F411336

General Info

Members Datasets Scaffolds Average Seq Length
333 197 333 102

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10871104|Ga0114129_108711042
Length 123
Sequence MFRRGLPDGARRPDGHCRERRSDMVKVALWVRLEAKAGKEADVERFLRGGLPLVQAEPDTTAWFGVRLGPSTFAIFDAFPDEAGRNAHLSGRVAAALKEKASELFAKPPTIEKVEVLAAKLPG

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
140 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 6.01
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10077485 3300003322 Bacteria 1770
2 rootH1_10230848 3300003323 Bacteria 1359
3 Ga0055536_1000013 3300003781 Bacteria 240693
4 Ga0055530_10000648 3300003791 Bacteria 29930
5 Ga0055540_1000008 3300003792 Bacteria 309635
6 Ga0055531_10000242 3300003794 Bacteria 59638
7 Ga0058860_11982111 3300004801 Bacteria 798
8 Ga0058862_12195488 3300004803 Bacteria 683
9 Ga0065712_10138851 3300005290 Bacteria 1470
10 Ga0065715_10423373 3300005293 Bacteria 831
11 Ga0065707_11083214 3300005295 Bacteria 519
12 Ga0070658_10912311 3300005327 Bacteria 764
13 Ga0070676_10340205 3300005328 Bacteria 1029
14 Ga0070677_10593453 3300005333 Unclassified 612
15 Ga0070666_10157752 3300005335 Bacteria 1585
16 Ga0070680_100084500 3300005336 Bacteria 2621
17 Ga0070687_100122687 3300005343 Unclassified 1488
18 Ga0070675_101049064 3300005354 Unclassified 749
19 Ga0070675_101257640 3300005354 Bacteria 682
20 Ga0070671_100171295 3300005355 Bacteria 1836
21 Ga0070674_100564174 3300005356 Bacteria 957
22 Ga0070709_10351182 3300005434 Unclassified 1090
23 Ga0070714_100512902 3300005435 Bacteria 1144
24 Ga0070714_100907377 3300005435 Bacteria 856
25 Ga0070714_101338771 3300005435 Unclassified 699
26 Ga0070713_100352585 3300005436 Unclassified 1365
27 Ga0070713_101480139 3300005436 Unclassified 659
28 Ga0070710_10034327 3300005437 Unclassified 2759
29 Ga0070711_100037199 3300005439 Unclassified 3264
30 Ga0070711_100066602 3300005439 Bacteria 2524
31 Ga0070711_101606467 3300005439 Bacteria 569
32 Ga0070705_101310965 3300005440 Bacteria 601
33 Ga0070694_100424624 3300005444 Unclassified 1045
34 Ga0070694_101264469 3300005444 Bacteria 620
35 Ga0070708_100005127 3300005445 Bacteria 10372
36 Ga0070708_100009287 3300005445 Bacteria 7924
37 Ga0070708_100178108 3300005445 Unclassified 1987
38 Ga0070708_100504237 3300005445 Bacteria 1142
39 Ga0070708_101022742 3300005445 Unclassified 775
40 Ga0070663_100785894 3300005455 Bacteria 815
41 Ga0070678_100230853 3300005456 Bacteria 1543
42 Ga0070678_100250393 3300005456 Bacteria 1485
43 Ga0070678_100379378 3300005456 Unclassified 1223
44 Ga0070678_101073212 3300005456 Bacteria 743
45 Ga0070662_100231565 3300005457 Bacteria 1478
46 Ga0070681_10047835 3300005458 Unclassified 4275
47 Ga0070681_10068109 3300005458 Bacteria 3527
48 Ga0070706_100004720 3300005467 Bacteria 13066
49 Ga0070706_100047782 3300005467 Bacteria 3950
50 Ga0070706_100048021 3300005467 Bacteria 3940
51 Ga0070706_100049298 3300005467 Bacteria 3887
52 Ga0070706_100227056 3300005467 Bacteria 1743
53 Ga0070706_100246896 3300005467 Bacteria 1667
54 Ga0070706_100253869 3300005467 Bacteria 1642
55 Ga0070706_100257335 3300005467 Bacteria 1630
56 Ga0070706_100401807 3300005467 Bacteria 1275
57 Ga0070706_100428213 3300005467 Bacteria 1231
58 Ga0070707_100007427 3300005468 Bacteria 10176
59 Ga0070707_100020526 3300005468 Bacteria 6234
60 Ga0070707_100088099 3300005468 Bacteria 3003
61 Ga0070707_100096357 3300005468 Bacteria 2866
62 Ga0070707_100186666 3300005468 Bacteria 2021
63 Ga0070707_100189990 3300005468 Bacteria 2002
64 Ga0070707_101557825 3300005468 Bacteria 628
65 Ga0070698_100022137 3300005471 Bacteria 6653
66 Ga0070698_100026816 3300005471 Bacteria 5992
67 Ga0070698_100050282 3300005471 Unclassified 4251
68 Ga0070698_100345252 3300005471 Bacteria 1420
69 Ga0070698_100531379 3300005471 Bacteria 1115
70 Ga0070698_100618733 3300005471 Bacteria 1024
71 Ga0070699_100058531 3300005518 Bacteria 3338
72 Ga0070699_100147335 3300005518 Bacteria 2080
73 Ga0070699_100623571 3300005518 Bacteria 984
74 Ga0070679_100097098 3300005530 Bacteria 2934
75 Ga0070679_100214450 3300005530 Bacteria 1888
76 Ga0070697_100022231 3300005536 Bacteria 5033
77 Ga0070697_100025358 3300005536 Bacteria 4730
78 Ga0070697_100146131 3300005536 Bacteria 1990
79 Ga0070697_100188981 3300005536 Bacteria 1748
80 Ga0070697_100574895 3300005536 Unclassified 989
81 Ga0070697_100870604 3300005536 Bacteria 798
82 Ga0068853_100203084 3300005539 Bacteria 1804
83 Ga0070672_101277018 3300005543 Unclassified 655
84 Ga0070695_100407141 3300005545 Bacteria 1033
85 Ga0070695_100451368 3300005545 Bacteria 985
86 Ga0070695_100468156 3300005545 Bacteria 969
87 Ga0070696_100780516 3300005546 Unclassified 785
88 Ga0070665_100220165 3300005548 Bacteria 1898
89 Ga0070665_100487997 3300005548 Bacteria 1243
