F411331

General Info

Members Datasets Scaffolds Average Seq Length
333 240 666 251

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10024684|Ga0105247_100246842
Length 278
Sequence VFLGYYGLPFRWISIQALVILFFEERSMDGTILTLFVLATFLGGFVSGFSGFAMGIVVSGIWLHIITPIQTATLIAGYGLLTQGYGIWKLRHALNWRNVWPLVLGTAIGIPIGVWLLTYINPGYVRFGVGVLLVLYAIYSLARPVFKPMKIGTAADVVIGTFNGLLGGLTGLGGVISTISCQLRGWSKDMQRAVFQPVLLAAFIIISISLSVSGAVTSESLKLYGLGLPFMIAGIWSGFKLYGKIDDETFRKVVLTLLLFAGASLIVSASIFRSVSAA

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
188 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
191 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
192 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
193 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
194 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
195 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
196 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
197 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
198 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
199 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
200 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
201 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
202 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
203 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
204 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
205 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
206 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
207 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
208 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
209 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
210 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
211 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
212 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
213 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
214 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
215 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
216 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
217 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
218 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
219 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
220 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
221 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
222 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
223 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
224 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
225 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
226 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
227 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
228 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
229 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
230 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
231 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
232 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
233 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
234 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
235 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
236 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
237 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
238 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
239 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
240 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.98
