F411336
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 197 | 333 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10871104|Ga0114129_108711042 |
| Length | 123 |
| Sequence | MFRRGLPDGARRPDGHCRERRSDMVKVALWVRLEAKAGKEADVERFLRGGLPLVQAEPDTTAWFGVRLGPSTFAIFDAFPDEAGRNAHLSGRVAAALKEKASELFAKPPTIEKVEVLAAKLPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 129 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 136 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 137 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 138 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 139 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 140 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 141 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 184 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 6.01 |
| Rhizosphere | 87.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10077485 | 3300003322 | Bacteria | 1770 |
| 2 | rootH1_10230848 | 3300003323 | Bacteria | 1359 |
| 3 | Ga0055536_1000013 | 3300003781 | Bacteria | 240693 |
| 4 | Ga0055530_10000648 | 3300003791 | Bacteria | 29930 |
| 5 | Ga0055540_1000008 | 3300003792 | Bacteria | 309635 |
| 6 | Ga0055531_10000242 | 3300003794 | Bacteria | 59638 |
| 7 | Ga0058860_11982111 | 3300004801 | Bacteria | 798 |
| 8 | Ga0058862_12195488 | 3300004803 | Bacteria | 683 |
| 9 | Ga0065712_10138851 | 3300005290 | Bacteria | 1470 |
| 10 | Ga0065715_10423373 | 3300005293 | Bacteria | 831 |
| 11 | Ga0065707_11083214 | 3300005295 | Bacteria | 519 |
| 12 | Ga0070658_10912311 | 3300005327 | Bacteria | 764 |
| 13 | Ga0070676_10340205 | 3300005328 | Bacteria | 1029 |
| 14 | Ga0070677_10593453 | 3300005333 | Unclassified | 612 |
| 15 | Ga0070666_10157752 | 3300005335 | Bacteria | 1585 |
| 16 | Ga0070680_100084500 | 3300005336 | Bacteria | 2621 |
| 17 | Ga0070687_100122687 | 3300005343 | Unclassified | 1488 |
| 18 | Ga0070675_101049064 | 3300005354 | Unclassified | 749 |
| 19 | Ga0070675_101257640 | 3300005354 | Bacteria | 682 |
| 20 | Ga0070671_100171295 | 3300005355 | Bacteria | 1836 |
| 21 | Ga0070674_100564174 | 3300005356 | Bacteria | 957 |
| 22 | Ga0070709_10351182 | 3300005434 | Unclassified | 1090 |
| 23 | Ga0070714_100512902 | 3300005435 | Bacteria | 1144 |
| 24 | Ga0070714_100907377 | 3300005435 | Bacteria | 856 |
| 25 | Ga0070714_101338771 | 3300005435 | Unclassified | 699 |
| 26 | Ga0070713_100352585 | 3300005436 | Unclassified | 1365 |
| 27 | Ga0070713_101480139 | 3300005436 | Unclassified | 659 |
| 28 | Ga0070710_10034327 | 3300005437 | Unclassified | 2759 |
| 29 | Ga0070711_100037199 | 3300005439 | Unclassified | 3264 |
| 30 | Ga0070711_100066602 | 3300005439 | Bacteria | 2524 |
| 31 | Ga0070711_101606467 | 3300005439 | Bacteria | 569 |
| 32 | Ga0070705_101310965 | 3300005440 | Bacteria | 601 |
| 33 | Ga0070694_100424624 | 3300005444 | Unclassified | 1045 |
| 34 | Ga0070694_101264469 | 3300005444 | Bacteria | 620 |
| 35 | Ga0070708_100005127 | 3300005445 | Bacteria | 10372 |
| 36 | Ga0070708_100009287 | 3300005445 | Bacteria | 7924 |
| 37 | Ga0070708_100178108 | 3300005445 | Unclassified | 1987 |
| 38 | Ga0070708_100504237 | 3300005445 | Bacteria | 1142 |
| 39 | Ga0070708_101022742 | 3300005445 | Unclassified | 775 |
| 40 | Ga0070663_100785894 | 3300005455 | Bacteria | 815 |
| 41 | Ga0070678_100230853 | 3300005456 | Bacteria | 1543 |
| 42 | Ga0070678_100250393 | 3300005456 | Bacteria | 1485 |
| 43 | Ga0070678_100379378 | 3300005456 | Unclassified | 1223 |
| 44 | Ga0070678_101073212 | 3300005456 | Bacteria | 743 |
| 45 | Ga0070662_100231565 | 3300005457 | Bacteria | 1478 |
| 46 | Ga0070681_10047835 | 3300005458 | Unclassified | 4275 |
| 47 | Ga0070681_10068109 | 3300005458 | Bacteria | 3527 |
| 48 | Ga0070706_100004720 | 3300005467 | Bacteria | 13066 |
| 49 | Ga0070706_100047782 | 3300005467 | Bacteria | 3950 |
| 50 | Ga0070706_100048021 | 3300005467 | Bacteria | 3940 |
| 51 | Ga0070706_100049298 | 3300005467 | Bacteria | 3887 |
| 52 | Ga0070706_100227056 | 3300005467 | Bacteria | 1743 |
| 53 | Ga0070706_100246896 | 3300005467 | Bacteria | 1667 |
| 54 | Ga0070706_100253869 | 3300005467 | Bacteria | 1642 |
| 55 | Ga0070706_100257335 | 3300005467 | Bacteria | 1630 |
| 56 | Ga0070706_100401807 | 3300005467 | Bacteria | 1275 |
| 57 | Ga0070706_100428213 | 3300005467 | Bacteria | 1231 |
| 58 | Ga0070707_100007427 | 3300005468 | Bacteria | 10176 |
| 59 | Ga0070707_100020526 | 3300005468 | Bacteria | 6234 |
| 60 | Ga0070707_100088099 | 3300005468 | Bacteria | 3003 |
| 61 | Ga0070707_100096357 | 3300005468 | Bacteria | 2866 |
| 62 | Ga0070707_100186666 | 3300005468 | Bacteria | 2021 |
| 63 | Ga0070707_100189990 | 3300005468 | Bacteria | 2002 |
| 64 | Ga0070707_101557825 | 3300005468 | Bacteria | 628 |
| 65 | Ga0070698_100022137 | 3300005471 | Bacteria | 6653 |
| 66 | Ga0070698_100026816 | 3300005471 | Bacteria | 5992 |
| 67 | Ga0070698_100050282 | 3300005471 | Unclassified | 4251 |
| 68 | Ga0070698_100345252 | 3300005471 | Bacteria | 1420 |
| 69 | Ga0070698_100531379 | 3300005471 | Bacteria | 1115 |
| 70 | Ga0070698_100618733 | 3300005471 | Bacteria | 1024 |
| 71 | Ga0070699_100058531 | 3300005518 | Bacteria | 3338 |
| 72 | Ga0070699_100147335 | 3300005518 | Bacteria | 2080 |
| 73 | Ga0070699_100623571 | 3300005518 | Bacteria | 984 |
| 74 | Ga0070679_100097098 | 3300005530 | Bacteria | 2934 |
| 75 | Ga0070679_100214450 | 3300005530 | Bacteria | 1888 |
| 76 | Ga0070697_100022231 | 3300005536 | Bacteria | 5033 |
| 77 | Ga0070697_100025358 | 3300005536 | Bacteria | 4730 |
| 78 | Ga0070697_100146131 | 3300005536 | Bacteria | 1990 |
| 79 | Ga0070697_100188981 | 3300005536 | Bacteria | 1748 |
| 80 | Ga0070697_100574895 | 3300005536 | Unclassified | 989 |
| 81 | Ga0070697_100870604 | 3300005536 | Bacteria | 798 |
| 82 | Ga0068853_100203084 | 3300005539 | Bacteria | 1804 |