90 Ga0070704_100027586 3300005549 Bacteria 3769
91 Ga0070704_100184533 3300005549 Bacteria 1671
92 Ga0068852_101224083 3300005616 Bacteria 772
93 Ga0068859_101068893 3300005617 Bacteria 887
94 Ga0068859_102346118 3300005617 Bacteria 588
95 Ga0068864_100452025 3300005618 Bacteria 1229
96 Ga0068858_100751009 3300005842 Bacteria 950
97 Ga0068860_102083204 3300005843 Bacteria 589
98 Ga0068862_100674360 3300005844 Bacteria 999
99 Ga0070717_10037057 3300006028 Bacteria 3958
100 Ga0070717_10062132 3300006028 Bacteria 3097
101 Ga0070717_10402602 3300006028 Bacteria 1230
102 Ga0070717_10794199 3300006028 Unclassified 861
103 Ga0075364_10837032 3300006051 Bacteria 627
104 Ga0075432_10098497 3300006058 Unclassified 1078
105 Ga0075432_10130009 3300006058 Bacteria 953
106 Ga0070715_10040003 3300006163 Bacteria 1957
107 Ga0070716_100028595 3300006173 Unclassified 3005
108 Ga0070716_100367615 3300006173 Bacteria 1024
109 Ga0070712_100041469 3300006175 Bacteria 3160
110 Ga0070712_100121843 3300006175 Bacteria 1963
111 Ga0070712_100293103 3300006175 Bacteria 1314
112 Ga0070712_100549078 3300006175 Unclassified 973
113 Ga0070712_100924865 3300006175 Bacteria 753
114 Ga0097621_100243675 3300006237 Unclassified 1572
115 Ga0075428_102426113 3300006844 Bacteria 538
116 Ga0075433_10724550 3300006852 Bacteria 870
117 Ga0075433_10908346 3300006852 Bacteria 768
118 Ga0075433_11540596 3300006852 Bacteria 574
119 Ga0075433_11681221 3300006852 Bacteria 547
120 Ga0075434_100235459 3300006871 Bacteria 1851
121 Ga0075434_100647848 3300006871 Bacteria 1075
122 Ga0075434_100785697 3300006871 Bacteria 968
123 Ga0075429_101101468 3300006880 Bacteria 694
124 Ga0068865_101683902 3300006881 Unclassified 571
125 Ga0075436_100054623 3300006914 Bacteria 2757
126 Ga0075436_100193205 3300006914 Bacteria 1440
127 Ga0097620_101068941 3300006931 Bacteria 887
128 Ga0097620_102346166 3300006931 Bacteria 588
129 Ga0075435_100003103 3300007076 Bacteria 11224
130 Ga0075435_100363551 3300007076 Bacteria 1242
131 Ga0075435_100402011 3300007076 Bacteria 1178
132 Ga0075435_100421407 3300007076 Bacteria 1150
133 Ga0114129_10348418 3300009147 Bacteria 1963
134 Ga0114129_10543140 3300009147 Bacteria 1512
135 Ga0114129_10871104 3300009147 Bacteria 1143
136 Ga0114129_11662532 3300009147 Unclassified 780
137 Ga0105243_10000098 3300009148 Bacteria 99914
138 Ga0105242_10244279 3300009176 Bacteria 1615
139 Ga0105242_10838220 3300009176 Bacteria 914
140 Ga0105248_10561724 3300009177 Bacteria 1287
141 Ga0105249_11813088 3300009553 Bacteria 683
142 Ga0105249_12426045 3300009553 Bacteria 597
143 Ga0099796_10191156 3300010159 Bacteria 826
144 Ga0099796_10213158 3300010159 Bacteria 788
145 Ga0105239_10034935 3300010375 Bacteria 5521
146 Ga0105239_12756743 3300010375 Unclassified 574
147 Ga0105246_10006334 3300011119 Bacteria 7226
148 Ga0157371_11136474 3300013102 Bacteria 600
149 Ga0157374_10290950 3300013296 Bacteria 1614
150 Ga0163162_10629034 3300013306 Bacteria 1198
151 Ga0163162_11599326 3300013306 Bacteria 743
152 Ga0157372_10036823 3300013307 Bacteria 5395
153 Ga0157375_10821151 3300013308 Bacteria 1078
154 Ga0157380_13449606 3300014326 Bacteria 506
155 Ga0182008_10024465 3300014497 Bacteria 3075
156 Ga0157379_10627577 3300014968 Bacteria 1005
157 Ga0157376_10002306 3300014969 Bacteria 12892
158 Ga0157376_10549214 3300014969 Unclassified 1143
159 Ga0182007_10090224 3300015262 Bacteria 1009
160 Ga0182005_1044207 3300015265 Bacteria 1211
161 Ga0207425_1015966 3300025245 Bacteria 1675
162 Ga0209025_1044165 3300025294 Bacteria 1867
163 Ga0207696_1000002 3300025711 Bacteria 1098043
164 Ga0207655_1000080 3300025728 Bacteria 214570
165 Ga0207655_1020096 3300025728 Bacteria 3455
166 Ga0207692_10695868 3300025898 Unclassified 659
167 Ga0207692_10877631 3300025898 Unclassified 589
168 Ga0207680_10046432 3300025903 Bacteria 2568
169 Ga0207699_10097393 3300025906 Unclassified 1859
170 Ga0207699_11414970 3300025906 Unclassified 514
171 Ga0207684_10000285 3300025910 Bacteria 73299
172 Ga0207684_10008062 3300025910 Bacteria 9400
173 Ga0207684_10021308 3300025910 Bacteria 5534
174 Ga0207684_10040492 3300025910 Bacteria 3950
175 Ga0207684_10053402 3300025910 Bacteria 3430
176 Ga0207684_10106122 3300025910 Bacteria 2403
177 Ga0207684_10214711 3300025910 Bacteria 1660
178 Ga0207684_10413617 3300025910 Bacteria 1159
179 Ga0207684_10449526 3300025910 Bacteria 1106
180 Ga0207684_10472256 3300025910 Bacteria 1076
181 Ga0207684_11147541 3300025910 Unclassified 645
182 Ga0207654_11294707 3300025911 Unclassified 531
183 Ga0207707_10026512 3300025912 Bacteria 5065
184 Ga0207693_10024709 3300025915 Unclassified 4765
185 Ga0207693_10056333 3300025915 Bacteria 3082
186 Ga0207693_10334568 3300025915 Bacteria 1185
187 Ga0207693_10457477 3300025915 Unclassified 997
188 Ga0207663_10074586 3300025916 Unclassified 2199
189 Ga0207663_10150664 3300025916 Unclassified 1631
190 Ga0207663_10851452 3300025916 Bacteria 728
191 Ga0207662_10102446 3300025918 Bacteria 1775
192 Ga0207652_10144776 3300025921 Bacteria 2126
193 Ga0207652_10481090 3300025921 Bacteria 1118
194 Ga0207646_10009700 3300025922 Bacteria 9491
195 Ga0207646_10085290 3300025922 Bacteria 2825
196 Ga0207646_10116640 3300025922 Bacteria 2398
197 Ga0207646_10145683 3300025922 Bacteria 2134
198 Ga0207646_10164367 3300025922 Bacteria 2004
199 Ga0207646_10393341 3300025922 Bacteria 1252
200 Ga0207646_10488407 3300025922 Bacteria 1110
201 Ga0207700_10225086 3300025928 Unclassified 1592
202 Ga0207700_11131838 3300025928 Unclassified 699
203 Ga0207700_11244821 3300025928 Unclassified 664
204 Ga0207664_10568607 3300025929 Bacteria 1017
205 Ga0207664_11127962 3300025929 Unclassified 701
206 Ga0207644_10268276 3300025931 Unclassified 1367
207 Ga0207706_10116645 3300025933 Bacteria 2348
208 Ga0207686_10980740 3300025934 Bacteria 685
209 Ga0207709_10000011 3300025935 Bacteria 552881
210 Ga0207669_10372023 3300025937 Unclassified 1111
211 Ga0207665_10082429 3300025939 Unclassified 2217
212 Ga0207691_10329750 3300025940 Bacteria 1308
213 Ga0207689_10815878 3300025942 Bacteria 787
214 Ga0207667_11632257 3300025949 Bacteria 613
215 Ga0207712_11331425 3300025961 Bacteria 642
216 Ga0207703_10336018 3300026035 Bacteria 1387
217 Ga0207639_10581714 3300026041 Bacteria 1031
218 Ga0207641_10127971 3300026088 Bacteria 2276
219 Ga0207683_10084657 3300026121 Bacteria 2819
220 Ga0207683_10270399 3300026121 Unclassified 1552
221 Ga0207683_10469899 3300026121 Unclassified 1160
222 Ga0209970_1089952 3300027614 Bacteria 581
223 Ga0207428_10912437 3300027907 Unclassified 620
224 Ga0268266_10150918 3300028379 Bacteria 2094
225 Ga0268266_12356559 3300028379 Unclassified 503
226 Ga0268264_11878728 3300028381 Bacteria 609
227 Ga0265760_10042765 3300031090 Bacteria 1353
228 Ga0265328_10074292 3300031239 Bacteria 1250
229 Ga0265316_10336396 3300031344 Bacteria 1095
230 Ga0316579_10029995 3300031691 Bacteria 2483
231 Ga0307405_10222355 3300031731 Bacteria 1386
232 Ga0307405_10865560 3300031731 Unclassified 762
233 Ga0307414_10014222 3300032004 Bacteria 4762
234 Ga0373928_0142633 3300035084 Bacteria 658
235 Ga0373951_0239317 3300035091 Unclassified 542
236 Ga0373939_0032745 3300035114 Bacteria 1513
237 Ga0373960_0392180 3300035121 Bacteria 534
238 Ga0373943_0133233 3300035170 Bacteria 1332
239 Ga0373931_1177496 3300035691 Unclassified 524
240 Ga0373935_0668602 3300035692 Unclassified 763
241 Ga0316582_0073289 3300036647 Bacteria 2222
242 Ga0436365_0580786 3300039437 Bacteria 1845
243 Ga0439447_012543 3300041407 Bacteria 2432
244 Ga0439432_000019 3300042006 Bacteria 60642
245 Ga0439451_101306 3300042009 Bacteria 582
246 Ga0439463_000879 3300042016 Bacteria 8278
247 Ga0450902_022260 3300042137 Bacteria 1049
248 Ga0450904_023727 3300042139 Bacteria 628
249 Ga0450905_015759 3300042142 Bacteria 1086
250 Ga0495617_278609 3300046452 Bacteria 512
251 Ga0495592_0141535 3300046454 Bacteria 1673
252 Ga0495590_0005142 3300046457 Bacteria 5205
253 Ga0495591_100551 3300046458 Bacteria 717
254 Ga0495638_0000129 3300046460 Bacteria 123549
255 Ga0495651_0511198 3300046462 Unclassified 768
256 Ga0495605_0007848 3300046474 Bacteria 6046
257 Ga0495584_0032142 3300046491 Bacteria 2657
258 Ga0495584_0038425 3300046491 Bacteria 2419
259 Ga0495585_0182639 3300046492 Bacteria 1077
260 Ga0495607_0046915 3300046501 Bacteria 2533
261 Ga0495616_0040542 3300046513 Bacteria 2378
262 Ga0495628_0428787 3300046516 Bacteria 963
263 Ga0495632_0014722 3300046519 Bacteria 4413
264 Ga0495643_0035688 3300046522 Bacteria 2736
265 Ga0495644_0000024 3300046523 Bacteria 76102
266 Ga0495654_0003647 3300046530 Bacteria 9354
267 Ga0495597_0000986 3300046542 Bacteria 21941
268 Ga0495656_0369597 3300046615 Bacteria 746
269 Ga0495611_0001487 3300046648 Bacteria 11647
270 Ga0495599_0442545 3300046678 Bacteria 770
271 Ga0495623_0361480 3300046679 Unclassified 789
272 Ga0495671_0152312 3300046692 Bacteria 1125
273 Ga0495649_0000152 3300046694 Bacteria 60670
274 Ga0495589_0000387 3300046794 Bacteria 33666
275 Ga0495672_0029237 3300047320 Bacteria 3474
276 Ga0495672_0040668 3300047320 Bacteria 2817
277 Ga0495672_0335521 3300047320 Bacteria 706
278 Ga0495683_0077024 3300047323 Bacteria 1630
279 Ga0495615_0001156 3300048090 Bacteria 3812
280 Ga0495626_0006759 3300048091 Bacteria 6488
281 Ga0496101_0349804 3300048904 Bacteria 1161
282 Ga0496102_0000313 3300048905 Bacteria 61085
283 Ga0496102_1971073 3300048905 Unclassified 500
284 Ga0496104_0874732 3300048907 Bacteria 804
285 Ga0496104_1037318 3300048907 Unclassified 724
286 Ga0496104_1583121 3300048907 Unclassified 558
287 Ga0496106_0443141 3300048909 Bacteria 1043
288 Ga0496107_0747042 3300048910 Bacteria 718
289 Ga0496109_0079084 3300048912 Bacteria 3029
290 Ga0496110_0118328 3300048913 Bacteria 2386
291 Ga0496110_0405617 3300048913 Bacteria 1243
292 Ga0496110_0491223 3300048913 Bacteria 1118
293 Ga0496111_0120145 3300048914 Bacteria 1941
294 Ga0496111_0655071 3300048914 Unclassified 766
295 Ga0496112_0791431 3300048915 Bacteria 873
296 Ga0496113_0289282 3300048916 Bacteria 1311
297 Ga0496114_0103217 3300048917 Bacteria 2437
298 Ga0496115_0042601 3300048918 Bacteria 3617
299 Ga0496115_0076467 3300048918 Bacteria 2721
300 Ga0496115_1212185 3300048918 Unclassified 566
301 Ga0496116_0073250 3300048919 Bacteria 2160
302 Ga0496116_0102795 3300048919 Bacteria 1702
303 Ga0496117_0088488 3300048920 Bacteria 2003
304 Ga0496118_0146693 3300048921 Bacteria 1484
305 Ga0496122_0025550 3300048925 Bacteria 5125
306 Ga0496122_0368510 3300048925 Bacteria 742
307 Ga0496123_0043079 3300048926 Bacteria 3105
308 Ga0496124_0008383 3300048927 Bacteria 10814
309 Ga0496124_0525336 3300048927 Bacteria 787
310 Ga0496124_0775483 3300048927 Bacteria 597
311 Ga0495678_002650 3300049459 Bacteria 11881
312 Ga0495678_007163 3300049459 Bacteria 5820
313 Ga0501037_0415295 3300049573 Bacteria 921
314 nmdc:mga0k408_138998_c1 3300050493 Bacteria 1444
315 nmdc:mga05p37_158096_c1 3300050507 Bacteria 2769
316 nmdc:mga05p37_236965_c1 3300050507 Bacteria 2196
317 nmdc:mga09592_916324_c1 3300050508 Bacteria 736
318 nmdc:mga06r32_117485_c1 3300050510 Bacteria 2621
319 nmdc:mga0n895_1469104_c1 3300050512 Bacteria 649
320 nmdc:mga0n895_1822504_c1 3300050512 Unclassified 569
321 nmdc:mga0n895_51490_c1 3300050512 Bacteria 4040
322 nmdc:mga0n895_577968_c1 3300050512 Bacteria 1128
323 nmdc:mga0rr50_1082272_c1 3300050513 Bacteria 682
324 nmdc:mga0rr50_6006_c1 3300050513 Bacteria 7330
325 nmdc:mga0rr50_641146_c1 3300050513 Bacteria 906
326 nmdc:mga0rr50_952425_c1 3300050513 Bacteria 732
327 nmdc:mga08x19_130062_c1 3300050514 Bacteria 1693
328 nmdc:mga08x19_350074_c1 3300050514 Bacteria 1031
329 nmdc:mga08x19_58576_c1 3300050514 Unclassified 2492
330 nmdc:mga08x19_71754_c1 3300050514 Bacteria 2258
331 nmdc:mga0a205_1212752_c1 3300050515 Bacteria 602
332 nmdc:mga0a205_186891_c1 3300050515 Bacteria 1965
333 nmdc:mga0a205_837540_c1 3300050515 Bacteria 767

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027614 Ga0209970_1089952 Ga0209970_10899521 92
2 3300006844 Ga0075428_102426113 Ga0075428_1024261131 98
3 3300003323 rootH1_10230848 rootH1_102308482 99
4 3300003781 Ga0055536_1000013 Ga0055536_1000013215 99
5 3300003791 Ga0055530_10000648 Ga0055530_100006485 99
6 3300003792 Ga0055540_1000008 Ga0055540_1000008260 99
7 3300003794 Ga0055531_10000242 Ga0055531_1000024244 99
8 3300004801 Ga0058860_11982111 Ga0058860_119821112 99
9 3300005467 Ga0070706_100047782 Ga0070706_1000477824 99
10 3300005471 Ga0070698_100531379 Ga0070698_1005313792 99
11 3300006852 Ga0075433_10908346 Ga0075433_109083462 99
12 3300007076 Ga0075435_100421407 Ga0075435_1004214072 99
13 3300010159 Ga0099796_10213158 Ga0099796_102131581 99
14 3300013306 Ga0163162_11599326 Ga0163162_115993261 99
15 3300025910 Ga0207684_10040492 Ga0207684_100404924 99
16 3300025939 Ga0207665_10082429 Ga0207665_100824293 99
17 3300050513 nmdc:mga0rr50_952425_c1 nmdc:mga0rr50_952425_c1_21_329 99
18 3300005290 Ga0065712_10138851 Ga0065712_101388513 100
19 3300005293 Ga0065715_10423373 Ga0065715_104233732 100
20 3300005327 Ga0070658_10912311 Ga0070658_109123111 100
21 3300005328 Ga0070676_10340205 Ga0070676_103402051 100
22 3300005333 Ga0070677_10593453 Ga0070677_105934531 100
23 3300005335 Ga0070666_10157752 Ga0070666_101577522 100
24 3300005336 Ga0070680_100084500 Ga0070680_1000845004 100
25 3300005343 Ga0070687_100122687 Ga0070687_1001226871 100
26 3300005354 Ga0070675_101049064 Ga0070675_1010490642 100
27 3300005354 Ga0070675_101257640 Ga0070675_1012576401 100
28 3300005355 Ga0070671_100171295 Ga0070671_1001712953 100
29 3300005356 Ga0070674_100564174 Ga0070674_1005641741 100
30 3300005434 Ga0070709_10351182 Ga0070709_103511822 100
31 3300005435 Ga0070714_100512902 Ga0070714_1005129022 100
32 3300005435 Ga0070714_100907377 Ga0070714_1009073772 100
33 3300005435 Ga0070714_101338771 Ga0070714_1013387712 100
34 3300005436 Ga0070713_100352585 Ga0070713_1003525853 100
35 3300005436 Ga0070713_101480139 Ga0070713_1014801391 100
36 3300005437 Ga0070710_10034327 Ga0070710_100343273 100
37 3300005439 Ga0070711_100037199 Ga0070711_1000371994 100
38 3300005439 Ga0070711_100066602 Ga0070711_1000666023 100
39 3300005439 Ga0070711_101606467 Ga0070711_1016064672 100
40 3300005440 Ga0070705_101310965 Ga0070705_1013109651 100
41 3300005444 Ga0070694_100424624 Ga0070694_1004246242 100
42 3300005445 Ga0070708_100005127 Ga0070708_10000512710 100
43 3300005445 Ga0070708_100009287 Ga0070708_1000092874 100
44 3300005445 Ga0070708_100178108 Ga0070708_1001781082 100
45 3300005445 Ga0070708_100504237 Ga0070708_1005042372 100
46 3300005445 Ga0070708_101022742 Ga0070708_1010227421 100
47 3300005455 Ga0070663_100785894 Ga0070663_1007858941 100
48 3300005456 Ga0070678_100230853 Ga0070678_1002308533 100
49 3300005456 Ga0070678_100379378 Ga0070678_1003793782 100
50 3300005456 Ga0070678_101073212 Ga0070678_1010732121 100
51 3300005457 Ga0070662_100231565 Ga0070662_1002315652 100
52 3300005458 Ga0070681_10047835 Ga0070681_100478353 100
53 3300005458 Ga0070681_10068109 Ga0070681_100681092 100
54 3300005467 Ga0070706_100004720 Ga0070706_10000472011 100
55 3300005467 Ga0070706_100048021 Ga0070706_1000480215 100
56 3300005467 Ga0070706_100049298 Ga0070706_1000492984 100
57 3300005467 Ga0070706_100227056 Ga0070706_1002270562 100
58 3300005467 Ga0070706_100246896 Ga0070706_1002468961 100
59 3300005467 Ga0070706_100401807 Ga0070706_1004018071 100
60 3300005467 Ga0070706_100428213 Ga0070706_1004282133 100
61 3300005468 Ga0070707_100007427 Ga0070707_1000074272 100
62 3300005468 Ga0070707_100020526 Ga0070707_1000205265 100
63 3300005468 Ga0070707_100088099 Ga0070707_1000880992 100
64 3300005468 Ga0070707_100096357 Ga0070707_1000963572 100
65 3300005468 Ga0070707_100186666 Ga0070707_1001866663 100
66 3300005468 Ga0070707_100189990 Ga0070707_1001899903 100
67 3300005468 Ga0070707_101557825 Ga0070707_1015578251 100
68 3300005471 Ga0070698_100022137 Ga0070698_1000221373 100
69 3300005471 Ga0070698_100026816 Ga0070698_1000268165 100
70 3300005471 Ga0070698_100050282 Ga0070698_1000502823 100
71 3300005471 Ga0070698_100345252 Ga0070698_1003452523 100
72 3300005471 Ga0070698_100618733 Ga0070698_1006187332 100
73 3300005518 Ga0070699_100058531 Ga0070699_1000585312 100
74 3300005518 Ga0070699_100147335 Ga0070699_1001473351 100
75 3300005518 Ga0070699_100623571 Ga0070699_1006235712 100
76 3300005530 Ga0070679_100097098 Ga0070679_1000970982 100
77 3300005530 Ga0070679_100214450 Ga0070679_1002144503 100
78 3300005536 Ga0070697_100022231 Ga0070697_1000222313 100
79 3300005536 Ga0070697_100025358 Ga0070697_1000253586 100
80 3300005536 Ga0070697_100146131 Ga0070697_1001461311 100
81 3300005536 Ga0070697_100188981 Ga0070697_1001889813 100
82 3300005536 Ga0070697_100574895 Ga0070697_1005748953 100
83 3300005536 Ga0070697_100870604 Ga0070697_1008706041 100
84 3300005543 Ga0070672_101277018 Ga0070672_1012770181 100
85 3300005545 Ga0070695_100407141 Ga0070695_1004071412 100
86 3300005545 Ga0070695_100468156 Ga0070695_1004681562 100
87 3300005546 Ga0070696_100780516 Ga0070696_1007805162 100
88 3300005548 Ga0070665_100220165 Ga0070665_1002201653 100
89 3300005548 Ga0070665_100487997 Ga0070665_1004879972 100
90 3300005549 Ga0070704_100027586 Ga0070704_1000275865 100
91 3300005549 Ga0070704_100184533 Ga0070704_1001845333 100
92 3300005616 Ga0068852_101224083 Ga0068852_1012240831 100
93 3300005617 Ga0068859_101068893 Ga0068859_1010688932 100
94 3300005617 Ga0068859_102346118 Ga0068859_1023461182 100
95 3300005618 Ga0068864_100452025 Ga0068864_1004520253 100
96 3300005842 Ga0068858_100751009 Ga0068858_1007510092 100
97 3300005843 Ga0068860_102083204 Ga0068860_1020832041 100
98 3300006028 Ga0070717_10037057 Ga0070717_100370574 100
99 3300006028 Ga0070717_10062132 Ga0070717_100621321 100
100 3300006028 Ga0070717_10402602 Ga0070717_104026022 100
101 3300006058 Ga0075432_10098497 Ga0075432_100984972 100
102 3300006058 Ga0075432_10130009 Ga0075432_101300092 100
103 3300006163 Ga0070715_10040003 Ga0070715_100400033 100
104 3300006173 Ga0070716_100028595 Ga0070716_1000285955 100
105 3300006173 Ga0070716_100367615 Ga0070716_1003676152 100
106 3300006175 Ga0070712_100041469 Ga0070712_1000414693 100
107 3300006175 Ga0070712_100121843 Ga0070712_1001218432 100
108 3300006175 Ga0070712_100293103 Ga0070712_1002931032 100
109 3300006175 Ga0070712_100924865 Ga0070712_1009248653 100
110 3300006237 Ga0097621_100243675 Ga0097621_1002436753 100
111 3300006852 Ga0075433_10724550 Ga0075433_107245502 100
112 3300006852 Ga0075433_11540596 Ga0075433_115405962 100
113 3300006852 Ga0075433_11681221 Ga0075433_116812211 100
114 3300006871 Ga0075434_100235459 Ga0075434_1002354593 100
115 3300006871 Ga0075434_100647848 Ga0075434_1006478481 100
116 3300006871 Ga0075434_100785697 Ga0075434_1007856971 100
117 3300006880 Ga0075429_101101468 Ga0075429_1011014681 100
118 3300006881 Ga0068865_101683902 Ga0068865_1016839021 100
119 3300006914 Ga0075436_100054623 Ga0075436_1000546233 100
120 3300006914 Ga0075436_100193205 Ga0075436_1001932053 100
121 3300006931 Ga0097620_101068941 Ga0097620_1010689412 100
122 3300006931 Ga0097620_102346166 Ga0097620_1023461661 100
123 3300007076 Ga0075435_100003103 Ga0075435_10000310312 100
124 3300007076 Ga0075435_100363551 Ga0075435_1003635513 100
125 3300007076 Ga0075435_100402011 Ga0075435_1004020112 100
126 3300009147 Ga0114129_10348418 Ga0114129_103484183 100
127 3300009147 Ga0114129_10543140 Ga0114129_105431401 100
128 3300009147 Ga0114129_10871104 Ga0114129_108711042 100
129 3300009147 Ga0114129_11662532 Ga0114129_116625321 100
130 3300009148 Ga0105243_10000098 Ga0105243_1000009843 100
131 3300009176 Ga0105242_10244279 Ga0105242_102442792 100
132 3300009176 Ga0105242_10838220 Ga0105242_108382202 100
133 3300009177 Ga0105248_10561724 Ga0105248_105617242 100
134 3300009553 Ga0105249_11813088 Ga0105249_118130881 100
135 3300010159 Ga0099796_10191156 Ga0099796_101911561 100
136 3300010375 Ga0105239_12756743 Ga0105239_127567431 100
137 3300011119 Ga0105246_10006334 Ga0105246_100063344 100
138 3300013102 Ga0157371_11136474 Ga0157371_111364741 100
139 3300013296 Ga0157374_10290950 Ga0157374_102909502 100
140 3300013306 Ga0163162_10629034 Ga0163162_106290343 100
141 3300013307 Ga0157372_10036823 Ga0157372_100368232 100
142 3300014326 Ga0157380_13449606 Ga0157380_134496062 100
143 3300014497 Ga0182008_10024465 Ga0182008_100244653 100
144 3300014968 Ga0157379_10627577 Ga0157379_106275772 100
145 3300014969 Ga0157376_10549214 Ga0157376_105492143 100
146 3300015262 Ga0182007_10090224 Ga0182007_100902242 100
147 3300015265 Ga0182005_1044207 Ga0182005_10442073 100
148 3300025245 Ga0207425_1015966 Ga0207425_10159662 100
149 3300025294 Ga0209025_1044165 Ga0209025_10441652 100
150 3300025711 Ga0207696_1000002 Ga0207696_1000002826 100
151 3300025728 Ga0207655_1000080 Ga0207655_1000080123 100
152 3300025728 Ga0207655_1020096 Ga0207655_10200962 100
153 3300025898 Ga0207692_10695868 Ga0207692_106958681 100
154 3300025898 Ga0207692_10877631 Ga0207692_108776311 100
155 3300025903 Ga0207680_10046432 Ga0207680_100464322 100
156 3300025906 Ga0207699_10097393 Ga0207699_100973933 100
157 3300025910 Ga0207684_10000285 Ga0207684_1000028573 100
158 3300025910 Ga0207684_10008062 Ga0207684_100080627 100
159 3300025910 Ga0207684_10021308 Ga0207684_100213082 100
160 3300025910 Ga0207684_10053402 Ga0207684_100534023 100
161 3300025910 Ga0207684_10106122 Ga0207684_101061222 100
162 3300025910 Ga0207684_10413617 Ga0207684_104136171 100
163 3300025910 Ga0207684_10449526 Ga0207684_104495261 100
164 3300025910 Ga0207684_11147541 Ga0207684_111475412 100
165 3300025912 Ga0207707_10026512 Ga0207707_100265124 100
166 3300025915 Ga0207693_10024709 Ga0207693_100247094 100
167 3300025915 Ga0207693_10056333 Ga0207693_100563333 100
168 3300025915 Ga0207693_10334568 Ga0207693_103345682 100
169 3300025916 Ga0207663_10074586 Ga0207663_100745863 100
170 3300025916 Ga0207663_10150664 Ga0207663_101506643 100
171 3300025916 Ga0207663_10851452 Ga0207663_108514522 100
172 3300025918 Ga0207662_10102446 Ga0207662_101024462 100
173 3300025921 Ga0207652_10144776 Ga0207652_101447762 100
174 3300025921 Ga0207652_10481090 Ga0207652_104810902 100
175 3300025922 Ga0207646_10009700 Ga0207646_100097008 100
176 3300025922 Ga0207646_10085290 Ga0207646_100852903 100
177 3300025922 Ga0207646_10116640 Ga0207646_101166402 100
178 3300025922 Ga0207646_10145683 Ga0207646_101456832 100
179 3300025922 Ga0207646_10164367 Ga0207646_101643671 100
180 3300025922 Ga0207646_10393341 Ga0207646_103933412 100
181 3300025922 Ga0207646_10488407 Ga0207646_104884072 100
182 3300025928 Ga0207700_10225086 Ga0207700_102250861 100
183 3300025928 Ga0207700_11244821 Ga0207700_112448212 100
184 3300025929 Ga0207664_10568607 Ga0207664_105686071 100
185 3300025929 Ga0207664_11127962 Ga0207664_111279621 100
186 3300025931 Ga0207644_10268276 Ga0207644_102682761 100
187 3300025933 Ga0207706_10116645 Ga0207706_101166453 100
188 3300025934 Ga0207686_10980740 Ga0207686_109807402 100
189 3300025935 Ga0207709_10000011 Ga0207709_1000001143 100
190 3300025937 Ga0207669_10372023 Ga0207669_103720231 100
191 3300025940 Ga0207691_10329750 Ga0207691_103297501 100
192 3300025942 Ga0207689_10815878 Ga0207689_108158782 100
193 3300025949 Ga0207667_11632257 Ga0207667_116322571 100
194 3300026035 Ga0207703_10336018 Ga0207703_103360181 100
195 3300026088 Ga0207641_10127971 Ga0207641_101279712 100
196 3300026121 Ga0207683_10084657 Ga0207683_100846574 100
197 3300026121 Ga0207683_10469899 Ga0207683_104698991 100
198 3300027907 Ga0207428_10912437 Ga0207428_109124371 100
199 3300028379 Ga0268266_10150918 Ga0268266_101509182 100
200 3300028379 Ga0268266_12356559 Ga0268266_123565591 100
201 3300028381 Ga0268264_11878728 Ga0268264_118787282 100
202 3300031239 Ga0265328_10074292 Ga0265328_100742922 100
203 3300031344 Ga0265316_10336396 Ga0265316_103363962 100
204 3300031691 Ga0316579_10029995 Ga0316579_100299952 100
205 3300031731 Ga0307405_10222355 Ga0307405_102223551 100
206 3300031731 Ga0307405_10865560 Ga0307405_108655602 100
207 3300032004 Ga0307414_10014222 Ga0307414_100142224 100
208 3300035084 Ga0373928_0142633 Ga0373928_0142633_91_393 100
209 3300035091 Ga0373951_0239317 Ga0373951_0239317_154_456 100
210 3300035114 Ga0373939_0032745 Ga0373939_0032745_189_491 100
211 3300035121 Ga0373960_0392180 Ga0373960_0392180_137_439 100
212 3300035170 Ga0373943_0133233 Ga0373943_0133233_128_430 100
213 3300035691 Ga0373931_1177496 Ga0373931_1177496_206_508 100
214 3300035692 Ga0373935_0668602 Ga0373935_0668602_319_621 100
215 3300036647 Ga0316582_0073289 Ga0316582_0073289_454_756 100
216 3300041407 Ga0439447_012543 Ga0439447_012543_2053_2355 100
217 3300042006 Ga0439432_000019 Ga0439432_000019_16344_16646 100
218 3300042009 Ga0439451_101306 Ga0439451_101306_255_557 100
219 3300042016 Ga0439463_000879 Ga0439463_000879_5346_5648 100
220 3300042137 Ga0450902_022260 Ga0450902_022260_189_491 100
221 3300042139 Ga0450904_023727 Ga0450904_023727_209_511 100
222 3300042142 Ga0450905_015759 Ga0450905_015759_726_1028 100
223 3300046452 Ga0495617_278609 Ga0495617_278609_12_314 100
224 3300046457 Ga0495590_0005142 Ga0495590_0005142_283_585 100
225 3300046458 Ga0495591_100551 Ga0495591_100551_147_449 100
226 3300046460 Ga0495638_0000129 Ga0495638_0000129_86928_87230 100
227 3300046474 Ga0495605_0007848 Ga0495605_0007848_2399_2701 100
228 3300046491 Ga0495584_0032142 Ga0495584_0032142_1219_1521 100
229 3300046491 Ga0495584_0038425 Ga0495584_0038425_2066_2368 100
230 3300046492 Ga0495585_0182639 Ga0495585_0182639_563_865 100
231 3300046501 Ga0495607_0046915 Ga0495607_0046915_2176_2478 100
232 3300046513 Ga0495616_0040542 Ga0495616_0040542_135_437 100
233 3300046519 Ga0495632_0014722 Ga0495632_0014722_3258_3560 100
234 3300046522 Ga0495643_0035688 Ga0495643_0035688_408_710 100
235 3300046523 Ga0495644_0000024 Ga0495644_0000024_18348_18650 100
236 3300046530 Ga0495654_0003647 Ga0495654_0003647_1997_2299 100
237 3300046542 Ga0495597_0000986 Ga0495597_0000986_7813_8115 100
238 3300046615 Ga0495656_0369597 Ga0495656_0369597_74_376 100
239 3300046648 Ga0495611_0001487 Ga0495611_0001487_6074_6376 100
240 3300046692 Ga0495671_0152312 Ga0495671_0152312_768_1070 100
241 3300046694 Ga0495649_0000152 Ga0495649_0000152_35437_35739 100
242 3300046794 Ga0495589_0000387 Ga0495589_0000387_26012_26314 100
243 3300047320 Ga0495672_0029237 Ga0495672_0029237_1782_2084 100
244 3300047320 Ga0495672_0040668 Ga0495672_0040668_1163_1465 100
245 3300047320 Ga0495672_0335521 Ga0495672_0335521_246_548 100
246 3300047323 Ga0495683_0077024 Ga0495683_0077024_52_354 100
247 3300048090 Ga0495615_0001156 Ga0495615_0001156_3301_3603 100
248 3300048091 Ga0495626_0006759 Ga0495626_0006759_2631_2933 100
249 3300048904 Ga0496101_0349804 Ga0496101_0349804_440_742 100
250 3300048905 Ga0496102_0000313 Ga0496102_0000313_16119_16421 100
251 3300048905 Ga0496102_1971073 Ga0496102_1971073_51_353 100
252 3300048907 Ga0496104_1037318 Ga0496104_1037318_318_620 100
253 3300048907 Ga0496104_1583121 Ga0496104_1583121_19_321 100
254 3300048909 Ga0496106_0443141 Ga0496106_0443141_134_436 100
255 3300048912 Ga0496109_0079084 Ga0496109_0079084_2133_2435 100
256 3300048913 Ga0496110_0405617 Ga0496110_0405617_98_400 100
257 3300048913 Ga0496110_0491223 Ga0496110_0491223_596_898 100
258 3300048914 Ga0496111_0120145 Ga0496111_0120145_707_1009 100
259 3300048914 Ga0496111_0655071 Ga0496111_0655071_152_454 100
260 3300048915 Ga0496112_0791431 Ga0496112_0791431_473_775 100
261 3300048916 Ga0496113_0289282 Ga0496113_0289282_346_648 100
262 3300048918 Ga0496115_0076467 Ga0496115_0076467_1538_1840 100
263 3300048919 Ga0496116_0073250 Ga0496116_0073250_308_610 100
264 3300048919 Ga0496116_0102795 Ga0496116_0102795_337_639 100
265 3300048920 Ga0496117_0088488 Ga0496117_0088488_916_1218 100
266 3300048921 Ga0496118_0146693 Ga0496118_0146693_683_985 100
267 3300048925 Ga0496122_0025550 Ga0496122_0025550_3871_4173 100
268 3300048925 Ga0496122_0368510 Ga0496122_0368510_372_674 100
269 3300048926 Ga0496123_0043079 Ga0496123_0043079_1428_1730 100
270 3300048927 Ga0496124_0008383 Ga0496124_0008383_3222_3524 100
271 3300048927 Ga0496124_0525336 Ga0496124_0525336_196_498 100
272 3300048927 Ga0496124_0775483 Ga0496124_0775483_118_420 100
273 3300049459 Ga0495678_002650 Ga0495678_002650_5177_5479 100
274 3300049459 Ga0495678_007163 Ga0495678_007163_3665_3967 100
275 3300050493 nmdc:mga0k408_138998_c1 nmdc:mga0k408_138998_c1_884_1186 100
276 3300050507 nmdc:mga05p37_158096_c1 nmdc:mga05p37_158096_c1_2310_2660 100
277 3300050507 nmdc:mga05p37_236965_c1 nmdc:mga05p37_236965_c1_1651_2022 100
278 3300050508 nmdc:mga09592_916324_c1 nmdc:mga09592_916324_c1_184_498 100
279 3300050510 nmdc:mga06r32_117485_c1 nmdc:mga06r32_117485_c1_79_396 100
280 3300050512 nmdc:mga0n895_1469104_c1 nmdc:mga0n895_1469104_c1_71_421 100
281 3300050512 nmdc:mga0n895_1822504_c1 nmdc:mga0n895_1822504_c1_233_535 100
282 3300050512 nmdc:mga0n895_51490_c1 nmdc:mga0n895_51490_c1_1411_1713 100
283 3300050512 nmdc:mga0n895_577968_c1 nmdc:mga0n895_577968_c1_704_1075 100
284 3300050513 nmdc:mga0rr50_1082272_c1 nmdc:mga0rr50_1082272_c1_292_618 100
285 3300050513 nmdc:mga0rr50_6006_c1 nmdc:mga0rr50_6006_c1_6961_7263 100
286 3300050513 nmdc:mga0rr50_641146_c1 nmdc:mga0rr50_641146_c1_79_381 100
287 3300050514 nmdc:mga08x19_130062_c1 nmdc:mga08x19_130062_c1_43_345 100
288 3300050514 nmdc:mga08x19_350074_c1 nmdc:mga08x19_350074_c1_462_764 100
289 3300050514 nmdc:mga08x19_58576_c1 nmdc:mga08x19_58576_c1_1791_2093 100
290 3300050514 nmdc:mga08x19_71754_c1 nmdc:mga08x19_71754_c1_1496_1798 100
291 3300050515 nmdc:mga0a205_1212752_c1 nmdc:mga0a205_1212752_c1_143_460 100
292 3300050515 nmdc:mga0a205_186891_c1 nmdc:mga0a205_186891_c1_1246_1548 100
293 3300050515 nmdc:mga0a205_837540_c1 nmdc:mga0a205_837540_c1_412_714 100
294 3300005539 Ga0068853_100203084 Ga0068853_1002030842 101
295 3300006028 Ga0070717_10794199 Ga0070717_107941991 101
296 3300006051 Ga0075364_10837032 Ga0075364_108370322 101
297 3300010375 Ga0105239_10034935 Ga0105239_100349353 101
298 3300026041 Ga0207639_10581714 Ga0207639_105817142 101
299 3300048910 Ga0496107_0747042 Ga0496107_0747042_77_382 101
300 3300048913 Ga0496110_0118328 Ga0496110_0118328_551_856 101
301 3300039437 Ga0436365_0580786 Ga0436365_0580786_1416_1736 103
302 3300049573 Ga0501037_0415295 Ga0501037_0415295_206_517 103
303 3300025906 Ga0207699_11414970 Ga0207699_114149701 104
304 3300025928 Ga0207700_11131838 Ga0207700_111318382 104
305 3300046462 Ga0495651_0511198 Ga0495651_0511198_213_539 104
306 3300046679 Ga0495623_0361480 Ga0495623_0361480_139_465 104
307 3300048918 Ga0496115_1212185 Ga0496115_1212185_165_491 104
308 3300046454 Ga0495592_0141535 Ga0495592_0141535_227_544 105
309 3300046516 Ga0495628_0428787 Ga0495628_0428787_335_652 105
310 3300046678 Ga0495599_0442545 Ga0495599_0442545_106_423 105
311 3300003322 rootL2_10077485 rootL2_100774853 106
312 3300004803 Ga0058862_12195488 Ga0058862_121954881 106
313 3300005295 Ga0065707_11083214 Ga0065707_110832141 106
314 3300005444 Ga0070694_101264469 Ga0070694_1012644691 106
315 3300005456 Ga0070678_100250393 Ga0070678_1002503932 106
316 3300005467 Ga0070706_100253869 Ga0070706_1002538692 106
317 3300005467 Ga0070706_100257335 Ga0070706_1002573352 106
318 3300005545 Ga0070695_100451368 Ga0070695_1004513681 106
319 3300005844 Ga0068862_100674360 Ga0068862_1006743602 106
320 3300006175 Ga0070712_100549078 Ga0070712_1005490781 106
321 3300009553 Ga0105249_12426045 Ga0105249_124260452 106
322 3300013308 Ga0157375_10821151 Ga0157375_108211513 106
323 3300014969 Ga0157376_10002306 Ga0157376_100023066 106
324 3300025910 Ga0207684_10214711 Ga0207684_102147114 106
325 3300025910 Ga0207684_10472256 Ga0207684_104722562 106
326 3300025911 Ga0207654_11294707 Ga0207654_112947071 106
327 3300025915 Ga0207693_10457477 Ga0207693_104574772 106
328 3300025961 Ga0207712_11331425 Ga0207712_113314252 106
329 3300026121 Ga0207683_10270399 Ga0207683_102703991 106
330 3300031090 Ga0265760_10042765 Ga0265760_100427652 106
331 3300048907 Ga0496104_0874732 Ga0496104_0874732_396_725 106
332 3300048917 Ga0496114_0103217 Ga0496114_0103217_1027_1356 106
333 3300048918 Ga0496115_0042601 Ga0496115_0042601_3058_3387 106

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9864 1 101
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9582 1 101
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.882 3 94
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8808 4 95
3qmq-assembly2.cif.gz_B crystal structure of e. coli lsrg 0.8679 3 96
ID Description Score Start End Superfamily
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9826 3 93 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9616 3 93 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8782 3 97 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8679 3 96 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8614 3 97 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A533BJI9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9959 1 86 GO:0004497
AF-A0A7W0U486-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9956 1 98 GO:0004497
AF-Q1M9G4-F1-model_v4 Conserved hypothetical exported protein 0.9954 1 97
AF-A0A0A1FAK1-F1-model_v4 Quinol monooxygenase YgiN 0.9951 1 97
AF-A0A1M6YAS9-F1-model_v4 Quinol monooxygenase YgiN 0.9951 1 99 GO:0004497

Feature Viewer

pLDDT pTM Quality
94.6 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map