Metatranscriptomes 0
Isolates 15.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 13.81
Rhizoplane 12.01
Rhizosphere 64.86
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10024684 3300009101 Bacteria 3624
2 MBSR1b_contig_13832682 2162886012 Bacteria 1018
3 JGI25159J45721_1005397 3300002987 Bacteria 4019
4 JGI25406J46586_10002346 3300003203 Bacteria 8945
5 rootH1_10177679 3300003316 Bacteria 1161
6 rootH2_10023937 3300003320 Bacteria 7128
7 rootL2_10131133 3300003322 Bacteria 1775
8 rootL2_10279397 3300003322 Bacteria 1951
9 rootH1_10165132 3300003323 Bacteria 1265
10 JGI25404J52841_10001144 3300003659 Bacteria 4495
11 Ga0065165_1001715 3300005262 Bacteria 21983
12 Ga0065715_10162513 3300005293 Bacteria 1616
13 Ga0070683_100036624 3300005329 Bacteria 4490
14 Ga0068869_100144934 3300005334 Unclassified 1837
15 Ga0068869_100148925 3300005334 Bacteria 1814
16 Ga0070680_100018489 3300005336 Bacteria 5506
17 Ga0070682_100123714 3300005337 Bacteria 1740
18 Ga0068868_100827422 3300005338 Bacteria 837
19 Ga0070661_100034581 3300005344 Bacteria 3665
20 Ga0070671_100534440 3300005355 Unclassified 1010
21 Ga0070674_100481921 3300005356 Bacteria 1030
22 Ga0070673_100615080 3300005364 Bacteria 992
23 Ga0070709_10027436 3300005434 Bacteria 3386
24 Ga0070709_10048604 3300005434 Bacteria 2648
25 Ga0070709_10420828 3300005434 Bacteria 1001
26 Ga0070714_100333445 3300005435 Bacteria 1421
27 Ga0070714_100596859 3300005435 Unclassified 1060
28 Ga0070713_100112864 3300005436 Bacteria 2372
29 Ga0070713_100244238 3300005436 Unclassified 1636
30 Ga0070711_100062037 3300005439 Bacteria 2604
31 Ga0070711_100198757 3300005439 Bacteria 1545
32 Ga0070663_100010626 3300005455 Bacteria 5743
33 Ga0070663_100023498 3300005455 Bacteria 4133
34 Ga0070663_100031886 3300005455 Bacteria 3626
35 Ga0070678_100031265 3300005456 Bacteria 3670
36 Ga0070678_100084903 3300005456 Bacteria 2411
37 Ga0070678_100104083 3300005456 Bacteria 2207
38 Ga0070681_10080726 3300005458 Bacteria 3208
39 Ga0070679_100009982 3300005530 Bacteria 8988
40 Ga0070684_100014029 3300005535 Bacteria 6479
41 Ga0068853_100125690 3300005539 Bacteria 2291
42 Ga0068853_100244710 3300005539 Bacteria 1645
43 Ga0068853_100554323 3300005539 Unclassified 1089
44 Ga0070672_100048151 3300005543 Bacteria 3311
45 Ga0070672_100298499 3300005543 Bacteria 1365
46 Ga0070686_100159581 3300005544 Bacteria 1587
47 Ga0070693_100029125 3300005547 Bacteria 3009
48 Ga0070693_100337715 3300005547 Bacteria 1027
49 Ga0070665_100026089 3300005548 Bacteria 5883
50 Ga0070665_100072292 3300005548 Bacteria 3457
51 Ga0070665_100118848 3300005548 Bacteria 2645
52 Ga0070665_100248844 3300005548 Bacteria 1778
53 Ga0068855_100422882 3300005563 Bacteria 1457
54 Ga0068855_100516800 3300005563 Bacteria 1296
55 Ga0068857_100017532 3300005577 Bacteria 6278
56 Ga0068857_100095335 3300005577 Bacteria 2666
57 Ga0068856_100086281 3300005614 Bacteria 3119
58 Ga0068852_100539998 3300005616 Unclassified 1165
59 Ga0068859_100030884 3300005617 Bacteria 5376
60 Ga0068861_100374109 3300005719 Bacteria 1257
61 Ga0068858_100199262 3300005842 Bacteria 1893
62 Ga0068862_100200851 3300005844 Bacteria 1797
63 Ga0081540_1000238 3300005983 Bacteria 57732
64 Ga0081540_1003398 3300005983 Bacteria 12614
65 Ga0081540_1003516 3300005983 Bacteria 12367
66 Ga0081540_1004375 3300005983 Bacteria 10801
67 Ga0081540_1006853 3300005983 Bacteria 8224
68 Ga0081539_10000629 3300005985 Bacteria 71410
69 Ga0081539_10002257 3300005985 Bacteria 28023
70 Ga0081539_10020905 3300005985 Bacteria 4397
71 Ga0070717_10200381 3300006028 Bacteria 1748
72 Ga0070712_100053734 3300006175 Bacteria 2814
73 Ga0075367_10115567 3300006178 Bacteria 1650
74 Ga0097621_100177923 3300006237 Unclassified 1837
75 Ga0097621_100211450 3300006237 Bacteria 1687
76 Ga0097621_100372960 3300006237 Bacteria 1273
77 Ga0075370_10225478 3300006353 Bacteria 1108
78 Ga0068865_100099973 3300006881 Bacteria 2121
79 Ga0097620_100030884 3300006931 Bacteria 5376
80 Ga0099795_10020865 3300007788 Bacteria 2141
81 Ga0105240_10096858 3300009093 Bacteria 3595
82 Ga0105247_10630083 3300009101 Bacteria 799
83 Ga0105243_10020601 3300009148 Bacteria 4999
84 Ga0105242_10127292 3300009176 Bacteria 2194
85 Ga0105248_10107784 3300009177 Bacteria 3141
86 Ga0105237_10159564 3300009545 Bacteria 2253
87 Ga0105238_10028960 3300009551 Bacteria 5641
88 Ga0105238_10057303 3300009551 Bacteria 3907
89 Ga0105238_10140090 3300009551 Bacteria 2396
90 Ga0105238_10178336 3300009551 Bacteria 2101
91 Ga0099796_10011609 3300010159 Bacteria 2462
92 Ga0105239_10047415 3300010375 Bacteria 4708
93 Ga0105239_10059485 3300010375 Bacteria 4193
94 Ga0105239_10100380 3300010375 Bacteria 3201
95 Ga0105239_10357594 3300010375 Bacteria 1649
96 Ga0105239_10363176 3300010375 Bacteria 1635
97 Ga0105246_10001029 3300011119 Bacteria 16043
98 Ga0157369_10089762 3300013105 Bacteria 3282
99 Ga0157374_10007293 3300013296 Bacteria 9424
100 Ga0157374_10007914 3300013296 Bacteria 9074
101 Ga0157378_10011018 3300013297 Bacteria 7913
102 Ga0157378_10125878 3300013297 Bacteria 2367
103 Ga0163162_10014003 3300013306 Bacteria 7839
104 Ga0163162_10131732 3300013306 Bacteria 2609
105 Ga0163162_10191255 3300013306 Bacteria 2174
106 Ga0163162_10214549 3300013306 Bacteria 2055
107 Ga0163162_10629819 3300013306 Unclassified 1197
108 Ga0157372_10209547 3300013307 Bacteria 2258
109 Ga0157375_10010267 3300013308 Bacteria 8240
110 Ga0157375_10389498 3300013308 Bacteria 1560
111 Ga0163163_10300364 3300014325 Bacteria 1658
112 Ga0157376_10030707 3300014969 Bacteria 4294
113 Ga0163161_10308124 3300017792 Bacteria 1249
114 Ga0213876_10165278 3300021384 Bacteria 1177
115 Ga0209130_1000343 3300025284 Bacteria 53596
116 Ga0207656_10247354 3300025321 Bacteria 873
117 Ga0207710_10092842 3300025900 Bacteria 1415
118 Ga0207699_10044596 3300025906 Bacteria 2582
119 Ga0207707_10022239 3300025912 Bacteria 5543
120 Ga0207695_10276963 3300025913 Bacteria 1572
121 Ga0207671_10170909 3300025914 Bacteria 1688
122 Ga0207693_10071260 3300025915 Bacteria 2720
123 Ga0207693_10099780 3300025915 Bacteria 2277
124 Ga0207652_10246335 3300025921 Bacteria 1611
125 Ga0207694_10091861 3300025924 Bacteria 2396
126 Ga0207694_10637170 3300025924 Bacteria 898
127 Ga0207687_10018571 3300025927 Bacteria 4594
128 Ga0207700_10112008 3300025928 Bacteria 2198
129 Ga0207644_10383722 3300025931 Bacteria 1146
130 Ga0207644_10444656 3300025931 Unclassified 1064
131 Ga0207686_10334356 3300025934 Bacteria 1136
132 Ga0207704_10642254 3300025938 Bacteria 873
133 Ga0207691_10174764 3300025940 Unclassified 1879
134 Ga0207691_10211517 3300025940 Bacteria 1684
135 Ga0207689_10104716 3300025942 Bacteria 2325
136 Ga0207661_10002436 3300025944 Bacteria 12825
137 Ga0207668_10248356 3300025972 Bacteria 1444
138 Ga0207703_10104022 3300026035 Bacteria 2411
139 Ga0207639_10099184 3300026041 Bacteria 2350
140 Ga0207639_10906178 3300026041 Bacteria 824
141 Ga0207678_10005498 3300026067 Bacteria 11324
142 Ga0207678_10008407 3300026067 Bacteria 9105
143 Ga0207678_10049563 3300026067 Bacteria 3629
144 Ga0207678_10074242 3300026067 Bacteria 2914
145 Ga0207676_10028563 3300026095 Bacteria 4168
146 Ga0207674_10037216 3300026116 Bacteria 5063
147 Ga0207683_10018682 3300026121 Bacteria 5914
148 Ga0207683_10323067 3300026121 Bacteria 1414
149 Ga0209179_1045566 3300027512 Bacteria 931
150 Ga0268266_10097678 3300028379 Bacteria 2583
151 Ga0268266_10535970 3300028379 Unclassified 1120
152 Ga0268265_10210315 3300028380 Bacteria 1694
153 Ga0265318_10081067 3300028577 Bacteria 1199
154 Ga0265331_10130706 3300031250 Bacteria 1145
155 Ga0265316_10031974 3300031344 Bacteria 4299
156 Ga0307408_100615183 3300031548 Bacteria 967
157 Ga0265314_10005031 3300031711 Bacteria 12046
158 Ga0307510_10081081 3300033180 Bacteria 3149
159 Ga0373932_0015751 3300035112 Bacteria 1921
160 Ga0373936_0019068 3300035113 Bacteria 2656
161 Ga0373945_0018314 3300035116 Bacteria 2382
162 Ga0373956_0208942 3300035119 Bacteria 926
163 Ga0373957_0011365 3300035120 Bacteria 2971
164 Ga0373955_0010158 3300035172 Bacteria 4437
165 Ga0373955_0100149 3300035172 Bacteria 1662
166 Ga0373924_0003203 3300035410 Bacteria 5596
167 Ga0373935_0027763 3300035692 Bacteria 3497
168 Ga0373927_0069002 3300035695 Bacteria 2288
169 Ga0373933_0006680 3300035724 Bacteria 6286
170 Ga0373933_0096351 3300035724 Bacteria 1831
171 Ga0373947_0081968 3300035725 Bacteria 1999
172 Ga0373937_0010217 3300036401 Bacteria 8189
173 Ga0373937_0209574 3300036401 Bacteria 1833
174 Ga0373925_0020554 3300037068 Bacteria 4808
175 Ga0373925_0027532 3300037068 Bacteria 4159
176 Ga0436365_0952676 3300039437 Bacteria 6900
177 Ga0436361_0082378 3300039447 Bacteria 1230
178 Ga0451845_0400271 3300041501 Bacteria 898
179 Ga0466965_0093501 3300044683 Bacteria 1531
180 Ga0466963_0038469 3300044694 Bacteria 3128
181 Ga0466967_0045894 3300045976 Bacteria 3800
182 Ga0495592_0093682 3300046454 Bacteria 2151
183 Ga0495592_0179552 3300046454 Bacteria 1443
184 Ga0495629_0173512 3300046459 Bacteria 1495
185 Ga0495638_0258744 3300046460 Bacteria 956
186 Ga0495641_0090882 3300046461 Bacteria 1364
187 Ga0495580_0013227 3300046472 Bacteria 6308
188 Ga0495582_0018146 3300046473 Bacteria 3850
189 Ga0495662_0057828 3300046476 Bacteria 1873
190 Ga0495662_0120519 3300046476 Bacteria 1288
191 Ga0495664_0019627 3300046477 Bacteria 3889
192 Ga0495664_0124797 3300046477 Bacteria 1557
193 Ga0495618_0090757 3300046514 Bacteria 1953
194 Ga0495618_0185007 3300046514 Bacteria 1323
195 Ga0495628_0208399 3300046516 Bacteria 1471
196 Ga0495630_0187847 3300046517 Bacteria 1576
197 Ga0495666_0086037 3300046526 Bacteria 1485
198 Ga0495665_0029046 3300046531 Bacteria 2963
199 Ga0495640_0006608 3300046533 Bacteria 9148
200 Ga0495622_0006509 3300046557 Bacteria 5418
201 Ga0495667_0017616 3300046559 Bacteria 4825
202 Ga0495667_0035701 3300046559 Bacteria 3321
203 Ga0495668_0043362 3300046616 Bacteria 2503
204 Ga0495634_0020673 3300046642 Bacteria 4664
205 Ga0495635_0081970 3300046663 Bacteria 2207
206 Ga0495659_0082551 3300046664 Bacteria 1222
207 Ga0495661_0223726 3300046665 Bacteria 974
208 Ga0495588_0005886 3300046674 Bacteria 5495
209 Ga0495657_0016257 3300046675 Bacteria 5424
210 Ga0495623_0100402 3300046679 Bacteria 1764
211 Ga0495646_0143506 3300046680 Bacteria 1333
212 Ga0495658_0091470 3300046683 Bacteria 1802
213 Ga0495669_0070914 3300046684 Bacteria 1588
214 Ga0495613_0434356 3300046689 Bacteria 891
215 Ga0495600_0067583 3300046809 Bacteria 2336
216 Ga0495674_0045558 3300047319 Bacteria 3894
217 Ga0495674_0237932 3300047319 Bacteria 1501
218 Ga0495680_0039812 3300047322 Bacteria 3747
219 Ga0495673_0033131 3300047469 Bacteria 2401
220 Ga0495684_0015335 3300047471 Bacteria 5898
221 Ga0495684_0130174 3300047471 Bacteria 1891
222 Ga0495593_0022925 3300047673 Bacteria 3474
223 Ga0495602_0017200 3300048088 Bacteria 7251
224 Ga0496100_0239009 3300048903 Unclassified 1339
225 Ga0496101_0001703 3300048904 Bacteria 13165
226 Ga0496101_0068765 3300048904 Bacteria 2590
227 Ga0496102_0001416 3300048905 Bacteria 21268
228 Ga0496102_0012393 3300048905 Bacteria 7377
229 Ga0496102_0017273 3300048905 Bacteria 6320
230 Ga0496102_0437687 3300048905 Bacteria 1227
231 Ga0496103_0009799 3300048906 Bacteria 5673
232 Ga0496103_0032221 3300048906 Bacteria 3198
233 Ga0496104_0017356 3300048907 Bacteria 6552
234 Ga0496104_0057013 3300048907 Bacteria 3696
235 Ga0496104_0074842 3300048907 Bacteria 3224
236 Ga0496104_0127923 3300048907 Bacteria 2439
237 Ga0496105_0001406 3300048908 Bacteria 16895
238 Ga0496105_0014300 3300048908 Bacteria 6316
239 Ga0496106_0040698 3300048909 Bacteria 3481
240 Ga0496106_0050738 3300048909 Bacteria 3127
241 Ga0496106_0225378 3300048909 Bacteria 1495
242 Ga0496107_0000895 3300048910 Bacteria 17531
243 Ga0496107_0011274 3300048910 Bacteria 6221
244 Ga0496108_0003543 3300048911 Bacteria 12519
245 Ga0496108_0102763 3300048911 Bacteria 2439
246 Ga0496108_0313466 3300048911 Bacteria 1367
247 Ga0496109_0061456 3300048912 Bacteria 3434
248 Ga0496109_0071871 3300048912 Bacteria 3177
249 Ga0496109_0607329 3300048912 Bacteria 1030
250 Ga0496110_0144082 3300048913 Bacteria 2154
251 Ga0496110_0201287 3300048913 Bacteria 1809
252 Ga0496110_0678224 3300048913 Bacteria 931
253 Ga0496111_0014030 3300048914 Bacteria 5465
254 Ga0496111_0025553 3300048914 Bacteria 4168
255 Ga0496111_0066229 3300048914 Bacteria 2623
256 Ga0496112_0086393 3300048915 Bacteria 3103
257 Ga0496112_0150799 3300048915 Bacteria 2292
258 Ga0496113_0261825 3300048916 Bacteria 1381
259 Ga0496114_0016446 3300048917 Bacteria 5962
260 Ga0496114_0042477 3300048917 Bacteria 3769
261 Ga0496115_0094088 3300048918 Bacteria 2451
262 Ga0496115_0185586 3300048918 Bacteria 1718
263 Ga0496115_0214279 3300048918 Bacteria 1590
264 Ga0496117_0033972 3300048920 Bacteria 3850
265 Ga0496118_0025778 3300048921 Bacteria 5030
266 Ga0496121_0207476 3300048924 Bacteria 1391
267 Ga0496126_0038653 3300048929 Bacteria 4437
268 nmdc:mga03n38_52086_c1 3300050490 Bacteria 1830
269 nmdc:mga0yw44_394535_c1 3300050492 Unclassified 935
270 Ga0495601_0011641 3300053077 Bacteria 5271
271 Ga0495601_0076312 3300053077 Bacteria 2146
272 Ga0495601_0089655 3300053077 Bacteria 1978
273 Ga0495612_0057523 3300053078 Bacteria 1606
274 Ga0495612_0148588 3300053078 Bacteria 1019
275 Ga0495619_0003016 3300053085 Bacteria 10935
276 Ga0495619_0036592 3300053085 Bacteria 3197
277 Ga0500556_0000536 3300053104 Bacteria 25885
278 Ga0500595_000232 3300053119 Bacteria 37646
279 Ga0500595_046575 3300053119 Bacteria 1363
280 Ga0500603_062588 3300053150 Bacteria 1044
281 Ga0500638_085431 3300053162 Bacteria 1493
282 Ga0500637_0002843 3300053178 Bacteria 7798
283 Ga0500661_000141 3300055283 Bacteria 12137
284 2513715320 2513237104 Bacteria 10034502
285 2745079191 2744054633 Bacteria 8678936
286 2805917774 2802429603 Bacteria 8777136
287 2824668088 2824661429 Bacteria 9877870
288 2824734418 2824732956 Bacteria 7810675
289 2879105613 2879099564 Bacteria 10442239
290 2904667851 2904666416 Bacteria 8226587
291 2929620400 2929615660 Bacteria 9193770
292 2929626293 2929624759 Bacteria 9339455
293 2932784827 2932784394 Bacteria 9704911
294 2932796525 2932794094 Bacteria 7915132
295 2932803479 2932801729 Bacteria 7987968
296 2932809860 2932809354 Bacteria 9135765
297 2932828663 2932828146 Bacteria 9745859
298 2933582318 2933577622 Bacteria 9116884
299 2935619915 2935616580 Bacteria 9032984
300 2935638898 2935638405 Bacteria 10015038
301 2935676703 2935675223 Bacteria 9928132
302 2935685092 2935684952 Bacteria 9590419
303 2935694781 2935694250 Bacteria 9291695
304 2935703903 2935703347 Bacteria 10242284
305 2935713645 2935713505 Bacteria 9608509
306 2935724265 2935722832 Bacteria 9608746
307 2935733377 2935732158 Bacteria 9706831
308 2935742756 2935741537 Bacteria 9707219
309 2935751057 2935750917 Bacteria 9590372
310 2935760420 2935760218 Bacteria 9817913
311 2935802040 2935801545 Bacteria 9301974
312 2935810809 2935810662 Bacteria 9401221
313 2935828392 2935827899 Bacteria 10038562
314 2935839807 2935837841 Bacteria 9454360
315 2935857770 2935855204 Bacteria 9035059
316 2935868889 2935864058 Bacteria 9784707
317 2935874304 2935873716 Bacteria 9632195
318 2935886548 2935883170 Bacteria 7964738
319 2935992770 2935992306 Bacteria 9802711
320 2936002684 2936002035 Bacteria 9362176
321 2936037771 2936037263 Bacteria 9446081
322 2940558140 2940556831 Bacteria 9590747
323 2941540852 2941538514 Bacteria 9402094
324 8016608834 8016603502 Bacteria 8731218
325 8016616064 8016613128 Bacteria 8794220
326 8016625153 8016622563 Bacteria 7999408
327 8017064768 8017057580 Bacteria 10023680
328 8019546491 8019538911 Bacteria 7872763
329 8019552198 8019547302 Bacteria 7996444
330 8019591898 8019586578 Bacteria 10212056
331 8019599385 8019597564 Bacteria 10041141
332 8019608972 8019608314 Bacteria 10042931
333 8055745262 8055742211 Bacteria 9226248
334 Ga0105247_10024684
335 MBSR1b_contig_13832682
336 JGI25159J45721_1005397
337 JGI25406J46586_10002346
338 rootH1_10177679
339 rootH2_10023937
340 rootL2_10131133
341 rootL2_10279397
342 rootH1_10165132
343 JGI25404J52841_10001144
344 Ga0065165_1001715
345 Ga0065715_10162513
346 Ga0070683_100036624
347 Ga0068869_100144934
348 Ga0068869_100148925
349 Ga0070680_100018489
350 Ga0070682_100123714
351 Ga0068868_100827422
352 Ga0070661_100034581
353 Ga0070671_100534440
354 Ga0070674_100481921
355 Ga0070673_100615080
356 Ga0070709_10027436
357 Ga0070709_10048604
358 Ga0070709_10420828
359 Ga0070714_100333445
360 Ga0070714_100596859
361 Ga0070713_100112864
362 Ga0070713_100244238
363 Ga0070711_100062037
364 Ga0070711_100198757
365 Ga0070663_100010626
366 Ga0070663_100023498
367 Ga0070663_100031886
368 Ga0070678_100031265
369 Ga0070678_100084903
370 Ga0070678_100104083
371 Ga0070681_10080726
372 Ga0070679_100009982
373 Ga0070684_100014029
374 Ga0068853_100125690
375 Ga0068853_100244710
376 Ga0068853_100554323
377 Ga0070672_100048151
378 Ga0070672_100298499
379 Ga0070686_100159581
380 Ga0070693_100029125
381 Ga0070693_100337715
382 Ga0070665_100026089
383 Ga0070665_100072292
384 Ga0070665_100118848
385 Ga0070665_100248844
386 Ga0068855_100422882
387 Ga0068855_100516800
388 Ga0068857_100017532
389 Ga0068857_100095335
390 Ga0068856_100086281
391 Ga0068852_100539998
392 Ga0068859_100030884
393 Ga0068861_100374109
394 Ga0068858_100199262
395 Ga0068862_100200851
396 Ga0081540_1000238
397 Ga0081540_1003398
398 Ga0081540_1003516
399 Ga0081540_1004375
400 Ga0081540_1006853
401 Ga0081539_10000629
402 Ga0081539_10002257
403 Ga0081539_10020905
404 Ga0070717_10200381
405 Ga0070712_100053734
406 Ga0075367_10115567
407 Ga0097621_100177923
408 Ga0097621_100211450
409 Ga0097621_100372960
410 Ga0075370_10225478
411 Ga0068865_100099973
412 Ga0097620_100030884
413 Ga0099795_10020865
414 Ga0105240_10096858
415 Ga0105247_10630083
416 Ga0105243_10020601
417 Ga0105242_10127292
418 Ga0105248_10107784
419 Ga0105237_10159564
420 Ga0105238_10028960
421 Ga0105238_10057303
422 Ga0105238_10140090
423 Ga0105238_10178336
424 Ga0099796_10011609
425 Ga0105239_10047415
426 Ga0105239_10059485
427 Ga0105239_10100380
428 Ga0105239_10357594
429 Ga0105239_10363176
430 Ga0105246_10001029
431 Ga0157369_10089762
432 Ga0157374_10007293
433 Ga0157374_10007914
434 Ga0157378_10011018
435 Ga0157378_10125878
436 Ga0163162_10014003
437 Ga0163162_10131732
438 Ga0163162_10191255
439 Ga0163162_10214549
440 Ga0163162_10629819
441 Ga0157372_10209547
442 Ga0157375_10010267
443 Ga0157375_10389498
444 Ga0163163_10300364
445 Ga0157376_10030707
446 Ga0163161_10308124
447 Ga0213876_10165278
448 Ga0209130_1000343
449 Ga0207656_10247354
450 Ga0207710_10092842
451 Ga0207699_10044596
452 Ga0207707_10022239
453 Ga0207695_10276963
454 Ga0207671_10170909
455 Ga0207693_10071260
456 Ga0207693_10099780
457 Ga0207652_10246335
458 Ga0207694_10091861
459 Ga0207694_10637170
460 Ga0207687_10018571
461 Ga0207700_10112008
462 Ga0207644_10383722
463 Ga0207644_10444656
464 Ga0207686_10334356
465 Ga0207704_10642254
466 Ga0207691_10174764
467 Ga0207691_10211517
468 Ga0207689_10104716
469 Ga0207661_10002436
470 Ga0207668_10248356
471 Ga0207703_10104022
472 Ga0207639_10099184
473 Ga0207639_10906178
474 Ga0207678_10005498
475 Ga0207678_10008407
476 Ga0207678_10049563
477 Ga0207678_10074242
478 Ga0207676_10028563
479 Ga0207674_10037216
480 Ga0207683_10018682
481 Ga0207683_10323067
482 Ga0209179_1045566
483 Ga0268266_10097678
484 Ga0268266_10535970
485 Ga0268265_10210315
486 Ga0265318_10081067
487 Ga0265331_10130706
488 Ga0265316_10031974
489 Ga0307408_100615183
490 Ga0265314_10005031
491 Ga0307510_10081081
492 Ga0373932_0015751
493 Ga0373936_0019068
494 Ga0373945_0018314
495 Ga0373956_0208942
496 Ga0373957_0011365
497 Ga0373955_0010158
498 Ga0373955_0100149
499 Ga0373924_0003203
500 Ga0373935_0027763
501 Ga0373927_0069002
502 Ga0373933_0006680
503 Ga0373933_0096351
504 Ga0373947_0081968
505 Ga0373937_0010217
506 Ga0373937_0209574
507 Ga0373925_0020554
508 Ga0373925_0027532
509 Ga0436365_0952676
510 Ga0436361_0082378
511 Ga0451845_0400271
512 Ga0466965_0093501
513 Ga0466963_0038469
514 Ga0466967_0045894
515 Ga0495592_0093682
516 Ga0495592_0179552
517 Ga0495629_0173512
518 Ga0495638_0258744
519 Ga0495641_0090882
520 Ga0495580_0013227
521 Ga0495582_0018146
522 Ga0495662_0057828
523 Ga0495662_0120519
524 Ga0495664_0019627
525 Ga0495664_0124797
526 Ga0495618_0090757
527 Ga0495618_0185007
528 Ga0495628_0208399
529 Ga0495630_0187847
530 Ga0495666_0086037
531 Ga0495665_0029046
532 Ga0495640_0006608
533 Ga0495622_0006509
534 Ga0495667_0017616
535 Ga0495667_0035701
536 Ga0495668_0043362
537 Ga0495634_0020673
538 Ga0495635_0081970
539 Ga0495659_0082551
540 Ga0495661_0223726
541 Ga0495588_0005886
542 Ga0495657_0016257
543 Ga0495623_0100402
544 Ga0495646_0143506
545 Ga0495658_0091470
546 Ga0495669_0070914
547 Ga0495613_0434356
548 Ga0495600_0067583
549 Ga0495674_0045558
550 Ga0495674_0237932
551 Ga0495680_0039812
552 Ga0495673_0033131
553 Ga0495684_0015335
554 Ga0495684_0130174
555 Ga0495593_0022925
556 Ga0495602_0017200
557 Ga0496100_0239009
558 Ga0496101_0001703
559 Ga0496101_0068765
560 Ga0496102_0001416
561 Ga0496102_0012393
562 Ga0496102_0017273
563 Ga0496102_0437687
564 Ga0496103_0009799
565 Ga0496103_0032221
566 Ga0496104_0017356
567 Ga0496104_0057013
568 Ga0496104_0074842
569 Ga0496104_0127923
570 Ga0496105_0001406
571 Ga0496105_0014300
572 Ga0496106_0040698
573 Ga0496106_0050738
574 Ga0496106_0225378
575 Ga0496107_0000895
576 Ga0496107_0011274
577 Ga0496108_0003543
578 Ga0496108_0102763
579 Ga0496108_0313466
580 Ga0496109_0061456
581 Ga0496109_0071871
582 Ga0496109_0607329
583 Ga0496110_0144082
584 Ga0496110_0201287
585 Ga0496110_0678224
586 Ga0496111_0014030
587 Ga0496111_0025553
588 Ga0496111_0066229
589 Ga0496112_0086393
590 Ga0496112_0150799
591 Ga0496113_0261825
592 Ga0496114_0016446
593 Ga0496114_0042477
594 Ga0496115_0094088
595 Ga0496115_0185586
596 Ga0496115_0214279
597 Ga0496117_0033972
598 Ga0496118_0025778
599 Ga0496121_0207476
600 Ga0496126_0038653
601 nmdc:mga03n38_52086_c1
602 nmdc:mga0yw44_394535_c1
603 Ga0495601_0011641
604 Ga0495601_0076312
605 Ga0495601_0089655
606 Ga0495612_0057523
607 Ga0495612_0148588
608 Ga0495619_0003016
609 Ga0495619_0036592
610 Ga0500556_0000536
611 Ga0500595_000232
612 Ga0500595_046575
613 Ga0500603_062588
614 Ga0500638_085431
615 Ga0500637_0002843
616 Ga0500661_000141
617 2513715320
618 2745079191
619 2805917774
620 2824668088
621 2824734418
622 2879105613
623 2904667851
624 2929620400
625 2929626293
626 2932784827
627 2932796525
628 2932803479
629 2932809860
630 2932828663
631 2933582318
632 2935619915
633 2935638898
634 2935676703
635 2935685092
636 2935694781
637 2935703903
638 2935713645
639 2935724265
640 2935733377
641 2935742756
642 2935751057
643 2935760420
644 2935802040
645 2935810809
646 2935828392
647 2935839807
648 2935857770
649 2935868889
650 2935874304
651 2935886548
652 2935992770
653 2936002684
654 2936037771
655 2940558140
656 2941540852
657 8016608834
658 8016616064
659 8016625153
660 8017064768
661 8019546491
662 8019552198
663 8019591898
664 8019599385
665 8019608972
666 8055745262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

36

265

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5626 5 240
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5416 5 240
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.4881 5 240
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.4715 5 240
8t69-assembly1.cif.gz_A human vmat2 in complex with tetrabenazine 0.425 2 243
ID Description Score Start End Superfamily
af_Q54E82_206_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4462 41 248 1.20.1250.20
af_Q54NX1_470_662_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4315 4 240 1.20.1250.20
af_Q54E82_206_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4293 41 248 1.20.1250.20
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4194 46 234 1.20.1250.20
af_C6KSY4_77_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4162 4 238 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Y9UVD1-F1-model_v4 Probable membrane transporter protein 0.9869 1 248 GO:0005886
AF-A0A838LSX1-F1-model_v4 Probable membrane transporter protein 0.9818 1 241 GO:0005886
AF-A0A317FC94-F1-model_v4 Probable membrane transporter protein 0.9651 2 239 GO:0005886
AF-A0A1V3NRQ6-F1-model_v4 Probable membrane transporter protein 0.9632 2 239 GO:0005886
AF-A0A525I288-F1-model_v4 Probable membrane transporter protein 0.961 1 241 GO:0005886

Map