| 83 | Ga0070672_101277018 | 3300005543 | Unclassified | 655 |
| 84 | Ga0070695_100407141 | 3300005545 | Bacteria | 1033 |
| 85 | Ga0070695_100451368 | 3300005545 | Bacteria | 985 |
| 86 | Ga0070695_100468156 | 3300005545 | Bacteria | 969 |
| 87 | Ga0070696_100780516 | 3300005546 | Unclassified | 785 |
| 88 | Ga0070665_100220165 | 3300005548 | Bacteria | 1898 |
| 89 | Ga0070665_100487997 | 3300005548 | Bacteria | 1243 |
| 90 | Ga0070704_100027586 | 3300005549 | Bacteria | 3769 |
| 91 | Ga0070704_100184533 | 3300005549 | Bacteria | 1671 |
| 92 | Ga0068852_101224083 | 3300005616 | Bacteria | 772 |
| 93 | Ga0068859_101068893 | 3300005617 | Bacteria | 887 |
| 94 | Ga0068859_102346118 | 3300005617 | Bacteria | 588 |
| 95 | Ga0068864_100452025 | 3300005618 | Bacteria | 1229 |
| 96 | Ga0068858_100751009 | 3300005842 | Bacteria | 950 |
| 97 | Ga0068860_102083204 | 3300005843 | Bacteria | 589 |
| 98 | Ga0068862_100674360 | 3300005844 | Bacteria | 999 |
| 99 | Ga0070717_10037057 | 3300006028 | Bacteria | 3958 |
| 100 | Ga0070717_10062132 | 3300006028 | Bacteria | 3097 |
| 101 | Ga0070717_10402602 | 3300006028 | Bacteria | 1230 |
| 102 | Ga0070717_10794199 | 3300006028 | Unclassified | 861 |
| 103 | Ga0075364_10837032 | 3300006051 | Bacteria | 627 |
| 104 | Ga0075432_10098497 | 3300006058 | Unclassified | 1078 |
| 105 | Ga0075432_10130009 | 3300006058 | Bacteria | 953 |
| 106 | Ga0070715_10040003 | 3300006163 | Bacteria | 1957 |
| 107 | Ga0070716_100028595 | 3300006173 | Unclassified | 3005 |
| 108 | Ga0070716_100367615 | 3300006173 | Bacteria | 1024 |
| 109 | Ga0070712_100041469 | 3300006175 | Bacteria | 3160 |
| 110 | Ga0070712_100121843 | 3300006175 | Bacteria | 1963 |
| 111 | Ga0070712_100293103 | 3300006175 | Bacteria | 1314 |
| 112 | Ga0070712_100549078 | 3300006175 | Unclassified | 973 |
| 113 | Ga0070712_100924865 | 3300006175 | Bacteria | 753 |
| 114 | Ga0097621_100243675 | 3300006237 | Unclassified | 1572 |
| 115 | Ga0075428_102426113 | 3300006844 | Bacteria | 538 |
| 116 | Ga0075433_10724550 | 3300006852 | Bacteria | 870 |
| 117 | Ga0075433_10908346 | 3300006852 | Bacteria | 768 |
| 118 | Ga0075433_11540596 | 3300006852 | Bacteria | 574 |
| 119 | Ga0075433_11681221 | 3300006852 | Bacteria | 547 |
| 120 | Ga0075434_100235459 | 3300006871 | Bacteria | 1851 |
| 121 | Ga0075434_100647848 | 3300006871 | Bacteria | 1075 |
| 122 | Ga0075434_100785697 | 3300006871 | Bacteria | 968 |
| 123 | Ga0075429_101101468 | 3300006880 | Bacteria | 694 |
| 124 | Ga0068865_101683902 | 3300006881 | Unclassified | 571 |
| 125 | Ga0075436_100054623 | 3300006914 | Bacteria | 2757 |
| 126 | Ga0075436_100193205 | 3300006914 | Bacteria | 1440 |
| 127 | Ga0097620_101068941 | 3300006931 | Bacteria | 887 |
| 128 | Ga0097620_102346166 | 3300006931 | Bacteria | 588 |
| 129 | Ga0075435_100003103 | 3300007076 | Bacteria | 11224 |
| 130 | Ga0075435_100363551 | 3300007076 | Bacteria | 1242 |
| 131 | Ga0075435_100402011 | 3300007076 | Bacteria | 1178 |
| 132 | Ga0075435_100421407 | 3300007076 | Bacteria | 1150 |
| 133 | Ga0114129_10348418 | 3300009147 | Bacteria | 1963 |
| 134 | Ga0114129_10543140 | 3300009147 | Bacteria | 1512 |
| 135 | Ga0114129_10871104 | 3300009147 | Bacteria | 1143 |
| 136 | Ga0114129_11662532 | 3300009147 | Unclassified | 780 |
| 137 | Ga0105243_10000098 | 3300009148 | Bacteria | 99914 |
| 138 | Ga0105242_10244279 | 3300009176 | Bacteria | 1615 |
| 139 | Ga0105242_10838220 | 3300009176 | Bacteria | 914 |
| 140 | Ga0105248_10561724 | 3300009177 | Bacteria | 1287 |
| 141 | Ga0105249_11813088 | 3300009553 | Bacteria | 683 |
| 142 | Ga0105249_12426045 | 3300009553 | Bacteria | 597 |
| 143 | Ga0099796_10191156 | 3300010159 | Bacteria | 826 |
| 144 | Ga0099796_10213158 | 3300010159 | Bacteria | 788 |
| 145 | Ga0105239_10034935 | 3300010375 | Bacteria | 5521 |
| 146 | Ga0105239_12756743 | 3300010375 | Unclassified | 574 |
| 147 | Ga0105246_10006334 | 3300011119 | Bacteria | 7226 |
| 148 | Ga0157371_11136474 | 3300013102 | Bacteria | 600 |
| 149 | Ga0157374_10290950 | 3300013296 | Bacteria | 1614 |
| 150 | Ga0163162_10629034 | 3300013306 | Bacteria | 1198 |
| 151 | Ga0163162_11599326 | 3300013306 | Bacteria | 743 |
| 152 | Ga0157372_10036823 | 3300013307 | Bacteria | 5395 |
| 153 | Ga0157375_10821151 | 3300013308 | Bacteria | 1078 |
| 154 | Ga0157380_13449606 | 3300014326 | Bacteria | 506 |
| 155 | Ga0182008_10024465 | 3300014497 | Bacteria | 3075 |
| 156 | Ga0157379_10627577 | 3300014968 | Bacteria | 1005 |
| 157 | Ga0157376_10002306 | 3300014969 | Bacteria | 12892 |
| 158 | Ga0157376_10549214 | 3300014969 | Unclassified | 1143 |
| 159 | Ga0182007_10090224 | 3300015262 | Bacteria | 1009 |
| 160 | Ga0182005_1044207 | 3300015265 | Bacteria | 1211 |
| 161 | Ga0207425_1015966 | 3300025245 | Bacteria | 1675 |
| 162 | Ga0209025_1044165 | 3300025294 | Bacteria | 1867 |
| 163 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 164 | Ga0207655_1000080 | 3300025728 | Bacteria | 214570 |
| 165 | Ga0207655_1020096 | 3300025728 | Bacteria | 3455 |
| 166 | Ga0207692_10695868 | 3300025898 | Unclassified | 659 |
| 167 | Ga0207692_10877631 | 3300025898 | Unclassified | 589 |
| 168 | Ga0207680_10046432 | 3300025903 | Bacteria | 2568 |
| 169 | Ga0207699_10097393 | 3300025906 | Unclassified | 1859 |
| 170 | Ga0207699_11414970 | 3300025906 | Unclassified | 514 |
| 171 | Ga0207684_10000285 | 3300025910 | Bacteria | 73299 |
| 172 | Ga0207684_10008062 | 3300025910 | Bacteria | 9400 |
| 173 | Ga0207684_10021308 | 3300025910 | Bacteria | 5534 |
| 174 | Ga0207684_10040492 | 3300025910 | Bacteria | 3950 |
| 175 | Ga0207684_10053402 | 3300025910 | Bacteria | 3430 |
| 176 | Ga0207684_10106122 | 3300025910 | Bacteria | 2403 |
| 177 | Ga0207684_10214711 | 3300025910 | Bacteria | 1660 |
| 178 | Ga0207684_10413617 | 3300025910 | Bacteria | 1159 |
| 179 | Ga0207684_10449526 | 3300025910 | Bacteria | 1106 |
