000006 | Ga0495669_0000006_84640_85557 | 290 |
| 286 | 3300046684 | Ga0495669_0000577 | Ga0495669_0000577_1575_2495 | 290 |
| 287 | 3300047317 | Ga0495604_0157982 | Ga0495604_0157982_462_1334 | 290 |
| 288 | 3300047320 | Ga0495672_0004601 | Ga0495672_0004601_7667_8539 | 290 |
| 289 | 3300047320 | Ga0495672_0026551 | Ga0495672_0026551_881_1798 | 290 |
| 290 | 3300047443 | Ga0495687_081322 | Ga0495687_081322_230_1105 | 290 |
| 291 | 3300047470 | Ga0495681_0036995 | Ga0495681_0036995_86_1021 | 290 |
| 292 | 3300047472 | Ga0495686_0005997 | Ga0495686_0005997_6385_7305 | 290 |
| 293 | 3300048909 | Ga0496106_0000109 | Ga0496106_0000109_36925_37797 | 290 |
| 294 | 3300048909 | Ga0496106_0016469 | Ga0496106_0016469_3753_4688 | 290 |
| 295 | 3300048910 | Ga0496107_0000086 | Ga0496107_0000086_3533_4468 | 290 |
| 296 | 3300048920 | Ga0496117_0001113 | Ga0496117_0001113_19493_20365 | 290 |
| 297 | 3300048920 | Ga0496117_0107487 | Ga0496117_0107487_639_1514 | 290 |
| 298 | 3300048921 | Ga0496118_0001953 | Ga0496118_0001953_1649_2521 | 290 |
| 299 | 3300048921 | Ga0496118_0002207 | Ga0496118_0002207_2714_3586 | 290 |
| 300 | 3300048922 | Ga0496119_0017106 | Ga0496119_0017106_3036_3908 | 290 |
| 301 | 3300048922 | Ga0496119_0026229 | Ga0496119_0026229_1951_2823 | 290 |
| 302 | 3300048923 | Ga0496120_0008671 | Ga0496120_0008671_1751_2623 | 290 |
| 303 | 3300048924 | Ga0496121_0001285 | Ga0496121_0001285_2654_3589 | 290 |
| 304 | 3300048924 | Ga0496121_0003282 | Ga0496121_0003282_20379_21251 | 290 |
| 305 | 3300048924 | Ga0496121_0005792 | Ga0496121_0005792_7609_8484 | 290 |
| 306 | 3300048924 | Ga0496121_0051523 | Ga0496121_0051523_1926_2801 | 290 |
| 307 | 3300048924 | Ga0496121_0094913 | Ga0496121_0094913_41_916 | 290 |
| 308 | 3300048925 | Ga0496122_0000137 | Ga0496122_0000137_114935_115807 | 290 |
| 309 | 3300048925 | Ga0496122_0235429 | Ga0496122_0235429_60_935 | 290 |
| 310 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_52733_53605 | 290 |
| 311 | 3300048926 | Ga0496123_0057103 | Ga0496123_0057103_1389_2264 | 290 |
| 312 | 3300048927 | Ga0496124_0000715 | Ga0496124_0000715_38958_39830 | 290 |
| 313 | 3300048927 | Ga0496124_0021779 | Ga0496124_0021779_3488_4360 | 290 |
| 314 | 3300048927 | Ga0496124_0028471 | Ga0496124_0028471_1761_2633 | 290 |
| 315 | 3300050494 | nmdc:mga06z11_51713_c1 | nmdc:mga06z11_51713_c1_1122_1994 | 290 |
| 316 | 3300053079 | Ga0500610_0082254 | Ga0500610_0082254_429_1301 | 290 |
| 317 | 3300053085 | Ga0495619_0214182 | Ga0495619_0214182_129_1001 | 290 |
| 318 | 3300053086 | Ga0500578_0015853 | Ga0500578_0015853_654_1529 | 290 |
| 319 | 3300053087 | Ga0500643_026052 | Ga0500643_026052_568_1494 | 290 |
| 320 | 3300053090 | Ga0500646_0072777 | Ga0500646_0072777_116_988 | 290 |
| 321 | 3300053102 | Ga0500554_001979 | Ga0500554_001979_623_1543 | 290 |
| 322 | 3300053109 | Ga0500569_004599 | Ga0500569_004599_367_1239 | 290 |
| 323 | 3300053118 | Ga0500594_0001980 | Ga0500594_0001980_581_1453 | 290 |
| 324 | 3300053125 | Ga0500618_000053 | Ga0500618_000053_98509_99444 | 290 |
| 325 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_94583_95503 | 290 |
| 326 | 3300053139 | Ga0500568_0000074 | Ga0500568_0000074_19965_20837 | 290 |
| 327 | 3300053139 | Ga0500568_0000307 | Ga0500568_0000307_1705_2577 | 290 |
| 328 | 3300053151 | Ga0500604_0009098 | Ga0500604_0009098_1116_1988 | 290 |
| 329 | 3300053153 | Ga0500616_0001534 | Ga0500616_0001534_4399_5274 | 290 |
| 330 | 3300053156 | Ga0500622_0003453 | Ga0500622_0003453_2016_2891 | 290 |
| 331 | 3300053156 | Ga0500622_0013879 | Ga0500622_0013879_755_1675 | 290 |
| 332 | 3300053161 | Ga0500634_0001650 | Ga0500634_0001650_4692_5567 | 290 |
| 333 | 3300061719 | Ga0466962_0076094 | Ga0466962_0076094_233_1105 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f6t-assembly1.cif.gz_A | cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila | 0.6908 | 7 | 249 |
| 8sbb-assembly1.cif.gz_A | cryo-em structure of ftalkb | 0.6734 | 6 | 249 |
| 8f6t-assembly1.cif.gz_A | cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila | 0.5892 | 7 | 249 |
| 8sbb-assembly1.cif.gz_A | cryo-em structure of ftalkb | 0.5794 | 6 | 249 |
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.4111 | 4 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6132 | 19 | 270 | 3.30.40.10 |
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.5758 | 19 | 270 | 3.30.40.10 |
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.3534 | 9 | 168 | 1.20.120.1760 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.35 | 5 | 186 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.3411 | 5 | 186 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7YL53-F1-model_v4 | Fatty acid desaturase | 0.9923 | 1 | 278 |
GO:0016020
GO:0042284 GO:0046513 |
| AF-A0A2V5T3R0-F1-model_v4 | Fatty acid desaturase | 0.9922 | 1 | 279 |
GO:0016020
GO:0042284 GO:0046513 |
| AF-A0A2R7QY42-F1-model_v4 | deleted | 0.9918 | 184 | 277 |
|
| AF-A0A2W5YJD6-F1-model_v4 | Fatty acid desaturase | 0.9904 | 1 | 279 |
GO:0016020
GO:0042284 GO:0046513 |
| AF-A0A5C1W8Y5-F1-model_v4 | Fatty acid desaturase | 0.9902 | 1 | 283 |
GO:0006629
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar