F411479

General Info

Members Datasets Scaffolds Average Seq Length
333 200 666 147

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0098016|Ga0451576_0098016_2248_2763
Length 171
Sequence MISRRGTGLSSGGRIRRRYNRLMIRWMLSATLLFLAAPASAETNAELKEQVRRTEMAFAKTLADRNPAAFASFLASETIFMSNGRVTRGARQVAERWKQFFEGAQAPFSWEPEQVEVLDSGTLAMSSGPVRDPSGKRIGTFNSVWRRERNGDWKIVLDNGCPACNCDAAGK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.6
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 21.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0098016 3300045051 Bacteria 3049
2 rootL2_10272843 3300003322 Bacteria 1082
3 Ga0070676_10632912 3300005328 Unclassified 775
4 Ga0070683_100000005 3300005329 Bacteria 361724
5 Ga0070683_100313582 3300005329 Bacteria 1493
6 Ga0068869_100963147 3300005334 Bacteria 741
7 Ga0070666_10364966 3300005335 Bacteria 1035
8 Ga0068868_101525808 3300005338 Unclassified 626
9 Ga0070660_100405745 3300005339 Bacteria 1127
10 Ga0070689_100322401 3300005340 Bacteria 1290
11 Ga0070689_100471972 3300005340 Bacteria 1071
12 Ga0070687_100158116 3300005343 Bacteria 1337
13 Ga0070692_10147297 3300005345 Bacteria 1338
14 Ga0070671_100795741 3300005355 Unclassified 823
15 Ga0070673_100960389 3300005364 Unclassified 794
16 Ga0070688_100535933 3300005365 Bacteria 888
17 Ga0070667_100311239 3300005367 Bacteria 1419
18 Ga0070667_100702099 3300005367 Bacteria 936
19 Ga0070703_10003553 3300005406 Bacteria 4430
20 Ga0070713_100138685 3300005436 Bacteria 2152
21 Ga0070705_100063830 3300005440 Bacteria 2198
22 Ga0070700_100386896 3300005441 Bacteria 1048
23 Ga0070694_100054558 3300005444 Bacteria 2708
24 Ga0070694_100062880 3300005444 Bacteria 2537
25 Ga0070694_101786144 3300005444 Unclassified 524
26 Ga0070708_100560637 3300005445 Bacteria 1077
27 Ga0070678_100133399 3300005456 Bacteria 1977
28 Ga0068867_100188341 3300005459 Unclassified 1645
29 Ga0070685_10227515 3300005466 Bacteria 1225
30 Ga0070706_100080371 3300005467 Unclassified 3019
31 Ga0070706_100129438 3300005467 Unclassified 2355
32 Ga0070707_100019468 3300005468 Bacteria 6395
33 Ga0070698_100147247 3300005471 Unclassified 2303
34 Ga0070698_100222890 3300005471 Bacteria 1819
35 Ga0070684_100000053 3300005535 Bacteria 77715
36 Ga0070684_101258705 3300005535 Unclassified 696
37 Ga0070695_100025648 3300005545 Bacteria 3641
38 Ga0070665_100209756 3300005548 Bacteria 1949
39 Ga0070665_100247510 3300005548 Bacteria 1783
40 Ga0070665_100568755 3300005548 Unclassified 1146
41 Ga0070704_100013334 3300005549 Bacteria 5098
42 Ga0070704_100169043 3300005549 Unclassified 1737
43 Ga0068855_100286820 3300005563 Bacteria 1826
44 Ga0068857_101589966 3300005577 Bacteria 638
45 Ga0068859_100228424 3300005617 Bacteria 1949
46 Ga0068859_100472314 3300005617 Bacteria 1350
47 Ga0068859_100743842 3300005617 Bacteria 1070
48 Ga0068864_100285459 3300005618 Bacteria 1542
49 Ga0068864_100621347 3300005618 Bacteria 1050
50 Ga0068861_100194841 3300005719 Bacteria 1697
51 Ga0068861_100622831 3300005719 Bacteria 993
52 Ga0068858_100002712 3300005842 Bacteria 17848
53 Ga0068858_100090462 3300005842 Unclassified 2848
54 Ga0068858_100310777 3300005842 Bacteria 1505
55 Ga0068860_100201698 3300005843 Bacteria 1928
56 Ga0068860_100296114 3300005843 Unclassified 1584
57 Ga0068862_100062179 3300005844 Bacteria 3211
58 Ga0075365_10110305 3300006038 Bacteria 1890
59 Ga0075432_10095633 3300006058 Bacteria 1092
60 Ga0097621_100528955 3300006237 Bacteria 1071
61 Ga0068871_100330781 3300006358 Bacteria 1344
62 Ga0068871_100830935 3300006358 Bacteria 853
63 Ga0075428_100007210 3300006844 Bacteria 12312
64 Ga0075428_100018619 3300006844 Bacteria 7675
65 Ga0075428_100037889 3300006844 Bacteria 5306
66 Ga0075428_100222559 3300006844 Bacteria 2037
67 Ga0075430_100009737 3300006846 Bacteria 8124
68 Ga0075431_100004571 3300006847 Bacteria 13591
69 Ga0075431_100124802 3300006847 Bacteria 2656
70 Ga0075431_100298279 3300006847 Bacteria 1628
71 Ga0075431_100618687 3300006847 Unclassified 1065
72 Ga0075433_10127442 3300006852 Bacteria 2260
73 Ga0075433_10155163 3300006852 Bacteria 2037
74 Ga0075433_10182118 3300006852 Bacteria 1869
75 Ga0075433_10651349 3300006852 Bacteria 923
76 Ga0075434_100003453 3300006871 Bacteria 14125
77 Ga0075434_100239630 3300006871 Unclassified 1834
78 Ga0075434_100473915 3300006871 Bacteria 1273
79 Ga0075434_100956439 3300006871 Unclassified 871
80 Ga0075429_100001699 3300006880 Bacteria 18193
81 Ga0075429_100068718 3300006880 Bacteria 3084
82 Ga0075429_100186757 3300006880 Unclassified 1816
83 Ga0075429_101220503 3300006880 Bacteria 656
84 Ga0075436_100007975 3300006914 Bacteria 7251
85 Ga0075436_100339347 3300006914 Bacteria 1081
86 Ga0097620_100228424 3300006931 Bacteria 1949
87 Ga0097620_100472302 3300006931 Bacteria 1350
88 Ga0097620_100743900 3300006931 Bacteria 1070
89 Ga0075435_100001570 3300007076 Bacteria 14753
90 Ga0075435_100027259 3300007076 Bacteria 4467
91 Ga0075435_100079552 3300007076 Bacteria 2690
92 Ga0105240_10470642 3300009093 Bacteria 1402
93 Ga0111539_10231871 3300009094 Unclassified 2150
94 Ga0111539_10384971 3300009094 Bacteria 1633
95 Ga0105245_10121755 3300009098 Bacteria 2438
96 Ga0105245_10662743 3300009098 Bacteria 1074
97 Ga0105247_10017135 3300009101 Bacteria 4348
98 Ga0114129_10008269 3300009147 Bacteria 14844
99 Ga0114129_10011401 3300009147 Bacteria 12661
100 Ga0114129_10043154 3300009147 Bacteria 6346
101 Ga0114129_10167427 3300009147 Bacteria 2998
102 Ga0114129_10176866 3300009147 Bacteria 2907
103 Ga0114129_10993992 3300009147 Unclassified 1057
104 Ga0114129_11019309 3300009147 Unclassified 1041
105 Ga0105243_10101495 3300009148 Bacteria 2389
106 Ga0105243_10739196 3300009148 Bacteria 963
107 Ga0105241_11350285 3300009174 Bacteria 681
108 Ga0105242_10007414 3300009176 Bacteria 8446
109 Ga0105248_10065345 3300009177 Bacteria 4085
110 Ga0105248_10269939 3300009177 Bacteria 1916
111 Ga0105248_10306206 3300009177 Bacteria 1789
112 Ga0105248_10522750 3300009177 Bacteria 1338
113 Ga0105248_11100209 3300009177 Bacteria 898
114 Ga0105238_10391236 3300009551 Bacteria 1382
115 Ga0105238_10425013 3300009551 Bacteria 1324
116 Ga0105238_11346706 3300009551 Bacteria 740
117 Ga0105249_10194177 3300009553 Bacteria 1983
118 Ga0105246_10132886 3300011119 Unclassified 1861
119 Ga0157370_11158084 3300013104 Unclassified 698
120 Ga0157369_10266469 3300013105 Bacteria 1786
121 Ga0157378_11847815 3300013297 Unclassified 653
122 Ga0163162_10825324 3300013306 Bacteria 1043
123 Ga0163162_11099598 3300013306 Bacteria 901
124 Ga0157372_10305840 3300013307 Bacteria 1850
125 Ga0157375_10402296 3300013308 Bacteria 1536
126 Ga0157375_10888047 3300013308 Bacteria 1036
127 Ga0157375_10894068 3300013308 Bacteria 1032
128 Ga0163163_10044647 3300014325 Bacteria 4348
129 Ga0163163_10827126 3300014325 Bacteria 989
130 Ga0163163_11772975 3300014325 Unclassified 678
131 Ga0157380_10007975 3300014326 Bacteria 7541
132 Ga0157380_10622168 3300014326 Bacteria 1072
133 Ga0157379_10059687 3300014968 Unclassified 3410
134 Ga0157376_10241078 3300014969 Bacteria 1684
135 Ga0157376_10654369 3300014969 Bacteria 1051
136 Ga0157376_10670793 3300014969 Bacteria 1039
137 Ga0197907_11241240 3300020069 Unclassified 928
138 Ga0206354_10789022 3300020081 Unclassified 902
139 Ga0207653_10054164 3300025885 Unclassified 1341
140 Ga0207653_10148341 3300025885 Bacteria 862
141 Ga0207710_10024395 3300025900 Bacteria 2604
142 Ga0207684_10041050 3300025910 Bacteria 3924
143 Ga0207695_10370132 3300025913 Bacteria 1319
144 Ga0207660_10195337 3300025917 Bacteria 1578
145 Ga0207657_10560699 3300025919 Unclassified 893
146 Ga0207706_10125444 3300025933 Bacteria 2258
147 Ga0207686_10024542 3300025934 Unclassified 3495
148 Ga0207709_10024939 3300025935 Bacteria 3420
149 Ga0207670_10123474 3300025936 Bacteria 1886
150 Ga0207670_10159266 3300025936 Bacteria 1683
151 Ga0207711_10659557 3300025941 Bacteria 976
152 Ga0207661_10000031 3300025944 Bacteria 164429
153 Ga0207667_10144921 3300025949 Bacteria 2445
154 Ga0207651_10210694 3300025960 Bacteria 1564
155 Ga0207712_10494934 3300025961 Bacteria 1044
156 Ga0207677_11102725 3300026023 Bacteria 724
157 Ga0207677_11360891 3300026023 Bacteria 653
158 Ga0207703_10005660 3300026035 Bacteria 10035
159 Ga0207703_10047484 3300026035 Bacteria 3462
160 Ga0207703_10150336 3300026035 Unclassified 2030
161 Ga0207639_10652311 3300026041 Bacteria 974
162 Ga0207708_10516202 3300026075 Bacteria 1003
163 Ga0207641_10443655 3300026088 Unclassified 1253
164 Ga0207641_10731366 3300026088 Bacteria 976
165 Ga0207648_10227538 3300026089 Unclassified 1658
166 Ga0207676_10480325 3300026095 Bacteria 1177
167 Ga0207676_10608920 3300026095 Bacteria 1050
168 Ga0207675_100057674 3300026118 Bacteria 3623
169 Ga0207675_100553545 3300026118 Bacteria 1150
170 Ga0207428_10322257 3300027907 Bacteria 1141
171 Ga0268266_10710932 3300028379 Bacteria 969
172 Ga0268266_10781307 3300028379 Bacteria 922
173 Ga0268265_10087612 3300028380 Bacteria 2478
174 Ga0268264_10175660 3300028381 Bacteria 1941
175 Ga0268264_10302416 3300028381 Bacteria 1506
176 Ga0268264_10781513 3300028381 Bacteria 953
177 Ga0265331_10056756 3300031250 Unclassified 1858
178 Ga0265316_10584848 3300031344 Bacteria 793
179 Ga0307408_101476260 3300031548 Bacteria 642
180 Ga0307405_10159611 3300031731 Unclassified 1595
181 Ga0307413_10091328 3300031824 Bacteria 1984
182 Ga0307410_11260294 3300031852 Bacteria 646
183 Ga0307406_10589736 3300031901 Unclassified 915
184 Ga0307412_10143877 3300031911 Unclassified 1750
185 Ga0307412_11324325 3300031911 Unclassified 649
186 Ga0307416_100477283 3300032002 Unclassified 1306
187 Ga0307416_100754221 3300032002 Bacteria 1066
188 Ga0307414_11074141 3300032004 Unclassified 743
189 Ga0307411_10119790 3300032005 Unclassified 1902
190 Ga0307415_100079358 3300032126 Bacteria 2338
191 Ga0373936_0236855 3300035113 Unclassified 813
192 Ga0373953_0387636 3300035117 Bacteria 614
193 Ga0373954_0016854 3300035118 Bacteria 3277
194 Ga0373954_0085682 3300035118 Bacteria 1509
195 Ga0373956_0304730 3300035119 Unclassified 759
196 Ga0373943_0782024 3300035170 Unclassified 568
197 Ga0373946_0170952 3300035171 Bacteria 1026
198 Ga0373955_0160455 3300035172 Unclassified 1327
199 Ga0373924_0140481 3300035410 Bacteria 1054
200 Ga0373931_0314925 3300035691 Bacteria 970
201 Ga0373927_0559942 3300035695 Bacteria 755
202 Ga0373933_0012981 3300035724 Bacteria 4609
203 Ga0373933_0227821 3300035724 Bacteria 1197
204 Ga0373933_0267414 3300035724 Unclassified 1103
205 Ga0373947_0218597 3300035725 Bacteria 1252
206 Ga0373937_0194546 3300036401 Unclassified 1906
207 Ga0373937_0207590 3300036401 Bacteria 1842
208 Ga0373937_1475555 3300036401 Unclassified 628
209 Ga0439449_0069368 3300042007 Bacteria 1300
210 Ga0450905_064938 3300042142 Bacteria 615
211 Ga0439446_0055377 3300042156 Unclassified 1191
212 Ga0439434_0079589 3300042435 Bacteria 1039
213 Ga0466967_1646055 3300045976 Unclassified 639
214 Ga0495592_0023026 3300046454 Bacteria 4739
215 Ga0495603_0166869 3300046455 Bacteria 1276
216 Ga0495651_0006736 3300046462 Bacteria 8785
217 Ga0495651_0091166 3300046462 Bacteria 2285
218 Ga0495651_0100517 3300046462 Bacteria 2154
219 Ga0495651_0706159 3300046462 Bacteria 628
220 Ga0495653_0121593 3300046463 Bacteria 1860
221 Ga0495580_0000506 3300046472 Bacteria 32778
222 Ga0495580_0295814 3300046472 Bacteria 1103
223 Ga0495582_0598968 3300046473 Unclassified 638
224 Ga0495639_0458865 3300046475 Bacteria 648
225 Ga0495662_0176682 3300046476 Bacteria 1052
226 Ga0495664_0004535 3300046477 Bacteria 7596
227 Ga0495664_0559429 3300046477 Unclassified 681
228 Ga0495608_0255131 3300046511 Bacteria 1093
229 Ga0495618_0158911 3300046514 Bacteria 1441
230 Ga0495628_0042474 3300046516 Bacteria 3626
231 Ga0495628_0052656 3300046516 Bacteria 3215
232 Ga0495628_0310319 3300046516 Bacteria 1166
233 Ga0495630_0336522 3300046517 Bacteria 1154
234 Ga0495644_0150117 3300046523 Bacteria 892
235 Ga0495652_0024325 3300046529 Bacteria 5362
236 Ga0495652_0219395 3300046529 Bacteria 1430
237 Ga0495652_0293118 3300046529 Bacteria 1186
238 Ga0495652_0489158 3300046529 Unclassified 855
239 Ga0495665_0238316 3300046531 Bacteria 938
240 Ga0495665_0348666 3300046531 Bacteria 754
241 Ga0495640_0055338 3300046533 Bacteria 2714
242 Ga0495640_0070980 3300046533 Bacteria 2338
243 Ga0495587_0029794 3300046536 Bacteria 3312
244 Ga0495587_0368622 3300046536 Unclassified 799
245 Ga0495645_0005158 3300046543 Bacteria 8943
246 Ga0495645_0436545 3300046543 Unclassified 828
247 Ga0495667_0010653 3300046559 Bacteria 6216
248 Ga0495667_0250809 3300046559 Bacteria 1126
249 Ga0495634_0021672 3300046642 Bacteria 4537
250 Ga0495635_0981383 3300046663 Unclassified 538
251 Ga0495657_0094213 3300046675 Bacteria 1916
252 Ga0495657_0843845 3300046675 Unclassified 522
253 Ga0495599_0027940 3300046678 Bacteria 3534
254 Ga0495599_0647829 3300046678 Bacteria 612
255 Ga0495623_0016168 3300046679 Bacteria 4820
256 Ga0495623_0063145 3300046679 Unclassified 2320
257 Ga0495623_0110782 3300046679 Bacteria 1663
258 Ga0495623_0114307 3300046679 Bacteria 1632
259 Ga0495646_0150839 3300046680 Unclassified 1293
260 Ga0495646_0207669 3300046680 Bacteria 1064
261 Ga0495669_0324599 3300046684 Bacteria 743
262 Ga0495613_0243932 3300046689 Bacteria 1255
263 Ga0495600_0020858 3300046809 Bacteria 4193
264 Ga0495604_0067552 3300047317 Bacteria 2716
265 Ga0495604_0079580 3300047317 Bacteria 2458
266 Ga0495604_0267413 3300047317 Bacteria 1160
267 Ga0495636_0317480 3300047318 Bacteria 731
268 Ga0495636_0455201 3300047318 Unclassified 615
269 Ga0495674_0008114 3300047319 Bacteria 10022
270 Ga0495674_0062826 3300047319 Bacteria 3232
271 Ga0495674_0683010 3300047319 Bacteria 807
272 Ga0495680_0131534 3300047322 Bacteria 1838
273 Ga0495675_0118206 3300047444 Unclassified 1652
274 Ga0495675_0479608 3300047444 Bacteria 716
275 Ga0495684_0019664 3300047471 Bacteria 5203
276 Ga0495684_0022505 3300047471 Bacteria 4848
277 Ga0495684_0100098 3300047471 Bacteria 2191
278 Ga0495602_0255883 3300048088 Bacteria 1302
279 Ga0495602_0283680 3300048088 Unclassified 1219
280 Ga0495602_0295924 3300048088 Unclassified 1186
281 Ga0495602_0320346 3300048088 Bacteria 1128
282 Ga0496114_0594889 3300048917 Bacteria 976
283 Ga0496115_0630244 3300048918 Bacteria 850
284 Ga0501036_0396665 3300049572 Bacteria 1151
285 Ga0501038_0214402 3300049574 Bacteria 1539
286 Ga0501039_0198181 3300049575 Bacteria 1579
287 Ga0501040_0189259 3300049576 Bacteria 1460
288 Ga0501041_0061919 3300049577 Bacteria 2291
289 Ga0501042_0873117 3300049578 Bacteria 655
290 Ga0501043_0189542 3300049579 Bacteria 1600
291 Ga0501071_0212051 3300049587 Bacteria 1456
292 Ga0501075_0220270 3300049591 Bacteria 1447
293 Ga0501075_0232682 3300049591 Bacteria 1405
294 Ga0501076_0521063 3300049592 Bacteria 980
295 Ga0501077_0028530 3300049593 Bacteria 3547
296 Ga0501077_0426231 3300049593 Bacteria 849
297 Ga0501080_0133800 3300049742 Bacteria 2295
298 Ga0501080_1333343 3300049742 Unclassified 614
299 Ga0501081_0099971 3300049743 Bacteria 2050
300 Ga0501081_0200916 3300049743 Bacteria 1445
301 Ga0501045_0314449 3300049824 Bacteria 1165
302 Ga0501045_0464412 3300049824 Unclassified 941
303 nmdc:mga05p37_1067278_c1 3300050507 Unclassified 850
304 nmdc:mga05p37_12726_c1 3300050507 Bacteria 10058
305 nmdc:mga05p37_138142_c1 3300050507 Bacteria 2987
306 nmdc:mga05p37_181354_c1 3300050507 Bacteria 2561
307 nmdc:mga05p37_396_c1 3300050507 Bacteria 47293
308 nmdc:mga05p37_410656_c1 3300050507 Unclassified 1578
309 nmdc:mga05p37_684121_c1 3300050507 Bacteria 1143
310 nmdc:mga05p37_84352_c1 3300050507 Bacteria 3914
311 nmdc:mga09592_14077_c1 3300050508 Bacteria 6531
312 nmdc:mga09592_217352_c1 3300050508 Bacteria 1656
313 nmdc:mga09592_220742_c1 3300050508 Bacteria 1642
314 nmdc:mga0qj67_24311_c1 3300050509 Bacteria 4669
315 nmdc:mga06r32_56556_c1 3300050510 Bacteria 3766
316 nmdc:mga06r32_84536_c1 3300050510 Bacteria 3093
317 nmdc:mga08y16_1198512_c1 3300050511 Unclassified 730
318 nmdc:mga08y16_207111_c1 3300050511 Bacteria 2032
319 nmdc:mga0n895_103447_c1 3300050512 Bacteria 2860
320 nmdc:mga0n895_11195_c1 3300050512 Bacteria 7988
321 nmdc:mga0n895_336406_c1 3300050512 Unclassified 1529
322 nmdc:mga0rr50_251974_c1 3300050513 Bacteria 1467
323 nmdc:mga08x19_436193_c1 3300050514 Bacteria 921
324 nmdc:mga0a205_148256_c1 3300050515 Bacteria 2246
325 nmdc:mga0a205_157207_c1 3300050515 Bacteria 2172
326 nmdc:mga0a205_172317_c1 3300050515 Unclassified 2060
327 Ga0495601_0162803 3300053077 Bacteria 1458
328 Ga0590074_005507 3300059423 Bacteria 2098
329 Ga0590075_001777 3300059424 Bacteria 5279
330 Ga0590077_001558 3300059426 Bacteria 5291
331 Ga0501082_0001335 3300060353 Bacteria 21627
332 Ga0501082_0260646 3300060353 Bacteria 1508
333 Ga0530510_0764230 3300061734 Unclassified 737
334 Ga0451576_0098016
335 rootL2_10272843
336 Ga0070676_10632912
337 Ga0070683_100000005
338 Ga0070683_100313582
339 Ga0068869_100963147
340 Ga0070666_10364966
341 Ga0068868_101525808
342 Ga0070660_100405745
343 Ga0070689_100322401
344 Ga0070689_100471972
345 Ga0070687_100158116
346 Ga0070692_10147297
347 Ga0070671_100795741
348 Ga0070673_100960389
349 Ga0070688_100535933
350 Ga0070667_100311239
351 Ga0070667_100702099
352 Ga0070703_10003553
353 Ga0070713_100138685
354 Ga0070705_100063830
355 Ga0070700_100386896
356 Ga0070694_100054558
357 Ga0070694_100062880
358 Ga0070694_101786144
359 Ga0070708_100560637
360 Ga0070678_100133399
361 Ga0068867_100188341
362 Ga0070685_10227515
363 Ga0070706_100080371
364 Ga0070706_100129438
365 Ga0070707_100019468
366 Ga0070698_100147247
367 Ga0070698_100222890
368 Ga0070684_100000053
369 Ga0070684_101258705
370 Ga0070695_100025648
371 Ga0070665_100209756
372 Ga0070665_100247510
373 Ga0070665_100568755
374 Ga0070704_100013334
375 Ga0070704_100169043
376 Ga0068855_100286820
377 Ga0068857_101589966
378 Ga0068859_100228424
379 Ga0068859_100472314
380 Ga0068859_100743842
381 Ga0068864_100285459
382 Ga0068864_100621347
383 Ga0068861_100194841
384 Ga0068861_100622831
385 Ga0068858_100002712
386 Ga0068858_100090462
387 Ga0068858_100310777
388 Ga0068860_100201698
389 Ga0068860_100296114
390 Ga0068862_100062179
391 Ga0075365_10110305
392 Ga0075432_10095633
393 Ga0097621_100528955
394 Ga0068871_100330781
395 Ga0068871_100830935
396 Ga0075428_100007210
397 Ga0075428_100018619
398 Ga0075428_100037889
399 Ga0075428_100222559
400 Ga0075430_100009737
401 Ga0075431_100004571
402 Ga0075431_100124802
403 Ga0075431_100298279
404 Ga0075431_100618687
405 Ga0075433_10127442
406 Ga0075433_10155163
407 Ga0075433_10182118
408 Ga0075433_10651349
409 Ga0075434_100003453
410 Ga0075434_100239630
411 Ga0075434_100473915
412 Ga0075434_100956439
413 Ga0075429_100001699
414 Ga0075429_100068718
415 Ga0075429_100186757
416 Ga0075429_101220503
417 Ga0075436_100007975
418 Ga0075436_100339347
419 Ga0097620_100228424
420 Ga0097620_100472302
421 Ga0097620_100743900
422 Ga0075435_100001570
423 Ga0075435_100027259
424 Ga0075435_100079552
425 Ga0105240_10470642
426 Ga0111539_10231871
427 Ga0111539_10384971
428 Ga0105245_10121755
429 Ga0105245_10662743
430 Ga0105247_10017135
431 Ga0114129_10008269
432 Ga0114129_10011401
433 Ga0114129_10043154
434 Ga0114129_10167427
435 Ga0114129_10176866
436 Ga0114129_10993992
437 Ga0114129_11019309
438 Ga0105243_10101495
439 Ga0105243_10739196
440 Ga0105241_11350285
441 Ga0105242_10007414
442 Ga0105248_10065345
443 Ga0105248_10269939
444 Ga0105248_10306206
445 Ga0105248_10522750
446 Ga0105248_11100209
447 Ga0105238_10391236
448 Ga0105238_10425013
449 Ga0105238_11346706
450 Ga0105249_10194177
451 Ga0105246_10132886
452 Ga0157370_11158084
453 Ga0157369_10266469
454 Ga0157378_11847815
455 Ga0163162_10825324
456 Ga0163162_11099598
457 Ga0157372_10305840
458 Ga0157375_10402296
459 Ga0157375_10888047
460 Ga0157375_10894068
461 Ga0163163_10044647
462 Ga0163163_10827126
463 Ga0163163_11772975
464 Ga0157380_10007975
465 Ga0157380_10622168
466 Ga0157379_10059687
467 Ga0157376_10241078
468 Ga0157376_10654369
469 Ga0157376_10670793
470 Ga0197907_11241240
471 Ga0206354_10789022
472 Ga0207653_10054164
473 Ga0207653_10148341
474 Ga0207710_10024395
475 Ga0207684_10041050
476 Ga0207695_10370132
477 Ga0207660_10195337
478 Ga0207657_10560699
479 Ga0207706_10125444
480 Ga0207686_10024542
481 Ga0207709_10024939
482 Ga0207670_10123474
483 Ga0207670_10159266
484 Ga0207711_10659557
485 Ga0207661_10000031
486 Ga0207667_10144921
487 Ga0207651_10210694
488 Ga0207712_10494934
489 Ga0207677_11102725
490 Ga0207677_11360891
491 Ga0207703_10005660
492 Ga0207703_10047484
493 Ga0207703_10150336
494 Ga0207639_10652311
495 Ga0207708_10516202
496 Ga0207641_10443655
497 Ga0207641_10731366
498 Ga0207648_10227538
499 Ga0207676_10480325
500 Ga0207676_10608920
501 Ga0207675_100057674
502 Ga0207675_100553545
503 Ga0207428_10322257
504 Ga0268266_10710932
505 Ga0268266_10781307
506 Ga0268265_10087612
507 Ga0268264_10175660
508 Ga0268264_10302416
509 Ga0268264_10781513
510 Ga0265331_10056756
511 Ga0265316_10584848
512 Ga0307408_101476260
513 Ga0307405_10159611
514 Ga0307413_10091328
515 Ga0307410_11260294
516 Ga0307406_10589736
517 Ga0307412_10143877
518 Ga0307412_11324325
519 Ga0307416_100477283
520 Ga0307416_100754221
521 Ga0307414_11074141
522 Ga0307411_10119790
523 Ga0307415_100079358
524 Ga0373936_0236855
525 Ga0373953_0387636
526 Ga0373954_0016854
527 Ga0373954_0085682
528 Ga0373956_0304730
529 Ga0373943_0782024
530 Ga0373946_0170952
531 Ga0373955_0160455
532 Ga0373924_0140481
533 Ga0373931_0314925
534 Ga0373927_0559942
535 Ga0373933_0012981
536 Ga0373933_0227821
537 Ga0373933_0267414
538 Ga0373947_0218597
539 Ga0373937_0194546
540 Ga0373937_0207590
541 Ga0373937_1475555
542 Ga0439449_0069368
543 Ga0450905_064938
544 Ga0439446_0055377
545 Ga0439434_0079589
546 Ga0466967_1646055
547 Ga0495592_0023026
548 Ga0495603_0166869
549 Ga0495651_0006736
550 Ga0495651_0091166
551 Ga0495651_0100517
552 Ga0495651_0706159
553 Ga0495653_0121593
554 Ga0495580_0000506
555 Ga0495580_0295814
556 Ga0495582_0598968
557 Ga0495639_0458865
558 Ga0495662_0176682
559 Ga0495664_0004535
560 Ga0495664_0559429
561 Ga0495608_0255131
562 Ga0495618_0158911
563 Ga0495628_0042474
564 Ga0495628_0052656
565 Ga0495628_0310319
566 Ga0495630_0336522
567 Ga0495644_0150117
568 Ga0495652_0024325
569 Ga0495652_0219395
570 Ga0495652_0293118
571 Ga0495652_0489158
572 Ga0495665_0238316
573 Ga0495665_0348666
574 Ga0495640_0055338
575 Ga0495640_0070980
576 Ga0495587_0029794
577 Ga0495587_0368622
578 Ga0495645_0005158
579 Ga0495645_0436545
580 Ga0495667_0010653
581 Ga0495667_0250809
582 Ga0495634_0021672
583 Ga0495635_0981383
584 Ga0495657_0094213
585 Ga0495657_0843845
586 Ga0495599_0027940
587 Ga0495599_0647829
588 Ga0495623_0016168
589 Ga0495623_0063145
590 Ga0495623_0110782
591 Ga0495623_0114307
592 Ga0495646_0150839
593 Ga0495646_0207669
594 Ga0495669_0324599
595 Ga0495613_0243932
596 Ga0495600_0020858
597 Ga0495604_0067552
598 Ga0495604_0079580
599 Ga0495604_0267413
600 Ga0495636_0317480
601 Ga0495636_0455201
602 Ga0495674_0008114
603 Ga0495674_0062826
604 Ga0495674_0683010
605 Ga0495680_0131534
606 Ga0495675_0118206
607 Ga0495675_0479608
608 Ga0495684_0019664
609 Ga0495684_0022505
610 Ga0495684_0100098
611 Ga0495602_0255883
612 Ga0495602_0283680
613 Ga0495602_0295924
614 Ga0495602_0320346
615 Ga0496114_0594889
616 Ga0496115_0630244
617 Ga0501036_0396665
618 Ga0501038_0214402
619 Ga0501039_0198181
620 Ga0501040_0189259
621 Ga0501041_0061919
622 Ga0501042_0873117
623 Ga0501043_0189542
624 Ga0501071_0212051
625 Ga0501075_0220270
626 Ga0501075_0232682
627 Ga0501076_0521063
628 Ga0501077_0028530
629 Ga0501077_0426231
630 Ga0501080_0133800
631 Ga0501080_1333343
632 Ga0501081_0099971
633 Ga0501081_0200916
634 Ga0501045_0314449
635 Ga0501045_0464412
636 nmdc:mga05p37_1067278_c1
637 nmdc:mga05p37_12726_c1
638 nmdc:mga05p37_138142_c1
639 nmdc:mga05p37_181354_c1
640 nmdc:mga05p37_396_c1
641 nmdc:mga05p37_410656_c1
642 nmdc:mga05p37_684121_c1
643 nmdc:mga05p37_84352_c1
644 nmdc:mga09592_14077_c1
645 nmdc:mga09592_217352_c1
646 nmdc:mga09592_220742_c1
647 nmdc:mga0qj67_24311_c1
648 nmdc:mga06r32_56556_c1
649 nmdc:mga06r32_84536_c1
650 nmdc:mga08y16_1198512_c1
651 nmdc:mga08y16_207111_c1
652 nmdc:mga0n895_103447_c1
653 nmdc:mga0n895_11195_c1
654 nmdc:mga0n895_336406_c1
655 nmdc:mga0rr50_251974_c1
656 nmdc:mga08x19_436193_c1
657 nmdc:mga0a205_148256_c1
658 nmdc:mga0a205_157207_c1
659 nmdc:mga0a205_172317_c1
660 Ga0495601_0162803
661 Ga0590074_005507
662 Ga0590075_001777
663 Ga0590077_001558
664 Ga0501082_0001335
665 Ga0501082_0260646
666 Ga0530510_0764230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

51

155

0.89

PF12680

SnoaL_2

SnoaL-like domain

56

156

0.86

PF13474

SnoaL_3

SnoaL-like domain

51

159

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8of7-assembly1.cif.gz_B cyc15 diels alderase 0.8587 86 127
7v2w-assembly1.cif.gz_H protomer structure from the dimer of yeast tho complex 0.8283 87 136
6bju-assembly2.cif.gz_D the structure of atzh: a little known member of the atrazine breakdown pathway 0.8229 24 138
5llk-assembly1.cif.gz_A crystal structure of human alpha-dystroglycan 0.8095 117 138
4i4k-assembly1.cif.gz_B streptomyces globisporus c-1027 9-membered enediyne conserved protein sgce6 0.8065 27 143
ID Description Score Start End Superfamily
af_A0A0P0WX24_155_238_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8555 116 139 3.30.420.10
af_P08937_17_172_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8448 88 133 2.40.128.20
af_Q8RYS9_157_289_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8195 22 144 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8073 21 140 3.10.450.50
af_P39108_1_372_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.807 88 140 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A349LT56-F1-model_v4 DUF4440 domain-containing protein 1 22 140
AF-A0A3N5QF76-F1-model_v4 Nuclear transport factor 2 family protein 0.9894 21 142
AF-A0A0Q5HEE0-F1-model_v4 Ketosteroid isomerase 0.9866 18 139 GO:0016853
AF-A0A5C7PR23-F1-model_v4 Nuclear transport factor 2 family protein 0.9816 22 140
AF-A0A8A7V7T5-F1-model_v4 deleted 0.9797 27 142

Map