| 180 | Ga0207684_10472256 | 3300025910 | Bacteria | 1076 |
| 181 | Ga0207684_11147541 | 3300025910 | Unclassified | 645 |
| 182 | Ga0207654_11294707 | 3300025911 | Unclassified | 531 |
| 183 | Ga0207707_10026512 | 3300025912 | Bacteria | 5065 |
| 184 | Ga0207693_10024709 | 3300025915 | Unclassified | 4765 |
| 185 | Ga0207693_10056333 | 3300025915 | Bacteria | 3082 |
| 186 | Ga0207693_10334568 | 3300025915 | Bacteria | 1185 |
| 187 | Ga0207693_10457477 | 3300025915 | Unclassified | 997 |
| 188 | Ga0207663_10074586 | 3300025916 | Unclassified | 2199 |
| 189 | Ga0207663_10150664 | 3300025916 | Unclassified | 1631 |
| 190 | Ga0207663_10851452 | 3300025916 | Bacteria | 728 |
| 191 | Ga0207662_10102446 | 3300025918 | Bacteria | 1775 |
| 192 | Ga0207652_10144776 | 3300025921 | Bacteria | 2126 |
| 193 | Ga0207652_10481090 | 3300025921 | Bacteria | 1118 |
| 194 | Ga0207646_10009700 | 3300025922 | Bacteria | 9491 |
| 195 | Ga0207646_10085290 | 3300025922 | Bacteria | 2825 |
| 196 | Ga0207646_10116640 | 3300025922 | Bacteria | 2398 |
| 197 | Ga0207646_10145683 | 3300025922 | Bacteria | 2134 |
| 198 | Ga0207646_10164367 | 3300025922 | Bacteria | 2004 |
| 199 | Ga0207646_10393341 | 3300025922 | Bacteria | 1252 |
| 200 | Ga0207646_10488407 | 3300025922 | Bacteria | 1110 |
| 201 | Ga0207700_10225086 | 3300025928 | Unclassified | 1592 |
| 202 | Ga0207700_11131838 | 3300025928 | Unclassified | 699 |
| 203 | Ga0207700_11244821 | 3300025928 | Unclassified | 664 |
| 204 | Ga0207664_10568607 | 3300025929 | Bacteria | 1017 |
| 205 | Ga0207664_11127962 | 3300025929 | Unclassified | 701 |
| 206 | Ga0207644_10268276 | 3300025931 | Unclassified | 1367 |
| 207 | Ga0207706_10116645 | 3300025933 | Bacteria | 2348 |
| 208 | Ga0207686_10980740 | 3300025934 | Bacteria | 685 |
| 209 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 210 | Ga0207669_10372023 | 3300025937 | Unclassified | 1111 |
| 211 | Ga0207665_10082429 | 3300025939 | Unclassified | 2217 |
| 212 | Ga0207691_10329750 | 3300025940 | Bacteria | 1308 |
| 213 | Ga0207689_10815878 | 3300025942 | Bacteria | 787 |
| 214 | Ga0207667_11632257 | 3300025949 | Bacteria | 613 |
| 215 | Ga0207712_11331425 | 3300025961 | Bacteria | 642 |
| 216 | Ga0207703_10336018 | 3300026035 | Bacteria | 1387 |
| 217 | Ga0207639_10581714 | 3300026041 | Bacteria | 1031 |
| 218 | Ga0207641_10127971 | 3300026088 | Bacteria | 2276 |
| 219 | Ga0207683_10084657 | 3300026121 | Bacteria | 2819 |
| 220 | Ga0207683_10270399 | 3300026121 | Unclassified | 1552 |
| 221 | Ga0207683_10469899 | 3300026121 | Unclassified | 1160 |
| 222 | Ga0209970_1089952 | 3300027614 | Bacteria | 581 |
| 223 | Ga0207428_10912437 | 3300027907 | Unclassified | 620 |
| 224 | Ga0268266_10150918 | 3300028379 | Bacteria | 2094 |
| 225 | Ga0268266_12356559 | 3300028379 | Unclassified | 503 |
| 226 | Ga0268264_11878728 | 3300028381 | Bacteria | 609 |
| 227 | Ga0265760_10042765 | 3300031090 | Bacteria | 1353 |
| 228 | Ga0265328_10074292 | 3300031239 | Bacteria | 1250 |
| 229 | Ga0265316_10336396 | 3300031344 | Bacteria | 1095 |
| 230 | Ga0316579_10029995 | 3300031691 | Bacteria | 2483 |
| 231 | Ga0307405_10222355 | 3300031731 | Bacteria | 1386 |
| 232 | Ga0307405_10865560 | 3300031731 | Unclassified | 762 |
| 233 | Ga0307414_10014222 | 3300032004 | Bacteria | 4762 |
| 234 | Ga0373928_0142633 | 3300035084 | Bacteria | 658 |
| 235 | Ga0373951_0239317 | 3300035091 | Unclassified | 542 |
| 236 | Ga0373939_0032745 | 3300035114 | Bacteria | 1513 |
| 237 | Ga0373960_0392180 | 3300035121 | Bacteria | 534 |
| 238 | Ga0373943_0133233 | 3300035170 | Bacteria | 1332 |
| 239 | Ga0373931_1177496 | 3300035691 | Unclassified | 524 |
| 240 | Ga0373935_0668602 | 3300035692 | Unclassified | 763 |
| 241 | Ga0316582_0073289 | 3300036647 | Bacteria | 2222 |
| 242 | Ga0436365_0580786 | 3300039437 | Bacteria | 1845 |
| 243 | Ga0439447_012543 | 3300041407 | Bacteria | 2432 |
| 244 | Ga0439432_000019 | 3300042006 | Bacteria | 60642 |
| 245 | Ga0439451_101306 | 3300042009 | Bacteria | 582 |
| 246 | Ga0439463_000879 | 3300042016 | Bacteria | 8278 |
| 247 | Ga0450902_022260 | 3300042137 | Bacteria | 1049 |
| 248 | Ga0450904_023727 | 3300042139 | Bacteria | 628 |
| 249 | Ga0450905_015759 | 3300042142 | Bacteria | 1086 |
| 250 | Ga0495617_278609 | 3300046452 | Bacteria | 512 |
| 251 | Ga0495592_0141535 | 3300046454 | Bacteria | 1673 |
| 252 | Ga0495590_0005142 | 3300046457 | Bacteria | 5205 |
| 253 | Ga0495591_100551 | 3300046458 | Bacteria | 717 |
| 254 | Ga0495638_0000129 | 3300046460 | Bacteria | 123549 |
| 255 | Ga0495651_0511198 | 3300046462 | Unclassified | 768 |
| 256 | Ga0495605_0007848 | 3300046474 | Bacteria | 6046 |
| 257 | Ga0495584_0032142 | 3300046491 | Bacteria | 2657 |
| 258 | Ga0495584_0038425 | 3300046491 | Bacteria | 2419 |
| 259 | Ga0495585_0182639 | 3300046492 | Bacteria | 1077 |
| 260 | Ga0495607_0046915 | 3300046501 | Bacteria | 2533 |
| 261 | Ga0495616_0040542 | 3300046513 | Bacteria | 2378 |
| 262 | Ga0495628_0428787 | 3300046516 | Bacteria | 963 |
| 263 | Ga0495632_0014722 | 3300046519 | Bacteria | 4413 |
| 264 | Ga0495643_0035688 | 3300046522 | Bacteria | 2736 |
| 265 | Ga0495644_0000024 | 3300046523 | Bacteria | 76102 |
| 266 | Ga0495654_0003647 | 3300046530 | Bacteria | 9354 |
| 267 | Ga0495597_0000986 | 3300046542 | Bacteria | 21941 |
| 268 | Ga0495656_0369597 | 3300046615 | Bacteria | 746 |
| 269 | Ga0495611_0001487 | 3300046648 | Bacteria | 11647 |
| 270 | Ga0495599_0442545 | 3300046678 | Bacteria | 770 |
| 271 | Ga0495623_0361480 | 3300046679 | Unclassified | 789 |
| 272 | Ga0495671_0152312 | 3300046692 | Bacteria | 1125 |
| 273 | Ga0495649_0000152 | 3300046694 | Bacteria | 60670 |
| 274 | Ga0495589_0000387 | 3300046794 | Bacteria | 33666 |
| 275 | Ga0495672_0029237 | 3300047320 | Bacteria | 3474 |
| 276 | Ga0495672_0040668 | 3300047320 | Bacteria | 2817 |
| 277 | Ga0495672_0335521 | 3300047320 | Bacteria | 706 |
| 278 | Ga0495683_0077024 | 3300047323 | Bacteria | 1630 |
| 279 | Ga0495615_0001156 | 3300048090 | Bacteria | 3812 |
| 280 | Ga0495626_0006759 | 3300048091 | Bacteria | 6488 |
| 281 | Ga0496101_0349804 | 3300048904 | Bacteria | 1161 |
| 282 | Ga0496102_0000313 | 3300048905 | Bacteria | 61085 |
| 283 | Ga0496102_1971073 | 3300048905 | Unclassified | 500 |
| 284 | Ga0496104_0874732 | 3300048907 | Bacteria | 804 |
| 285 | Ga0496104_1037318 | 3300048907 | Unclassified | 724 |
| 286 | Ga0496104_1583121 | 3300048907 | Unclassified | 558 |
| 287 | Ga0496106_0443141 | 3300048909 | Bacteria | 1043 |
| 288 | Ga0496107_0747042 | 3300048910 | Bacteria | 718 |
| 289 | Ga0496109_0079084 | 3300048912 | Bacteria | 3029 |
| 290 | Ga0496110_0118328 | 3300048913 | Bacteria | 2386 |
| 291 | Ga0496110_0405617 | 3300048913 | Bacteria | 1243 |
| 292 | Ga0496110_0491223 | 3300048913 | Bacteria | 1118 |
| 293 | Ga0496111_0120145 | 3300048914 | Bacteria | 1941 |
| 294 | Ga0496111_0655071 | 3300048914 | Unclassified | 766 |
| 295 | Ga0496112_0791431 | 3300048915 | Bacteria | 873 |
| 296 | Ga0496113_0289282 | 3300048916 | Bacteria | 1311 |
| 297 | Ga0496114_0103217 | 3300048917 | Bacteria | 2437 |
| 298 | Ga0496115_0042601 | 3300048918 | Bacteria | 3617 |
| 299 | Ga0496115_0076467 | 3300048918 | Bacteria | 2721 |
| 300 | Ga0496115_1212185 | 3300048918 | Unclassified | 566 |
| 301 | Ga0496116_0073250 | 3300048919 | Bacteria | 2160 |
| 302 | Ga0496116_0102795 | 3300048919 | Bacteria | 1702 |
| 303 | Ga0496117_0088488 | 3300048920 | Bacteria | 2003 |
| 304 | Ga0496118_0146693 | 3300048921 | Bacteria | 1484 |
| 305 | Ga0496122_0025550 | 3300048925 | Bacteria | 5125 |
| 306 | Ga0496122_0368510 | 3300048925 | Bacteria | 742 |
| 307 | Ga0496123_0043079 | 3300048926 | Bacteria | 3105 |
| 308 | Ga0496124_0008383 | 3300048927 | Bacteria | 10814 |
| 309 | Ga0496124_0525336 | 3300048927 | Bacteria | 787 |
| 310 | Ga0496124_0775483 | 3300048927 | Bacteria | 597 |
| 311 | Ga0495678_002650 | 3300049459 | Bacteria | 11881 |
| 312 | Ga0495678_007163 | 3300049459 | Bacteria | 5820 |
| 313 | Ga0501037_0415295 | 3300049573 | Bacteria | 921 |
| 314 | nmdc:mga0k408_138998_c1 | 3300050493 | Bacteria | 1444 |
| 315 | nmdc:mga05p37_158096_c1 | 3300050507 | Bacteria | 2769 |
| 316 | nmdc:mga05p37_236965_c1 | 3300050507 | Bacteria | 2196 |
| 317 | nmdc:mga09592_916324_c1 | 3300050508 | Bacteria | 736 |
| 318 | nmdc:mga06r32_117485_c1 | 3300050510 | Bacteria | 2621 |
| 319 | nmdc:mga0n895_1469104_c1 | 3300050512 | Bacteria | 649 |
| 320 | nmdc:mga0n895_1822504_c1 | 3300050512 | Unclassified | 569 |
| 321 | nmdc:mga0n895_51490_c1 | 3300050512 | Bacteria | 4040 |
| 322 | nmdc:mga0n895_577968_c1 | 3300050512 | Bacteria | 1128 |
| 323 | nmdc:mga0rr50_1082272_c1 | 3300050513 | Bacteria | 682 |
| 324 | nmdc:mga0rr50_6006_c1 | 3300050513 | Bacteria | 7330 |
| 325 | nmdc:mga0rr50_641146_c1 | 3300050513 | Bacteria | 906 |
| 326 | nmdc:mga0rr50_952425_c1 | 3300050513 | Bacteria | 732 |
| 327 | nmdc:mga08x19_130062_c1 | 3300050514 | Bacteria | 1693 |
| 328 | nmdc:mga08x19_350074_c1 | 3300050514 | Bacteria | 1031 |
| 329 | nmdc:mga08x19_58576_c1 | 3300050514 | Unclassified | 2492 |
| 330 | nmdc:mga08x19_71754_c1 | 3300050514 | Bacteria | 2258 |
| 331 | nmdc:mga0a205_1212752_c1 | 3300050515 | Bacteria | 602 |
| 332 | nmdc:mga0a205_186891_c1 | 3300050515 | Bacteria | 1965 |
| 333 | nmdc:mga0a205_837540_c1 | 3300050515 | Bacteria | 767 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027614 | Ga0209970_1089952 | Ga0209970_10899521 | 92 |
| 2 | 3300006844 | Ga0075428_102426113 | Ga0075428_1024261131 | 98 |
| 3 | 3300003323 | rootH1_10230848 | rootH1_102308482 | 99 |
| 4 | 3300003781 | Ga0055536_1000013 | Ga0055536_1000013215 | 99 |
| 5 | 3300003791 | Ga0055530_10000648 | Ga0055530_100006485 | 99 |
| 6 | 3300003792 | Ga0055540_1000008 | Ga0055540_1000008260 | 99 |
| 7 | 3300003794 | Ga0055531_10000242 | Ga0055531_1000024244 | 99 |
| 8 | 3300004801 | Ga0058860_11982111 | Ga0058860_119821112 | 99 |
| 9 | 3300005467 | Ga0070706_100047782 | Ga0070706_1000477824 | 99 |
| 10 | 3300005471 | Ga0070698_100531379 | Ga0070698_1005313792 | 99 |
| 11 | 3300006852 | Ga0075433_10908346 | Ga0075433_109083462 | 99 |
| 12 | 3300007076 | Ga0075435_100421407 | Ga0075435_1004214072 | 99 |
| 13 | 3300010159 | Ga0099796_10213158 | Ga0099796_102131581 | 99 |
| 14 | 3300013306 | Ga0163162_11599326 | Ga0163162_115993261 | 99 |
| 15 | 3300025910 | Ga0207684_10040492 | Ga0207684_100404924 | 99 |
| 16 | 3300025939 | Ga0207665_10082429 | Ga0207665_100824293 | 99 |
| 17 | 3300050513 | nmdc:mga0rr50_952425_c1 | nmdc:mga0rr50_952425_c1_21_329 | 99 |
| 18 | 3300005290 | Ga0065712_10138851 | Ga0065712_101388513 | 100 |
| 19 | 3300005293 | Ga0065715_10423373 | Ga0065715_104233732 | 100 |
| 20 | 3300005327 | Ga0070658_10912311 | Ga0070658_109123111 | 100 |
| 21 | 3300005328 | Ga0070676_10340205 | Ga0070676_103402051 | 100 |
| 22 | 3300005333 | Ga0070677_10593453 | Ga0070677_105934531 | 100 |
| 23 | 3300005335 | Ga0070666_10157752 | Ga0070666_101577522 | 100 |
| 24 | 3300005336 | Ga0070680_100084500 | Ga0070680_1000845004 | 100 |
| 25 | 3300005343 | Ga0070687_100122687 | Ga0070687_1001226871 | 100 |
| 26 | 3300005354 | Ga0070675_101049064 | Ga0070675_1010490642 | 100 |
| 27 | 3300005354 | Ga0070675_101257640 | Ga0070675_1012576401 | 100 |
| 28 | 3300005355 | Ga0070671_100171295 | Ga0070671_1001712953 | 100 |
| 29 | 3300005356 | Ga0070674_100564174 | Ga0070674_1005641741 | 100 |
| 30 | 3300005434 | Ga0070709_10351182 | Ga0070709_103511822 | 100 |
| 31 | 3300005435 | Ga0070714_100512902 | Ga0070714_1005129022 | 100 |
| 32 | 3300005435 | Ga0070714_100907377 | Ga0070714_1009073772 | 100 |
| 33 | 3300005435 | Ga0070714_101338771 | Ga0070714_1013387712 | 100 |
| 34 | 3300005436 | Ga0070713_100352585 | Ga0070713_1003525853 | 100 |
| 35 | 3300005436 | Ga0070713_101480139 | Ga0070713_1014801391 | 100 |
| 36 | 3300005437 | Ga0070710_10034327 | Ga0070710_100343273 | 100 |
| 37 | 3300005439 | Ga0070711_100037199 | Ga0070711_1000371994 | 100 |
| 38 | 3300005439 | Ga0070711_100066602 | Ga0070711_1000666023 | 100 |
| 39 | 3300005439 | Ga0070711_101606467 | Ga0070711_1016064672 | 100 |
| 40 | 3300005440 | Ga0070705_101310965 | Ga0070705_1013109651 | 100 |
| 41 | 3300005444 | Ga0070694_100424624 | Ga0070694_1004246242 | 100 |
| 42 | 3300005445 | Ga0070708_100005127 | Ga0070708_10000512710 | 100 |
| 43 | 3300005445 | Ga0070708_100009287 | Ga0070708_1000092874 | 100 |
| 44 | 3300005445 | Ga0070708_100178108 | Ga0070708_1001781082 | 100 |
| 45 | 3300005445 | Ga0070708_100504237 | Ga0070708_1005042372 | 100 |
| 46 | 3300005445 | Ga0070708_101022742 | Ga0070708_1010227421 | 100 |
| 47 | 3300005455 | Ga0070663_100785894 | Ga0070663_1007858941 | 100 |
| 48 | 3300005456 | Ga0070678_100230853 | Ga0070678_1002308533 | 100 |
| 49 | 3300005456 | Ga0070678_100379378 | Ga0070678_1003793782 | 100 |
| 50 | 3300005456 | Ga0070678_101073212 | Ga0070678_1010732121 | 100 |
| 51 | 3300005457 | Ga0070662_100231565 | Ga0070662_1002315652 | 100 |
| 52 | 3300005458 | Ga0070681_10047835 | Ga0070681_100478353 | 100 |
| 53 | 3300005458 | Ga0070681_10068109 | Ga0070681_100681092 | 100 |
| 54 | 3300005467 | Ga0070706_100004720 | Ga0070706_10000472011 | 100 |
| 55 | 3300005467 | Ga0070706_100048021 | Ga0070706_1000480215 | 100 |
| 56 | 3300005467 | Ga0070706_100049298 | Ga0070706_1000492984 | 100 |
| 57 | 3300005467 | Ga0070706_100227056 | Ga0070706_1002270562 | 100 |
| 58 | 3300005467 | Ga0070706_100246896 | Ga0070706_1002468961 | 100 |
| 59 | 3300005467 | Ga0070706_100401807 | Ga0070706_1004018071 | 100 |
| 60 | 3300005467 | Ga0070706_100428213 | Ga0070706_1004282133 | 100 |
| 61 | 3300005468 | Ga0070707_100007427 | Ga0070707_1000074272 | 100 |
| 62 | 3300005468 | Ga0070707_100020526 | Ga0070707_1000205265 | 100 |
| 63 | 3300005468 | Ga0070707_100088099 | Ga0070707_1000880992 | 100 |
| 64 | 3300005468 | Ga0070707_100096357 | Ga0070707_1000963572 | 100 |
| 65 | 3300005468 | Ga0070707_100186666 | Ga0070707_1001866663 | 100 |
| 66 | 3300005468 | Ga0070707_100189990 | Ga0070707_1001899903 | 100 |
| 67 | 3300005468 | Ga0070707_101557825 | Ga0070707_1015578251 | 100 |
| 68 | 3300005471 | Ga0070698_100022137 | Ga0070698_1000221373 | 100 |
| 69 | 3300005471 | Ga0070698_100026816 | Ga0070698_1000268165 | 100 |
| 70 | 3300005471 | Ga0070698_100050282 | Ga0070698_1000502823 | 100 |
| 71 | 3300005471 | Ga0070698_100345252 | Ga0070698_1003452523 | 100 |
| 72 | 3300005471 | Ga0070698_100618733 | Ga0070698_1006187332 | 100 |
| 73 | 3300005518 | Ga0070699_100058531 | Ga0070699_1000585312 | 100 |
| 74 | 3300005518 | Ga0070699_100147335 | Ga0070699_1001473351 | 100 |
| 75 | 3300005518 | Ga0070699_100623571 | Ga0070699_1006235712 | 100 |
| 76 | 3300005530 | Ga0070679_100097098 | Ga0070679_1000970982 | 100 |
| 77 | 3300005530 | Ga0070679_100214450 | Ga0070679_1002144503 | 100 |
| 78 | 3300005536 | Ga0070697_100022231 | Ga0070697_1000222313 | 100 |
| 79 | 3300005536 | Ga0070697_100025358 | Ga0070697_1000253586 | 100 |
| 80 | 3300005536 | Ga0070697_100146131 | Ga0070697_1001461311 | 100 |
| 81 | 3300005536 | Ga0070697_100188981 | Ga0070697_1001889813 | 100 |
| 82 | 3300005536 | Ga0070697_100574895 | Ga0070697_1005748953 | 100 |
| 83 | 3300005536 | Ga0070697_100870604 | Ga0070697_1008706041 | 100 |
| 84 | 3300005543 | Ga0070672_101277018 | Ga0070672_1012770181 | 100 |
| 85 | 3300005545 | Ga0070695_100407141 | Ga0070695_1004071412 | 100 |
| 86 | 3300005545 | Ga0070695_100468156 | Ga0070695_1004681562 | 100 |
| 87 | 3300005546 | Ga0070696_100780516 | Ga0070696_1007805162 | 100 |
| 88 | 3300005548 | Ga0070665_100220165 | Ga0070665_1002201653 | 100 |
| 89 | 3300005548 | Ga0070665_100487997 | Ga0070665_1004879972 | 100 |
| 90 | 3300005549 | Ga0070704_100027586 | Ga0070704_1000275865 | 100 |
| 91 | 3300005549 | Ga0070704_100184533 | Ga0070704_1001845333 | 100 |
| 92 | 3300005616 | Ga0068852_101224083 | Ga0068852_1012240831 | 100 |
| 93 | 3300005617 | Ga0068859_101068893 | Ga0068859_1010688932 | 100 |
| 94 | 3300005617 | Ga0068859_102346118 | Ga0068859_1023461182 | 100 |
| 95 | 3300005618 | Ga0068864_100452025 | Ga0068864_1004520253 | 100 |
| 96 | 3300005842 | Ga0068858_100751009 | Ga0068858_1007510092 | 100 |
| 97 | 3300005843 | Ga0068860_102083204 | Ga0068860_1020832041 | 100 |
| 98 | 3300006028 | Ga0070717_10037057 | Ga0070717_100370574 | 100 |
| 99 | 3300006028 | Ga0070717_10062132 | Ga0070717_100621321 | 100 |
| 100 | 3300006028 | Ga0070717_10402602 | Ga0070717_104026022 | 100 |
| 101 | 3300006058 | Ga0075432_10098497 | Ga0075432_100984972 | 100 |
| 102 | 3300006058 | Ga0075432_10130009 | Ga0075432_101300092 | 100 |
| 103 | 3300006163 | Ga0070715_10040003 | Ga0070715_100400033 | 100 |
| 104 | 3300006173 | Ga0070716_100028595 | Ga0070716_1000285955 | 100 |
| 105 | 3300006173 | Ga0070716_100367615 | Ga0070716_1003676152 | 100 |
| 106 | 3300006175 | Ga0070712_100041469 | Ga0070712_1000414693 | 100 |
| 107 | 3300006175 | Ga0070712_100121843 | Ga0070712_1001218432 | 100 |
| 108 | 3300006175 | Ga0070712_100293103 | Ga0070712_1002931032 | 100 |
| 109 | 3300006175 | Ga0070712_100924865 | Ga0070712_1009248653 | 100 |
| 110 | 3300006237 | Ga0097621_100243675 | Ga0097621_1002436753 | 100 |
| 111 | 3300006852 | Ga0075433_10724550 | Ga0075433_107245502 | 100 |
| 112 | 3300006852 | Ga0075433_11540596 | Ga0075433_115405962 | 100 |
| 113 | 3300006852 | Ga0075433_11681221 | Ga0075433_116812211 | 100 |
| 114 | 3300006871 | Ga0075434_100235459 | Ga0075434_1002354593 | 100 |
| 115 | 3300006871 | Ga0075434_100647848 | Ga0075434_1006478481 | 100 |
| 116 | 3300006871 | Ga0075434_100785697 | Ga0075434_1007856971 | 100 |
| 117 | 3300006880 | Ga0075429_101101468 | Ga0075429_1011014681 | 100 |
| 118 | 3300006881 | Ga0068865_101683902 | Ga0068865_1016839021 | 100 |
| 119 | 3300006914 | Ga0075436_100054623 | Ga0075436_1000546233 | 100 |
| 120 | 3300006914 | Ga0075436_100193205 | Ga0075436_1001932053 | 100 |
| 121 | 3300006931 | Ga0097620_101068941 | Ga0097620_1010689412 | 100 |
| 122 | 3300006931 | Ga0097620_102346166 | Ga0097620_1023461661 | 100 |
| 123 | 3300007076 | Ga0075435_100003103 | Ga0075435_10000310312 | 100 |
| 124 | 3300007076 | Ga0075435_100363551 | Ga0075435_1003635513 | 100 |
| 125 | 3300007076 | Ga0075435_100402011 | Ga0075435_1004020112 | 100 |
| 126 | 3300009147 | Ga0114129_10348418 | Ga0114129_103484183 | 100 |
| 127 | 3300009147 | Ga0114129_10543140 | Ga0114129_105431401 | 100 |
| 128 | 3300009147 | Ga0114129_10871104 | Ga0114129_108711042 | 100 |
| 129 | 3300009147 | Ga0114129_11662532 | Ga0114129_116625321 | 100 |
| 130 | 3300009148 | Ga0105243_10000098 | Ga0105243_1000009843 | 100 |
| 131 | 3300009176 | Ga0105242_10244279 | Ga0105242_102442792 | 100 |
| 132 | 3300009176 | Ga0105242_10838220 | Ga0105242_108382202 | 100 |
| 133 | 3300009177 | Ga0105248_10561724 | Ga0105248_105617242 | 100 |
| 134 | 3300009553 | Ga0105249_11813088 | Ga0105249_118130881 | 100 |
| 135 | 3300010159 | Ga0099796_10191156 | Ga0099796_101911561 | 100 |
| 136 | 3300010375 | Ga0105239_12756743 | Ga0105239_127567431 | 100 |
| 137 | 3300011119 | Ga0105246_10006334 | Ga0105246_100063344 | 100 |
| 138 | 3300013102 | Ga0157371_11136474 | Ga0157371_111364741 | 100 |
| 139 | 3300013296 | Ga0157374_10290950 | Ga0157374_102909502 | 100 |
| 140 | 3300013306 | Ga0163162_10629034 | Ga0163162_106290343 | 100 |
| 141 | 3300013307 | Ga0157372_10036823 | Ga0157372_100368232 | 100 |
| 142 | 3300014326 | Ga0157380_13449606 | Ga0157380_134496062 | 100 |
| 143 | 3300014497 | Ga0182008_10024465 | Ga0182008_100244653 | 100 |
| 144 | 3300014968 | Ga0157379_10627577 | Ga0157379_106275772 | 100 |
| 145 | 3300014969 | Ga0157376_10549214 | Ga0157376_105492143 | 100 |
| 146 | 3300015262 | Ga0182007_10090224 | Ga0182007_100902242 | 100 |
| 147 | 3300015265 | Ga0182005_1044207 | Ga0182005_10442073 | 100 |
| 148 | 3300025245 | Ga0207425_1015966 | Ga0207425_10159662 | 100 |
| 149 | 3300025294 | Ga0209025_1044165 | Ga0209025_10441652 | 100 |
| 150 | 3300025711 | Ga0207696_1000002 | Ga0207696_1000002826 | 100 |
| 151 | 3300025728 | Ga0207655_1000080 | Ga0207655_1000080123 | 100 |
| 152 | 3300025728 | Ga0207655_1020096 | Ga0207655_10200962 | 100 |
| 153 | 3300025898 | Ga0207692_10695868 | Ga0207692_106958681 | 100 |
| 154 | 3300025898 | Ga0207692_10877631 | Ga0207692_108776311 | 100 |
| 155 | 3300025903 | Ga0207680_10046432 | Ga0207680_100464322 | 100 |
| 156 | 3300025906 | Ga0207699_10097393 | Ga0207699_100973933 | 100 |
| 157 | 3300025910 | Ga0207684_10000285 | Ga0207684_1000028573 | 100 |
| 158 | 3300025910 | Ga0207684_10008062 | Ga0207684_100080627 | 100 |
| 159 | 3300025910 | Ga0207684_10021308 | Ga0207684_100213082 | 100 |
| 160 | 3300025910 | Ga0207684_10053402 | Ga0207684_100534023 | 100 |
| 161 | 3300025910 | Ga0207684_10106122 | Ga0207684_101061222 | 100 |
| 162 | 3300025910 | Ga0207684_10413617 | Ga0207684_104136171 | 100 |
| 163 | 3300025910 | Ga0207684_10449526 | Ga0207684_104495261 | 100 |
| 164 | 3300025910 | Ga0207684_11147541 | Ga0207684_111475412 | 100 |
| 165 | 3300025912 | Ga0207707_10026512 | Ga0207707_100265124 | 100 |
| 166 | 3300025915 | Ga0207693_10024709 | Ga0207693_100247094 | 100 |
| 167 | 3300025915 | Ga0207693_10056333 | Ga0207693_100563333 | 100 |
| 168 | 3300025915 | Ga0207693_10334568 | Ga0207693_103345682 | 100 |
| 169 | 3300025916 | Ga0207663_10074586 | Ga0207663_100745863 | 100 |
| 170 | 3300025916 | Ga0207663_10150664 | Ga0207663_101506643 | 100 |
| 171 | 3300025916 | Ga0207663_10851452 | Ga0207663_108514522 | 100 |
| 172 | 3300025918 | Ga0207662_10102446 | Ga0207662_101024462 | 100 |
| 173 | 3300025921 | Ga0207652_10144776 | Ga0207652_101447762 | 100 |
| 174 | 3300025921 | Ga0207652_10481090 | Ga0207652_104810902 | 100 |
| 175 | 3300025922 | Ga0207646_10009700 | Ga0207646_100097008 | 100 |
| 176 | 3300025922 | Ga0207646_10085290 | Ga0207646_100852903 | 100 |
| 177 | 3300025922 | Ga0207646_10116640 | Ga0207646_101166402 | 100 |
| 178 | 3300025922 | Ga0207646_10145683 | Ga0207646_101456832 | 100 |
| 179 | 3300025922 | Ga0207646_10164367 | Ga0207646_101643671 | 100 |
| 180 | 3300025922 | Ga0207646_10393341 | Ga0207646_103933412 | 100 |
| 181 | 3300025922 | Ga0207646_10488407 | Ga0207646_104884072 | 100 |
| 182 | 3300025928 | Ga0207700_10225086 | Ga0207700_102250861 | 100 |
| 183 | 3300025928 | Ga0207700_11244821 | Ga0207700_112448212 | 100 |
| 184 | 3300025929 | Ga0207664_10568607 | Ga0207664_105686071 | 100 |
| 185 | 3300025929 | Ga0207664_11127962 | Ga0207664_111279621 | 100 |
| 186 | 3300025931 | Ga0207644_10268276 | Ga0207644_102682761 | 100 |
| 187 | 3300025933 | Ga0207706_10116645 | Ga0207706_101166453 | 100 |
| 188 | 3300025934 | Ga0207686_10980740 | Ga0207686_109807402 | 100 |
| 189 | 3300025935 | Ga0207709_10000011 | Ga0207709_1000001143 | 100 |
| 190 | 3300025937 | Ga0207669_10372023 | Ga0207669_103720231 | 100 |
| 191 | 3300025940 | Ga0207691_10329750 | Ga0207691_103297501 | 100 |
| 192 | 3300025942 | Ga0207689_10815878 | Ga0207689_108158782 | 100 |
| 193 | 3300025949 | Ga0207667_11632257 | Ga0207667_116322571 | 100 |
| 194 | 3300026035 | Ga0207703_10336018 | Ga0207703_103360181 | 100 |
| 195 | 3300026088 | Ga0207641_10127971 | Ga0207641_101279712 | 100 |
| 196 | 3300026121 | Ga0207683_10084657 | Ga0207683_100846574 | 100 |
| 197 | 3300026121 | Ga0207683_10469899 | Ga0207683_104698991 | 100 |
| 198 | 3300027907 | Ga0207428_10912437 | Ga0207428_109124371 | 100 |
| 199 | 3300028379 | Ga0268266_10150918 | Ga0268266_101509182 | 100 |
| 200 | 3300028379 | Ga0268266_12356559 | Ga0268266_123565591 | 100 |
| 201 | 3300028381 | Ga0268264_11878728 | Ga0268264_118787282 | 100 |
| 202 | 3300031239 | Ga0265328_10074292 | Ga0265328_100742922 | 100 |
| 203 | 3300031344 | Ga0265316_10336396 | Ga0265316_103363962 | 100 |
| 204 | 3300031691 | Ga0316579_10029995 | Ga0316579_100299952 | 100 |
| 205 | 3300031731 | Ga0307405_10222355 | Ga0307405_102223551 | 100 |
| 206 | 3300031731 | Ga0307405_10865560 | Ga0307405_108655602 | 100 |
| 207 | 3300032004 | Ga0307414_10014222 | Ga0307414_100142224 | 100 |
| 208 | 3300035084 | Ga0373928_0142633 | Ga0373928_0142633_91_393 | 100 |
| 209 | 3300035091 | Ga0373951_0239317 | Ga0373951_0239317_154_456 | 100 |
| 210 | 3300035114 | Ga0373939_0032745 | Ga0373939_0032745_189_491 | 100 |
| 211 | 3300035121 | Ga0373960_0392180 | Ga0373960_0392180_137_439 | 100 |
| 212 | 3300035170 | Ga0373943_0133233 | Ga0373943_0133233_128_430 | 100 |
| 213 | 3300035691 | Ga0373931_1177496 | Ga0373931_1177496_206_508 | 100 |
| 214 | 3300035692 | Ga0373935_0668602 | Ga0373935_0668602_319_621 | 100 |
| 215 | 3300036647 | Ga0316582_0073289 | Ga0316582_0073289_454_756 | 100 |
| 216 | 3300041407 | Ga0439447_012543 | Ga0439447_012543_2053_2355 | 100 |
| 217 | 3300042006 | Ga0439432_000019 | Ga0439432_000019_16344_16646 | 100 |
| 218 | 3300042009 | Ga0439451_101306 | Ga0439451_101306_255_557 | 100 |
| 219 | 3300042016 | Ga0439463_000879 | Ga0439463_000879_5346_5648 | 100 |
| 220 | 3300042137 | Ga0450902_022260 | Ga0450902_022260_189_491 | 100 |
| 221 | 3300042139 | Ga0450904_023727 | Ga0450904_023727_209_511 | 100 |
| 222 | 3300042142 | Ga0450905_015759 | Ga0450905_015759_726_1028 | 100 |
| 223 | 3300046452 | Ga0495617_278609 | Ga0495617_278609_12_314 | 100 |
| 224 | 3300046457 | Ga0495590_0005142 | Ga0495590_0005142_283_585 | 100 |
| 225 | 3300046458 | Ga0495591_100551 | Ga0495591_100551_147_449 | 100 |
| 226 | 3300046460 | Ga0495638_0000129 | Ga0495638_0000129_86928_87230 | 100 |
| 227 | 3300046474 | Ga0495605_0007848 | Ga0495605_0007848_2399_2701 | 100 |
| 228 | 3300046491 | Ga0495584_0032142 | Ga0495584_0032142_1219_1521 | 100 |
| 229 | 3300046491 | Ga0495584_0038425 | Ga0495584_0038425_2066_2368 | 100 |
| 230 | 3300046492 | Ga0495585_0182639 | Ga0495585_0182639_563_865 | 100 |
| 231 | 3300046501 | Ga0495607_0046915 | Ga0495607_0046915_2176_2478 | 100 |
| 232 | 3300046513 | Ga0495616_0040542 | Ga0495616_0040542_135_437 | 100 |
| 233 | 3300046519 | Ga0495632_0014722 | Ga0495632_0014722_3258_3560 | 100 |
| 234 | 3300046522 | Ga0495643_0035688 | Ga0495643_0035688_408_710 | 100 |
| 235 | 3300046523 | Ga0495644_0000024 | Ga0495644_0000024_18348_18650 | 100 |
| 236 | 3300046530 | Ga0495654_0003647 | Ga0495654_0003647_1997_2299 | 100 |
| 237 | 3300046542 | Ga0495597_0000986 | Ga0495597_0000986_7813_8115 | 100 |
| 238 | 3300046615 | Ga0495656_0369597 | Ga0495656_0369597_74_376 | 100 |
| 239 | 3300046648 | Ga0495611_0001487 | Ga0495611_0001487_6074_6376 | 100 |
| 240 | 3300046692 | Ga0495671_0152312 | Ga0495671_0152312_768_1070 | 100 |
| 241 | 3300046694 | Ga0495649_0000152 | Ga0495649_0000152_35437_35739 | 100 |
| 242 | 3300046794 | Ga0495589_0000387 | Ga0495589_0000387_26012_26314 | 100 |
| 243 | 3300047320 | Ga0495672_0029237 | Ga0495672_0029237_1782_2084 | 100 |
| 244 | 3300047320 | Ga0495672_0040668 | Ga0495672_0040668_1163_1465 | 100 |
| 245 | 3300047320 | Ga0495672_0335521 | Ga0495672_0335521_246_548 | 100 |
| 246 | 3300047323 | Ga0495683_0077024 | Ga0495683_0077024_52_354 | 100 |
| 247 | 3300048090 | Ga0495615_0001156 | Ga0495615_0001156_3301_3603 | 100 |
| 248 | 3300048091 | Ga0495626_0006759 | Ga0495626_0006759_2631_2933 | 100 |
| 249 | 3300048904 | Ga0496101_0349804 | Ga0496101_0349804_440_742 | 100 |
| 250 | 3300048905 | Ga0496102_0000313 | Ga0496102_0000313_16119_16421 | 100 |
| 251 | 3300048905 | Ga0496102_1971073 | Ga0496102_1971073_51_353 | 100 |
| 252 | 3300048907 | Ga0496104_1037318 | Ga0496104_1037318_318_620 | 100 |
| 253 | 3300048907 | Ga0496104_1583121 | Ga0496104_1583121_19_321 | 100 |
| 254 | 3300048909 | Ga0496106_0443141 | Ga0496106_0443141_134_436 | 100 |
| 255 | 3300048912 | Ga0496109_0079084 | Ga0496109_0079084_2133_2435 | 100 |
| 256 | 3300048913 | Ga0496110_0405617 | Ga0496110_0405617_98_400 | 100 |
| 257 | 3300048913 | Ga0496110_0491223 | Ga0496110_0491223_596_898 | 100 |
| 258 | 3300048914 | Ga0496111_0120145 | Ga0496111_0120145_707_1009 | 100 |
| 259 | 3300048914 | Ga0496111_0655071 | Ga0496111_0655071_152_454 | 100 |
| 260 | 3300048915 | Ga0496112_0791431 | Ga0496112_0791431_473_775 | 100 |
| 261 | 3300048916 | Ga0496113_0289282 | Ga0496113_0289282_346_648 | 100 |
| 262 | 3300048918 | Ga0496115_0076467 | Ga0496115_0076467_1538_1840 | 100 |
| 263 | 3300048919 | Ga0496116_0073250 | Ga0496116_0073250_308_610 | 100 |
| 264 | 3300048919 | Ga0496116_0102795 | Ga0496116_0102795_337_639 | 100 |
| 265 | 3300048920 | Ga0496117_0088488 | Ga0496117_0088488_916_1218 | 100 |
| 266 | 3300048921 | Ga0496118_0146693 | Ga0496118_0146693_683_985 | 100 |
| 267 | 3300048925 | Ga0496122_0025550 | Ga0496122_0025550_3871_4173 | 100 |
| 268 | 3300048925 | Ga0496122_0368510 | Ga0496122_0368510_372_674 | 100 |
| 269 | 3300048926 | Ga0496123_0043079 | Ga0496123_0043079_1428_1730 | 100 |
| 270 | 3300048927 | Ga0496124_0008383 | Ga0496124_0008383_3222_3524 | 100 |
| 271 | 3300048927 | Ga0496124_0525336 | Ga0496124_0525336_196_498 | 100 |
| 272 | 3300048927 | Ga0496124_0775483 | Ga0496124_0775483_118_420 | 100 |
| 273 | 3300049459 | Ga0495678_002650 | Ga0495678_002650_5177_5479 | 100 |
| 274 | 3300049459 | Ga0495678_007163 | Ga0495678_007163_3665_3967 | 100 |
| 275 | 3300050493 | nmdc:mga0k408_138998_c1 | nmdc:mga0k408_138998_c1_884_1186 | 100 |
| 276 | 3300050507 | nmdc:mga05p37_158096_c1 | nmdc:mga05p37_158096_c1_2310_2660 | 100 |
| 277 | 3300050507 | nmdc:mga05p37_236965_c1 | nmdc:mga05p37_236965_c1_1651_2022 | 100 |
| 278 | 3300050508 | nmdc:mga09592_916324_c1 | nmdc:mga09592_916324_c1_184_498 | 100 |
| 279 | 3300050510 | nmdc:mga06r32_117485_c1 | nmdc:mga06r32_117485_c1_79_396 | 100 |
| 280 | 3300050512 | nmdc:mga0n895_1469104_c1 | nmdc:mga0n895_1469104_c1_71_421 | 100 |
| 281 | 3300050512 | nmdc:mga0n895_1822504_c1 | nmdc:mga0n895_1822504_c1_233_535 | 100 |
| 282 | 3300050512 | nmdc:mga0n895_51490_c1 | nmdc:mga0n895_51490_c1_1411_1713 | 100 |
| 283 | 3300050512 | nmdc:mga0n895_577968_c1 | nmdc:mga0n895_577968_c1_704_1075 | 100 |
| 284 | 3300050513 | nmdc:mga0rr50_1082272_c1 | nmdc:mga0rr50_1082272_c1_292_618 | 100 |
| 285 | 3300050513 | nmdc:mga0rr50_6006_c1 | nmdc:mga0rr50_6006_c1_6961_7263 | 100 |
| 286 | 3300050513 | nmdc:mga0rr50_641146_c1 | nmdc:mga0rr50_641146_c1_79_381 | 100 |
| 287 | 3300050514 | nmdc:mga08x19_130062_c1 | nmdc:mga08x19_130062_c1_43_345 | 100 |
| 288 | 3300050514 | nmdc:mga08x19_350074_c1 | nmdc:mga08x19_350074_c1_462_764 | 100 |
| 289 | 3300050514 | nmdc:mga08x19_58576_c1 | nmdc:mga08x19_58576_c1_1791_2093 | 100 |
| 290 | 3300050514 | nmdc:mga08x19_71754_c1 | nmdc:mga08x19_71754_c1_1496_1798 | 100 |
| 291 | 3300050515 | nmdc:mga0a205_1212752_c1 | nmdc:mga0a205_1212752_c1_143_460 | 100 |
| 292 | 3300050515 | nmdc:mga0a205_186891_c1 | nmdc:mga0a205_186891_c1_1246_1548 | 100 |
| 293 | 3300050515 | nmdc:mga0a205_837540_c1 | nmdc:mga0a205_837540_c1_412_714 | 100 |
| 294 | 3300005539 | Ga0068853_100203084 | Ga0068853_1002030842 | 101 |
| 295 | 3300006028 | Ga0070717_10794199 | Ga0070717_107941991 | 101 |
| 296 | 3300006051 | Ga0075364_10837032 | Ga0075364_108370322 | 101 |
| 297 | 3300010375 | Ga0105239_10034935 | Ga0105239_100349353 | 101 |
| 298 | 3300026041 | Ga0207639_10581714 | Ga0207639_105817142 | 101 |
| 299 | 3300048910 | Ga0496107_0747042 | Ga0496107_0747042_77_382 | 101 |
| 300 | 3300048913 | Ga0496110_0118328 | Ga0496110_0118328_551_856 | 101 |
| 301 | 3300039437 | Ga0436365_0580786 | Ga0436365_0580786_1416_1736 | 103 |
| 302 | 3300049573 | Ga0501037_0415295 | Ga0501037_0415295_206_517 | 103 |
| 303 | 3300025906 | Ga0207699_11414970 | Ga0207699_114149701 | 104 |
| 304 | 3300025928 | Ga0207700_11131838 | Ga0207700_111318382 | 104 |
| 305 | 3300046462 | Ga0495651_0511198 | Ga0495651_0511198_213_539 | 104 |
| 306 | 3300046679 | Ga0495623_0361480 | Ga0495623_0361480_139_465 | 104 |
| 307 | 3300048918 | Ga0496115_1212185 | Ga0496115_1212185_165_491 | 104 |
| 308 | 3300046454 | Ga0495592_0141535 | Ga0495592_0141535_227_544 | 105 |
| 309 | 3300046516 | Ga0495628_0428787 | Ga0495628_0428787_335_652 | 105 |
| 310 | 3300046678 | Ga0495599_0442545 | Ga0495599_0442545_106_423 | 105 |
| 311 | 3300003322 | rootL2_10077485 | rootL2_100774853 | 106 |
| 312 | 3300004803 | Ga0058862_12195488 | Ga0058862_121954881 | 106 |
| 313 | 3300005295 | Ga0065707_11083214 | Ga0065707_110832141 | 106 |
| 314 | 3300005444 | Ga0070694_101264469 | Ga0070694_1012644691 | 106 |
| 315 | 3300005456 | Ga0070678_100250393 | Ga0070678_1002503932 | 106 |
| 316 | 3300005467 | Ga0070706_100253869 | Ga0070706_1002538692 | 106 |
| 317 | 3300005467 | Ga0070706_100257335 | Ga0070706_1002573352 | 106 |
| 318 | 3300005545 | Ga0070695_100451368 | Ga0070695_1004513681 | 106 |
| 319 | 3300005844 | Ga0068862_100674360 | Ga0068862_1006743602 | 106 |
| 320 | 3300006175 | Ga0070712_100549078 | Ga0070712_1005490781 | 106 |
| 321 | 3300009553 | Ga0105249_12426045 | Ga0105249_124260452 | 106 |
| 322 | 3300013308 | Ga0157375_10821151 | Ga0157375_108211513 | 106 |
| 323 | 3300014969 | Ga0157376_10002306 | Ga0157376_100023066 | 106 |
| 324 | 3300025910 | Ga0207684_10214711 | Ga0207684_102147114 | 106 |
| 325 | 3300025910 | Ga0207684_10472256 | Ga0207684_104722562 | 106 |
| 326 | 3300025911 | Ga0207654_11294707 | Ga0207654_112947071 | 106 |
| 327 | 3300025915 | Ga0207693_10457477 | Ga0207693_104574772 | 106 |
| 328 | 3300025961 | Ga0207712_11331425 | Ga0207712_113314252 | 106 |
| 329 | 3300026121 | Ga0207683_10270399 | Ga0207683_102703991 | 106 |
| 330 | 3300031090 | Ga0265760_10042765 | Ga0265760_100427652 | 106 |
| 331 | 3300048907 | Ga0496104_0874732 | Ga0496104_0874732_396_725 | 106 |
| 332 | 3300048917 | Ga0496114_0103217 | Ga0496114_0103217_1027_1356 | 106 |
| 333 | 3300048918 | Ga0496115_0042601 | Ga0496115_0042601_3058_3387 | 106 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.9864 | 1 | 101 |
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.9582 | 1 | 101 |
| 2omo-assembly2.cif.gz_C | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.882 | 3 | 94 |
| 2omo-assembly4.cif.gz_E | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.8808 | 4 | 95 |
| 3qmq-assembly2.cif.gz_B | crystal structure of e. coli lsrg | 0.8679 | 3 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pd1D01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9826 | 3 | 93 | 3.30.70.100 |
| 2pd1D01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9616 | 3 | 93 | 3.30.70.100 |
| af_O33291_1_95_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8782 | 3 | 97 | 3.30.70.100 |
| 3qmqB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8679 | 3 | 96 | 3.30.70.100 |
| af_O33291_1_95_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8614 | 3 | 97 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533BJI9-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9959 | 1 | 86 |
GO:0004497
|
| AF-A0A7W0U486-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9956 | 1 | 98 |
GO:0004497
|
| AF-Q1M9G4-F1-model_v4 | Conserved hypothetical exported protein | 0.9954 | 1 | 97 |
|
| AF-A0A0A1FAK1-F1-model_v4 | Quinol monooxygenase YgiN | 0.9951 | 1 | 97 |
|
| AF-A0A1M6YAS9-F1-model_v4 | Quinol monooxygenase YgiN | 0.9951 | 1 | 99 |
GO:0004497
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar