F411284

General Info

Members Datasets Scaffolds Average Seq Length
333 223 333 141

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100225354|Ga0070704_1002253542
Length 163
Sequence MRVVLATRAQPFINNAKEIIMPTRKADAVWNGNLKEGKGTVKLGSGAYNGQYSFSSRFENGTGTNPEELIAAAHAGCFSMALSAGLERGGHSPNSVQTEAKVHLSPKDGGGFRISRIDLVTTAEVPGIDDAAFQQVAQAAKEGCPVSQALSAVEITLDATLAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
198 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 2.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 1.2
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2239653 2162886007 Bacteria 1984
2 CNBas_1001522 3300000531 Bacteria 1227
3 Ga0065704_10002671 3300005289 Bacteria 4859
4 Ga0065704_10207142 3300005289 Bacteria 1122
5 Ga0065707_10087832 3300005295 Bacteria 4873
6 Ga0065707_10166685 3300005295 Bacteria 1517
7 Ga0065707_10373971 3300005295 Unclassified 873
8 Ga0070658_10036895 3300005327 Bacteria 3939
9 Ga0070683_100084910 3300005329 Bacteria 2967
10 Ga0070683_100203598 3300005329 Bacteria 1880
11 Ga0070670_100652556 3300005331 Bacteria 944
12 Ga0070670_101264869 3300005331 Bacteria 675
13 Ga0068869_100014233 3300005334 Bacteria 5309
14 Ga0070666_10828741 3300005335 Bacteria 682
15 Ga0070680_100296071 3300005336 Bacteria 1372
16 Ga0070680_101067041 3300005336 Bacteria 698
17 Ga0070680_101153672 3300005336 Bacteria 670
18 Ga0070682_100104214 3300005337 Bacteria 1878
19 Ga0068868_102377474 3300005338 Bacteria 506
20 Ga0070689_100124389 3300005340 Bacteria 2063
21 Ga0070689_100964850 3300005340 Bacteria 757
22 Ga0070692_10065237 3300005345 Bacteria 1927
23 Ga0070675_100687385 3300005354 Bacteria 931
24 Ga0070673_100367468 3300005364 Bacteria 1280
25 Ga0070659_101701919 3300005366 Bacteria 564
26 Ga0070714_100327949 3300005435 Bacteria 1433
27 Ga0070714_100448537 3300005435 Bacteria 1225
28 Ga0070713_100042336 3300005436 Bacteria 3717
29 Ga0070713_100538368 3300005436 Bacteria 1105
30 Ga0070710_10862369 3300005437 Bacteria 651
31 Ga0070701_10321905 3300005438 Bacteria 957
32 Ga0070711_100627107 3300005439 Unclassified 899
33 Ga0070705_100094369 3300005440 Unclassified 1873
34 Ga0070705_100384238 3300005440 Bacteria 1034
35 Ga0070708_100010451 3300005445 Bacteria 7524
36 Ga0070708_100089969 3300005445 Unclassified 2793
37 Ga0070663_100809526 3300005455 Bacteria 804
38 Ga0070662_100079934 3300005457 Bacteria 2433
39 Ga0070681_10001268 3300005458 Bacteria 22023
40 Ga0070681_10020671 3300005458 Bacteria 6594
41 Ga0070681_10029766 3300005458 Bacteria 5482
42 Ga0070681_10397571 3300005458 Unclassified 1289
43 Ga0070685_11062182 3300005466 Bacteria 610
44 Ga0070698_100202269 3300005471 Bacteria 1921
45 Ga0070698_100345141 3300005471 Bacteria 1420
46 Ga0070699_101575015 3300005518 Bacteria 602
47 Ga0070679_100015780 3300005530 Bacteria 7268
48 Ga0070679_100040290 3300005530 Bacteria 4648
49 Ga0070679_100062533 3300005530 Bacteria 3712
50 Ga0070679_100307328 3300005530 Bacteria 1536
51 Ga0070679_100928048 3300005530 Bacteria 814
52 Ga0070679_101441574 3300005530 Bacteria 635
53 Ga0070697_100522351 3300005536 Bacteria 1039
54 Ga0070697_101728062 3300005536 Unclassified 560
55 Ga0068853_100629308 3300005539 Bacteria 1020
56 Ga0070686_100313575 3300005544 Bacteria 1167
57 Ga0070686_100338770 3300005544 Bacteria 1126
58 Ga0070696_100624416 3300005546 Unclassified 871
59 Ga0070696_100872450 3300005546 Bacteria 745
60 Ga0070704_100225354 3300005549 Bacteria 1526
61 Ga0068855_100125144 3300005563 Bacteria 2940
62 Ga0068855_100219708 3300005563 Bacteria 2131
63 Ga0070664_100298963 3300005564 Bacteria 1454
64 Ga0068857_100129532 3300005577 Bacteria 2275
65 Ga0068857_100683590 3300005577 Unclassified 974
66 Ga0068857_101001830 3300005577 Bacteria 804
67 Ga0068856_100014825 3300005614 Bacteria 7523
68 Ga0070702_100077332 3300005615 Unclassified 1983
69 Ga0068852_100026380 3300005616 Bacteria 4722
70 Ga0068859_100252435 3300005617 Unclassified 1854
71 Ga0068859_100686818 3300005617 Bacteria 1115
72 Ga0068859_100952386 3300005617 Bacteria 942
73 Ga0068870_10006408 3300005840 Bacteria 5186
74 Ga0068863_100060840 3300005841 Bacteria 3571
75 Ga0068862_100038306 3300005844 Bacteria 4066
76 Ga0081540_1100343 3300005983 Bacteria 1248
77 Ga0070717_10641217 3300006028 Bacteria 964
78 Ga0075365_10035515 3300006038 Bacteria 3225
79 Ga0075365_10160292 3300006038 Bacteria 1567
80 Ga0075365_10455587 3300006038 Bacteria 903
81 Ga0075365_10679708 3300006038 Bacteria 727
82 Ga0075363_100044227 3300006048 Bacteria 2358
83 Ga0075363_100352768 3300006048 Bacteria 859
84 Ga0075364_10136655 3300006051 Bacteria 1647
85 Ga0075364_10138583 3300006051 Unclassified 1635
86 Ga0075364_10241317 3300006051 Bacteria 1227
87 Ga0075364_10450338 3300006051 Bacteria 879
88 Ga0070716_100029801 3300006173 Bacteria 2954
89 Ga0070712_100270818 3300006175 Bacteria 1364
90 Ga0075367_10063764 3300006178 Bacteria 2203
91 Ga0075430_100001087 3300006846 Bacteria 21577
92 Ga0075431_100268183 3300006847 Bacteria 1731
93 Ga0075433_10473900 3300006852 Bacteria 1103
94 Ga0075434_100411235 3300006871 Bacteria 1374
95 Ga0075434_100625073 3300006871 Unclassified 1096
96 Ga0068865_100145986 3300006881 Bacteria 1789
97 Ga0068865_100989601 3300006881 Bacteria 736
98 Ga0097620_100252438 3300006931 Unclassified 1854
99 Ga0097620_100686836 3300006931 Bacteria 1115
100 Ga0097620_100952468 3300006931 Bacteria 942
101 Ga0111539_10138076 3300009094 Unclassified 2855
102 Ga0111539_10602217 3300009094 Bacteria 1280
103 Ga0105245_10110221 3300009098 Bacteria 2559
104 Ga0114129_10001794 3300009147 Bacteria 29250
105 Ga0105243_11123936 3300009148 Bacteria 795
106 Ga0105241_10040674 3300009174 Bacteria 3510
107 Ga0105241_10093614 3300009174 Bacteria 2375
108 Ga0105241_10106130 3300009174 Unclassified 2241
109 Ga0105241_10974499 3300009174 Bacteria 792
110 Ga0105242_10169529 3300009176 Unclassified 1917
111 Ga0105242_10691040 3300009176 Bacteria 997
112 Ga0105248_10206721 3300009177 Bacteria 2212
113 Ga0105248_10541205 3300009177 Bacteria 1314
114 Ga0105248_10595803 3300009177 Bacteria 1247
115 Ga0105237_10118497 3300009545 Bacteria 2641
116 Ga0105238_10008990 3300009551 Bacteria 9996
117 Ga0105238_10052056 3300009551 Bacteria 4116
118 Ga0105238_10469352 3300009551 Bacteria 1257
119 Ga0105238_11292095 3300009551 Bacteria 755
120 Ga0105249_10109274 3300009553 Bacteria 2612
121 Ga0105249_11531314 3300009553 Bacteria 739
122 Ga0105239_10000544 3300010375 Bacteria 54307
123 Ga0105239_10053917 3300010375 Bacteria 4409
124 Ga0105239_10349809 3300010375 Bacteria 1668
125 Ga0105239_11369377 3300010375 Bacteria 817
126 Ga0105246_10022281 3300011119 Bacteria 4085
127 Ga0105246_10150007 3300011119 Bacteria 1764
128 Ga0157326_1000134 3300012513 Bacteria 8012
129 Ga0157373_10001972 3300013100 Bacteria 15557
130 Ga0157373_10462939 3300013100 Bacteria 913
131 Ga0157371_10251270 3300013102 Bacteria 1273
132 Ga0157370_10090198 3300013104 Bacteria 2878
133 Ga0157370_10837738 3300013104 Bacteria 836
134 Ga0157369_10062422 3300013105 Bacteria 4015
135 Ga0157374_10001117 3300013296 Bacteria 23066
136 Ga0157378_10584464 3300013297 Bacteria 1126
137 Ga0163162_10100233 3300013306 Bacteria 2988
138 Ga0163162_10678184 3300013306 Bacteria 1153
139 Ga0157372_10011289 3300013307 Bacteria 9503
140 Ga0157372_10107492 3300013307 Bacteria 3192
141 Ga0157372_11325646 3300013307 Bacteria 830
142 Ga0157372_12280632 3300013307 Bacteria 622
143 Ga0157375_10000435 3300013308 Bacteria 37740
144 Ga0157375_10084038 3300013308 Bacteria 3230
145 Ga0157375_10196184 3300013308 Bacteria 2174
146 Ga0157377_10416346 3300014745 Bacteria 919
147 Ga0157377_10788867 3300014745 Bacteria 699
148 Ga0157379_10363326 3300014968 Bacteria 1327
149 Ga0157376_10104206 3300014969 Bacteria 2485
150 Ga0157376_10257935 3300014969 Bacteria 1632
151 Ga0163161_10161539 3300017792 Bacteria 1708
152 Ga0197907_11512378 3300020069 Bacteria 540
153 Ga0206356_11591872 3300020070 Bacteria 952
154 Ga0206354_11344211 3300020081 Bacteria 679
155 Ga0207643_10003648 3300025908 Bacteria 8295
156 Ga0207705_10032372 3300025909 Bacteria 3736
157 Ga0207707_10003882 3300025912 Bacteria 13255
158 Ga0207707_10019693 3300025912 Bacteria 5891
159 Ga0207707_10038722 3300025912 Bacteria 4167
160 Ga0207707_10610067 3300025912 Unclassified 923
161 Ga0207671_10216159 3300025914 Bacteria 1500
162 Ga0207660_10498629 3300025917 Bacteria 988
163 Ga0207660_10753065 3300025917 Bacteria 795
164 Ga0207652_10068386 3300025921 Bacteria 3082
165 Ga0207652_10082205 3300025921 Bacteria 2818
166 Ga0207652_10085032 3300025921 Bacteria 2772
167 Ga0207652_10195325 3300025921 Bacteria 1820
168 Ga0207694_10108002 3300025924 Bacteria 2211
169 Ga0207694_10849068 3300025924 Bacteria 772
170 Ga0207650_10254793 3300025925 Bacteria 1422
171 Ga0207650_11182616 3300025925 Unclassified 651
172 Ga0207659_10474078 3300025926 Bacteria 1057
173 Ga0207687_10422307 3300025927 Unclassified 1100
174 Ga0207664_10443462 3300025929 Bacteria 1158
175 Ga0207644_10407933 3300025931 Bacteria 1112
176 Ga0207690_10642852 3300025932 Bacteria 869
177 Ga0207706_10055368 3300025933 Bacteria 3498
178 Ga0207704_10024702 3300025938 Bacteria 3265
179 Ga0207704_11450732 3300025938 Bacteria 588
180 Ga0207661_10099033 3300025944 Bacteria 2444
181 Ga0207661_11074804 3300025944 Bacteria 741
182 Ga0207661_12106490 3300025944 Unclassified 510
183 Ga0207679_10232020 3300025945 Bacteria 1559
184 Ga0207667_10135376 3300025949 Bacteria 2537
185 Ga0207667_11800291 3300025949 Bacteria 576
186 Ga0207651_10465200 3300025960 Bacteria 1087
187 Ga0207712_11606843 3300025961 Bacteria 583
188 Ga0207640_10230269 3300025981 Bacteria 1425
189 Ga0207703_11797403 3300026035 Bacteria 589
190 Ga0207639_10361488 3300026041 Bacteria 1299
191 Ga0207678_10364726 3300026067 Bacteria 1247
192 Ga0207702_10043664 3300026078 Bacteria 3765
193 Ga0207676_10000011 3300026095 Bacteria 382648
194 Ga0207674_10287490 3300026116 Bacteria 1593
195 Ga0207674_10380984 3300026116 Bacteria 1364
196 Ga0207674_11548104 3300026116 Bacteria 632
197 Ga0207675_100011316 3300026118 Bacteria 8350
198 Ga0207698_10034298 3300026142 Bacteria 3697
199 Ga0207698_11208366 3300026142 Bacteria 770
200 Ga0207428_10006714 3300027907 Bacteria 10565
201 Ga0268265_10058787 3300028380 Bacteria 2938
202 Ga0265334_10012289 3300028573 Bacteria 3599
203 Ga0265318_10000001 3300028577 Bacteria 500711
204 Ga0265330_10000023 3300031235 Bacteria 150143
205 Ga0265332_10000122 3300031238 Bacteria 65400
206 Ga0265328_10050147 3300031239 Bacteria 1532
207 Ga0265320_10000007 3300031240 Bacteria 331219
208 Ga0265339_10063971 3300031249 Bacteria 1974
209 Ga0265331_10000001 3300031250 Bacteria 798836
210 Ga0265316_10048788 3300031344 Bacteria 3339
211 Ga0307408_100071219 3300031548 Bacteria 2570
212 Ga0307408_100280346 3300031548 Unclassified 1388
213 Ga0307408_101138998 3300031548 Bacteria 725
214 Ga0265313_10000018 3300031595 Bacteria 151941
215 Ga0316575_10259657 3300031665 Bacteria 730
216 Ga0265314_10000006 3300031711 Bacteria 540431
217 Ga0265342_10091921 3300031712 Bacteria 1738
218 Ga0307405_10073997 3300031731 Unclassified 2201
219 Ga0307405_11854544 3300031731 Bacteria 537
220 Ga0307410_10015479 3300031852 Bacteria 4525
221 Ga0307407_10010962 3300031903 Bacteria 4295
222 Ga0307412_10081762 3300031911 Bacteria 2235
223 Ga0307416_100335983 3300032002 Bacteria 1521
224 Ga0307416_100340922 3300032002 Bacteria 1511
225 Ga0307415_100235501 3300032126 Unclassified 1477
226 Ga0373961_0192474 3300035241 Unclassified 716
227 Ga0373931_0741748 3300035691 Bacteria 651
228 Ga0373947_0264521 3300035725 Bacteria 1140
229 Ga0373937_1061196 3300036401 Bacteria 759
230 Ga0395900_0088592 3300037418 Bacteria 3182
231 Ga0395905_0544194 3300037471 Bacteria 1062
232 Ga0395901_1520276 3300038443 Bacteria 625
233 Ga0436365_0071400 3300039437 Bacteria 1735
234 Ga0436362_0879597 3300039453 Bacteria 4762
235 Ga0439438_088038 3300041405 Bacteria 758
236 Ga0439439_0099579 3300041406 Bacteria 799
237 Ga0439466_0201680 3300041411 Bacteria 605
238 Ga0439432_161617 3300042006 Bacteria 655
239 Ga0439452_036632 3300042010 Bacteria 1174
240 Ga0451577_0153140 3300042876 Bacteria 2075
241 Ga0451577_0162697 3300042876 Bacteria 2010
242 Ga0451577_0352817 3300042876 Bacteria 1334
243 Ga0453684_0001997 3300044712 Bacteria 52233
244 Ga0453684_0008388 3300044712 Bacteria 18543
245 Ga0453684_0121395 3300044712 Bacteria 3154
246 Ga0453684_0377698 3300044712 Bacteria 1592
247 Ga0466957_0482078 3300044842 Bacteria 858
248 Ga0451576_0759184 3300045051 Unclassified 1019
249 Ga0451576_1203506 3300045051 Bacteria 791
250 Ga0466967_0157864 3300045976 Bacteria 2127
251 Ga0466967_1438684 3300045976 Bacteria 687
252 Ga0495582_0182421 3300046473 Bacteria 1196
253 Ga0495639_0055456 3300046475 Bacteria 1808
254 Ga0495662_0052306 3300046476 Bacteria 1972
255 Ga0495584_0142542 3300046491 Bacteria 1217
256 Ga0495594_0339828 3300046499 Bacteria 855
257 Ga0495586_0010991 3300046535 Bacteria 4810
258 Ga0495587_0232368 3300046536 Bacteria 1039
259 Ga0495645_0180386 3300046543 Bacteria 1447
260 Ga0495634_0070356 3300046642 Bacteria 2307
261 Ga0495634_0076555 3300046642 Bacteria 2196
262 Ga0495635_0220374 3300046663 Bacteria 1283
263 Ga0495659_0079371 3300046664 Bacteria 1243
264 Ga0495657_0162564 3300046675 Bacteria 1381
265 Ga0495623_0123652 3300046679 Bacteria 1555
266 Ga0495647_0162875 3300046681 Bacteria 962
267 Ga0495647_0458234 3300046681 Bacteria 591
268 Ga0495669_0039204 3300046684 Unclassified 2097
269 Ga0495669_0266861 3300046684 Bacteria 823
270 Ga0495669_0287078 3300046684 Bacteria 792
271 Ga0495600_0585034 3300046809 Bacteria 679
272 Ga0495604_0350835 3300047317 Bacteria 980
273 Ga0495675_0017593 3300047444 Bacteria 4531
274 Ga0495675_0080216 3300047444 Bacteria 2055
275 Ga0495686_0125033 3300047472 Bacteria 1530
276 Ga0496101_0589102 3300048904 Bacteria 879
277 Ga0496109_0680134 3300048912 Bacteria 966
278 Ga0496110_1016288 3300048913 Unclassified 737
279 Ga0496112_1047296 3300048915 Unclassified 735
280 Ga0501305_104606 3300049161 Unclassified 530
281 Ga0501336_025361 3300049552 Unclassified 560
282 Ga0501033_0463845 3300049570 Bacteria 879
283 Ga0501034_0058696 3300049571 Bacteria 3866
284 Ga0501041_0494047 3300049577 Bacteria 778
285 Ga0501043_0004219 3300049579 Bacteria 11725
286 Ga0501046_0012870 3300049580 Bacteria 7114
287 Ga0501047_0004320 3300049581 Bacteria 13373
288 Ga0501068_0380158 3300049584 Bacteria 909
289 Ga0501070_0002183 3300049586 Bacteria 17214
290 Ga0501070_0065946 3300049586 Bacteria 2998
291 Ga0501071_0831393 3300049587 Bacteria 712
292 Ga0501075_0436790 3300049591 Bacteria 998
293 Ga0501076_1183797 3300049592 Bacteria 629
294 Ga0501076_1445005 3300049592 Bacteria 565
295 Ga0501217_028095 3300049661 Bacteria 1369
296 Ga0501228_021344 3300049666 Bacteria 735
297 Ga0501253_110961 3300049683 Bacteria 654
298 Ga0501079_0215221 3300049741 Bacteria 1501
299 Ga0501080_0241974 3300049742 Bacteria 1647
300 Ga0501273_006027 3300049770 Unclassified 1390
301 Ga0501273_047719 3300049770 Bacteria 648
302 Ga0501044_0397589 3300049823 Bacteria 1291
303 Ga0501045_0148932 3300049824 Bacteria 1741
304 Ga0501212_035813 3300049851 Bacteria 811
305 nmdc:mga03n38_365582_c1 3300050490 Bacteria 788
306 nmdc:mga03n38_77451_c1 3300050490 Bacteria 1554
307 nmdc:mga00v17_407388_c1 3300050491 Bacteria 884
308 nmdc:mga00v17_55705_c1 3300050491 Bacteria 2415
309 nmdc:mga00v17_79854_c1 3300050491 Bacteria 2041
310 nmdc:mga0yw44_468331_c1 3300050492 Bacteria 854
311 nmdc:mga0yw44_614946_c1 3300050492 Bacteria 738
312 nmdc:mga0yw44_751864_c1 3300050492 Bacteria 662
313 nmdc:mga06z11_183749_c1 3300050494 Bacteria 1207
314 nmdc:mga06z11_228238_c1 3300050494 Bacteria 1090
315 nmdc:mga05p37_23681_c1 3300050507 Bacteria 7454
316 nmdc:mga05p37_6779_c1 3300050507 Bacteria 13501
317 nmdc:mga0qj67_2387_c1 3300050509 Bacteria 13380
318 nmdc:mga06r32_33942_c1 3300050510 Bacteria 4809
319 nmdc:mga06r32_803101_c1 3300050510 Bacteria 901
320 nmdc:mga08y16_3367_c1 3300050511 Bacteria 16571
321 nmdc:mga0n895_403134_c1 3300050512 Bacteria 1383
322 nmdc:mga0n895_870800_c1 3300050512 Bacteria 887
323 nmdc:mga08x19_243966_c1 3300050514 Bacteria 1239
324 nmdc:mga0a205_514158_c1 3300050515 Bacteria 1054
325 nmdc:mga0a205_698275_c1 3300050515 Bacteria 864
326 Ga0495601_0772825 3300053077 Bacteria 610
327 Ga0495619_0363914 3300053085 Bacteria 1000
328 Ga0500608_006651 3300053122 Bacteria 4727
329 Ga0500616_0024062 3300053153 Bacteria 3389
330 Ga0501084_0345447 3300054114 Bacteria 1257
331 Ga0587073_0219997 3300059492 Unclassified 580
332 Ga0587069_076806 3300059642 Unclassified 645
333 Ga0530510_0419458 3300061734 Bacteria 1010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10106130 Ga0105241_101061303 110
2 3300046499 Ga0495594_0339828 Ga0495594_0339828_12_356 113
3 3300028573 Ga0265334_10012289 Ga0265334_100122895 124
4 3300028577 Ga0265318_10000001 Ga0265318_10000001380 124
5 3300031235 Ga0265330_10000023 Ga0265330_100000239 124
6 3300031238 Ga0265332_10000122 Ga0265332_100001222 124
7 3300031239 Ga0265328_10050147 Ga0265328_100501471 124
8 3300031240 Ga0265320_10000007 Ga0265320_1000000776 124
9 3300031249 Ga0265339_10063971 Ga0265339_100639712 124
10 3300031250 Ga0265331_10000001 Ga0265331_10000001462 124
11 3300031344 Ga0265316_10048788 Ga0265316_100487882 124
12 3300031595 Ga0265313_10000018 Ga0265313_100000186 124
13 3300031711 Ga0265314_10000006 Ga0265314_10000006182 124
14 3300031712 Ga0265342_10091921 Ga0265342_100919213 124
15 3300049661 Ga0501217_028095 Ga0501217_028095_549_950 124
16 3300005327 Ga0070658_10036895 Ga0070658_100368952 126
17 3300005331 Ga0070670_101264869 Ga0070670_1012648691 126
18 3300005334 Ga0068869_100014233 Ga0068869_1000142339 126
19 3300005336 Ga0070680_100296071 Ga0070680_1002960713 126
20 3300005435 Ga0070714_100327949 Ga0070714_1003279492 126
21 3300005440 Ga0070705_100094369 Ga0070705_1000943692 126
22 3300005539 Ga0068853_100629308 Ga0068853_1006293083 126
23 3300005544 Ga0070686_100338770 Ga0070686_1003387702 126
24 3300005616 Ga0068852_100026380 Ga0068852_1000263802 126
25 3300006028 Ga0070717_10641217 Ga0070717_106412172 126
26 3300006173 Ga0070716_100029801 Ga0070716_1000298013 126
27 3300006847 Ga0075431_100268183 Ga0075431_1002681831 126
28 3300009177 Ga0105248_10541205 Ga0105248_105412052 126
29 3300013308 Ga0157375_10000435 Ga0157375_1000043521 126
30 3300025909 Ga0207705_10032372 Ga0207705_100323722 126
31 3300025917 Ga0207660_10753065 Ga0207660_107530651 126
32 3300026041 Ga0207639_10361488 Ga0207639_103614883 126
33 3300026142 Ga0207698_10034298 Ga0207698_100342982 126
34 3300042876 Ga0451577_0162697 Ga0451577_0162697_1144_1569 126
35 3300044712 Ga0453684_0377698 Ga0453684_0377698_537_962 126
36 3300046476 Ga0495662_0052306 Ga0495662_0052306_1343_1765 126
37 3300046536 Ga0495587_0232368 Ga0495587_0232368_148_570 126
38 3300046543 Ga0495645_0180386 Ga0495645_0180386_380_802 126
39 3300046663 Ga0495635_0220374 Ga0495635_0220374_148_570 126
40 3300046664 Ga0495659_0079371 Ga0495659_0079371_738_1160 126
41 3300046675 Ga0495657_0162564 Ga0495657_0162564_331_753 126
42 3300046679 Ga0495623_0123652 Ga0495623_0123652_144_566 126
43 3300046809 Ga0495600_0585034 Ga0495600_0585034_207_629 126
44 3300047317 Ga0495604_0350835 Ga0495604_0350835_487_909 126
45 3300047444 Ga0495675_0017593 Ga0495675_0017593_2020_2442 126
46 3300047444 Ga0495675_0080216 Ga0495675_0080216_831_1253 126
47 3300049592 Ga0501076_1445005 Ga0501076_1445005_44_469 126
48 3300050514 nmdc:mga08x19_243966_c1 nmdc:mga08x19_243966_c1_16_441 126
49 3300005336 Ga0070680_101153672 Ga0070680_1011536721 127
50 3300005337 Ga0070682_100104214 Ga0070682_1001042144 127
51 3300005439 Ga0070711_100627107 Ga0070711_1006271072 127
52 3300005445 Ga0070708_100010451 Ga0070708_1000104514 127
53 3300005518 Ga0070699_101575015 Ga0070699_1015750151 127
54 3300010375 Ga0105239_10000544 Ga0105239_1000054445 127
55 3300011119 Ga0105246_10150007 Ga0105246_101500072 127
56 3300013308 Ga0157375_10084038 Ga0157375_100840385 127
57 3300014969 Ga0157376_10257935 Ga0157376_102579352 127
58 3300031548 Ga0307408_100280346 Ga0307408_1002803463 127
59 3300036401 Ga0373937_1061196 Ga0373937_1061196_266_697 127
60 3300039437 Ga0436365_0071400 Ga0436365_0071400_771_1289 127
61 3300046684 Ga0495669_0266861 Ga0495669_0266861_44_472 127
62 3300049570 Ga0501033_0463845 Ga0501033_0463845_28_456 127
63 3300049577 Ga0501041_0494047 Ga0501041_0494047_172_597 127
64 3300049587 Ga0501071_0831393 Ga0501071_0831393_104_544 127
65 3300049741 Ga0501079_0215221 Ga0501079_0215221_328_753 127
66 3300049742 Ga0501080_0241974 Ga0501080_0241974_31_456 127
67 3300049824 Ga0501045_0148932 Ga0501045_0148932_513_941 127
68 3300053077 Ga0495601_0772825 Ga0495601_0772825_148_579 127
69 3300053085 Ga0495619_0363914 Ga0495619_0363914_263_694 127
70 3300053122 Ga0500608_006651 Ga0500608_006651_257_691 127
71 3300053153 Ga0500616_0024062 Ga0500616_0024062_948_1409 127
72 3300054114 Ga0501084_0345447 Ga0501084_0345447_104_532 127
73 3300005289 Ga0065704_10207142 Ga0065704_102071421 128
74 3300005295 Ga0065707_10373971 Ga0065707_103739711 128
75 3300005329 Ga0070683_100084910 Ga0070683_1000849101 128
76 3300005329 Ga0070683_100203598 Ga0070683_1002035982 128
77 3300005331 Ga0070670_100652556 Ga0070670_1006525561 128
78 3300005335 Ga0070666_10828741 Ga0070666_108287411 128
79 3300005338 Ga0068868_102377474 Ga0068868_1023774741 128
80 3300005340 Ga0070689_100124389 Ga0070689_1001243894 128
81 3300005340 Ga0070689_100964850 Ga0070689_1009648501 128
82 3300005364 Ga0070673_100367468 Ga0070673_1003674681 128
83 3300005366 Ga0070659_101701919 Ga0070659_1017019191 128
84 3300005435 Ga0070714_100448537 Ga0070714_1004485372 128
85 3300005436 Ga0070713_100042336 Ga0070713_1000423362 128
86 3300005436 Ga0070713_100538368 Ga0070713_1005383681 128
87 3300005437 Ga0070710_10862369 Ga0070710_108623691 128
88 3300005438 Ga0070701_10321905 Ga0070701_103219052 128
89 3300005455 Ga0070663_100809526 Ga0070663_1008095262 128
90 3300005457 Ga0070662_100079934 Ga0070662_1000799343 128
91 3300005458 Ga0070681_10001268 Ga0070681_100012685 128
92 3300005458 Ga0070681_10020671 Ga0070681_100206713 128
93 3300005458 Ga0070681_10029766 Ga0070681_100297663 128
94 3300005466 Ga0070685_11062182 Ga0070685_110621821 128
95 3300005471 Ga0070698_100202269 Ga0070698_1002022692 128
96 3300005471 Ga0070698_100345141 Ga0070698_1003451413 128
97 3300005530 Ga0070679_100015780 Ga0070679_1000157803 128
98 3300005530 Ga0070679_100040290 Ga0070679_1000402902 128
99 3300005530 Ga0070679_100062533 Ga0070679_1000625332 128
100 3300005530 Ga0070679_100307328 Ga0070679_1003073282 128
101 3300005530 Ga0070679_100928048 Ga0070679_1009280481 128
102 3300005530 Ga0070679_101441574 Ga0070679_1014415741 128
103 3300005536 Ga0070697_100522351 Ga0070697_1005223512 128
104 3300005544 Ga0070686_100313575 Ga0070686_1003135752 128
105 3300005546 Ga0070696_100872450 Ga0070696_1008724501 128
106 3300005549 Ga0070704_100225354 Ga0070704_1002253542 128
107 3300005563 Ga0068855_100125144 Ga0068855_1001251442 128
108 3300005563 Ga0068855_100219708 Ga0068855_1002197082 128
109 3300005564 Ga0070664_100298963 Ga0070664_1002989632 128
110 3300005577 Ga0068857_100129532 Ga0068857_1001295324 128
111 3300005577 Ga0068857_101001830 Ga0068857_1010018302 128
112 3300005614 Ga0068856_100014825 Ga0068856_1000148253 128
113 3300005615 Ga0070702_100077332 Ga0070702_1000773322 128
114 3300005617 Ga0068859_100952386 Ga0068859_1009523862 128
115 3300005841 Ga0068863_100060840 Ga0068863_1000608403 128
116 3300005983 Ga0081540_1100343 Ga0081540_11003431 128
117 3300006038 Ga0075365_10035515 Ga0075365_100355152 128
118 3300006038 Ga0075365_10160292 Ga0075365_101602921 128
119 3300006038 Ga0075365_10455587 Ga0075365_104555871 128
120 3300006038 Ga0075365_10679708 Ga0075365_106797081 128
121 3300006048 Ga0075363_100044227 Ga0075363_1000442272 128
122 3300006048 Ga0075363_100352768 Ga0075363_1003527682 128
123 3300006051 Ga0075364_10136655 Ga0075364_101366552 128
124 3300006051 Ga0075364_10138583 Ga0075364_101385832 128
125 3300006051 Ga0075364_10241317 Ga0075364_102413172 128
126 3300006051 Ga0075364_10450338 Ga0075364_104503382 128
127 3300006175 Ga0070712_100270818 Ga0070712_1002708182 128
128 3300006178 Ga0075367_10063764 Ga0075367_100637643 128
129 3300006846 Ga0075430_100001087 Ga0075430_1000010874 128
130 3300006871 Ga0075434_100411235 Ga0075434_1004112352 128
131 3300006871 Ga0075434_100625073 Ga0075434_1006250731 128
132 3300006881 Ga0068865_100145986 Ga0068865_1001459862 128
133 3300006881 Ga0068865_100989601 Ga0068865_1009896012 128
134 3300006931 Ga0097620_100952468 Ga0097620_1009524682 128
135 3300009094 Ga0111539_10602217 Ga0111539_106022171 128
136 3300009098 Ga0105245_10110221 Ga0105245_101102213 128
137 3300009147 Ga0114129_10001794 Ga0114129_100017949 128
138 3300009148 Ga0105243_11123936 Ga0105243_111239361 128
139 3300009174 Ga0105241_10093614 Ga0105241_100936142 128
140 3300009174 Ga0105241_10974499 Ga0105241_109744992 128
141 3300009176 Ga0105242_10691040 Ga0105242_106910402 128
142 3300009177 Ga0105248_10206721 Ga0105248_102067212 128
143 3300009545 Ga0105237_10118497 Ga0105237_101184972 128
144 3300009551 Ga0105238_10008990 Ga0105238_100089905 128
145 3300009551 Ga0105238_10052056 Ga0105238_100520562 128
146 3300009551 Ga0105238_10469352 Ga0105238_104693522 128
147 3300009551 Ga0105238_11292095 Ga0105238_112920951 128
148 3300009553 Ga0105249_11531314 Ga0105249_115313141 128
149 3300010375 Ga0105239_10053917 Ga0105239_100539176 128
150 3300010375 Ga0105239_10349809 Ga0105239_103498092 128
151 3300010375 Ga0105239_11369377 Ga0105239_113693772 128
152 3300012513 Ga0157326_1000134 Ga0157326_10001347 128
153 3300013100 Ga0157373_10462939 Ga0157373_104629392 128
154 3300013104 Ga0157370_10090198 Ga0157370_100901982 128
155 3300013104 Ga0157370_10837738 Ga0157370_108377382 128
156 3300013105 Ga0157369_10062422 Ga0157369_100624222 128
157 3300013296 Ga0157374_10001117 Ga0157374_1000111714 128
158 3300013297 Ga0157378_10584464 Ga0157378_105844642 128
159 3300013307 Ga0157372_10011289 Ga0157372_1001128913 128
160 3300013307 Ga0157372_10107492 Ga0157372_101074923 128
161 3300013307 Ga0157372_11325646 Ga0157372_113256461 128
162 3300013307 Ga0157372_12280632 Ga0157372_122806322 128
163 3300013308 Ga0157375_10196184 Ga0157375_101961842 128
164 3300014745 Ga0157377_10416346 Ga0157377_104163462 128
165 3300014745 Ga0157377_10788867 Ga0157377_107888671 128
166 3300014968 Ga0157379_10363326 Ga0157379_103633261 128
167 3300014969 Ga0157376_10104206 Ga0157376_101042063 128
168 3300017792 Ga0163161_10161539 Ga0163161_101615392 128
169 3300020069 Ga0197907_11512378 Ga0197907_115123782 128
170 3300020070 Ga0206356_11591872 Ga0206356_115918721 128
171 3300020081 Ga0206354_11344211 Ga0206354_113442112 128
172 3300025912 Ga0207707_10003882 Ga0207707_100038829 128
173 3300025912 Ga0207707_10019693 Ga0207707_100196933 128
174 3300025912 Ga0207707_10038722 Ga0207707_100387223 128
175 3300025914 Ga0207671_10216159 Ga0207671_102161592 128
176 3300025917 Ga0207660_10498629 Ga0207660_104986292 128
177 3300025921 Ga0207652_10068386 Ga0207652_100683863 128
178 3300025921 Ga0207652_10082205 Ga0207652_100822052 128
179 3300025921 Ga0207652_10085032 Ga0207652_100850322 128
180 3300025921 Ga0207652_10195325 Ga0207652_101953253 128
181 3300025924 Ga0207694_10108002 Ga0207694_101080023 128
182 3300025924 Ga0207694_10849068 Ga0207694_108490681 128
183 3300025925 Ga0207650_11182616 Ga0207650_111826161 128
184 3300025927 Ga0207687_10422307 Ga0207687_104223071 128
185 3300025929 Ga0207664_10443462 Ga0207664_104434622 128
186 3300025931 Ga0207644_10407933 Ga0207644_104079332 128
187 3300025933 Ga0207706_10055368 Ga0207706_100553684 128
188 3300025938 Ga0207704_10024702 Ga0207704_100247024 128
189 3300025938 Ga0207704_11450732 Ga0207704_114507321 128
190 3300025944 Ga0207661_10099033 Ga0207661_100990332 128
191 3300025944 Ga0207661_11074804 Ga0207661_110748041 128
192 3300025944 Ga0207661_12106490 Ga0207661_121064901 128
193 3300025945 Ga0207679_10232020 Ga0207679_102320202 128
194 3300025949 Ga0207667_10135376 Ga0207667_101353763 128
195 3300025949 Ga0207667_11800291 Ga0207667_118002911 128
196 3300025960 Ga0207651_10465200 Ga0207651_104652002 128
197 3300025961 Ga0207712_11606843 Ga0207712_116068432 128
198 3300025981 Ga0207640_10230269 Ga0207640_102302692 128
199 3300026035 Ga0207703_11797403 Ga0207703_117974031 128
200 3300026067 Ga0207678_10364726 Ga0207678_103647263 128
201 3300026078 Ga0207702_10043664 Ga0207702_100436647 128
202 3300026095 Ga0207676_10000011 Ga0207676_10000011113 128
203 3300026116 Ga0207674_10380984 Ga0207674_103809842 128
204 3300026116 Ga0207674_11548104 Ga0207674_115481042 128
205 3300026118 Ga0207675_100011316 Ga0207675_1000113167 128
206 3300026142 Ga0207698_11208366 Ga0207698_112083661 128
207 3300031548 Ga0307408_101138998 Ga0307408_1011389982 128
208 3300031665 Ga0316575_10259657 Ga0316575_102596571 128
209 3300031731 Ga0307405_10073997 Ga0307405_100739974 128
210 3300031852 Ga0307410_10015479 Ga0307410_100154796 128
211 3300031903 Ga0307407_10010962 Ga0307407_100109622 128
212 3300032002 Ga0307416_100335983 Ga0307416_1003359833 128
213 3300032002 Ga0307416_100340922 Ga0307416_1003409222 128
214 3300032126 Ga0307415_100235501 Ga0307415_1002355012 128
215 3300035241 Ga0373961_0192474 Ga0373961_0192474_116_544 128
216 3300035691 Ga0373931_0741748 Ga0373931_0741748_76_564 128
217 3300035725 Ga0373947_0264521 Ga0373947_0264521_79_507 128
218 3300037418 Ga0395900_0088592 Ga0395900_0088592_1129_1566 128
219 3300037471 Ga0395905_0544194 Ga0395905_0544194_166_603 128
220 3300038443 Ga0395901_1520276 Ga0395901_1520276_17_448 128
221 3300039453 Ga0436362_0879597 Ga0436362_0879597_2044_2472 128
222 3300041405 Ga0439438_088038 Ga0439438_088038_84_512 128
223 3300041406 Ga0439439_0099579 Ga0439439_0099579_99_530 128
224 3300041411 Ga0439466_0201680 Ga0439466_0201680_140_571 128
225 3300042006 Ga0439432_161617 Ga0439432_161617_170_601 128
226 3300042010 Ga0439452_036632 Ga0439452_036632_190_621 128
227 3300042876 Ga0451577_0153140 Ga0451577_0153140_874_1302 128
228 3300042876 Ga0451577_0352817 Ga0451577_0352817_736_1164 128
229 3300044712 Ga0453684_0001997 Ga0453684_0001997_35079_35507 128
230 3300044712 Ga0453684_0008388 Ga0453684_0008388_15842_16270 128
231 3300044712 Ga0453684_0121395 Ga0453684_0121395_2426_2854 128
232 3300044842 Ga0466957_0482078 Ga0466957_0482078_256_693 128
233 3300045051 Ga0451576_0759184 Ga0451576_0759184_130_570 128
234 3300045051 Ga0451576_1203506 Ga0451576_1203506_160_588 128
235 3300045976 Ga0466967_0157864 Ga0466967_0157864_69_500 128
236 3300045976 Ga0466967_1438684 Ga0466967_1438684_207_635 128
237 3300046473 Ga0495582_0182421 Ga0495582_0182421_79_510 128
238 3300046475 Ga0495639_0055456 Ga0495639_0055456_835_1266 128
239 3300046491 Ga0495584_0142542 Ga0495584_0142542_367_795 128
240 3300046535 Ga0495586_0010991 Ga0495586_0010991_2733_3164 128
241 3300046642 Ga0495634_0070356 Ga0495634_0070356_164_595 128
242 3300046642 Ga0495634_0076555 Ga0495634_0076555_1091_1516 128
243 3300046681 Ga0495647_0162875 Ga0495647_0162875_254_685 128
244 3300046681 Ga0495647_0458234 Ga0495647_0458234_35_463 128
245 3300046684 Ga0495669_0039204 Ga0495669_0039204_136_564 128
246 3300046684 Ga0495669_0287078 Ga0495669_0287078_315_740 128
247 3300047472 Ga0495686_0125033 Ga0495686_0125033_967_1464 128
248 3300048904 Ga0496101_0589102 Ga0496101_0589102_304_744 128
249 3300048912 Ga0496109_0680134 Ga0496109_0680134_243_668 128
250 3300049161 Ga0501305_104606 Ga0501305_104606_51_479 128
251 3300049552 Ga0501336_025361 Ga0501336_025361_27_455 128
252 3300049571 Ga0501034_0058696 Ga0501034_0058696_1682_2110 128
253 3300049579 Ga0501043_0004219 Ga0501043_0004219_8296_8724 128
254 3300049580 Ga0501046_0012870 Ga0501046_0012870_4644_5072 128
255 3300049581 Ga0501047_0004320 Ga0501047_0004320_4896_5324 128
256 3300049584 Ga0501068_0380158 Ga0501068_0380158_57_482 128
257 3300049586 Ga0501070_0002183 Ga0501070_0002183_4044_4472 128
258 3300049586 Ga0501070_0065946 Ga0501070_0065946_2269_2694 128
259 3300049591 Ga0501075_0436790 Ga0501075_0436790_341_769 128
260 3300049592 Ga0501076_1183797 Ga0501076_1183797_46_474 128
261 3300049770 Ga0501273_006027 Ga0501273_006027_892_1320 128
262 3300049823 Ga0501044_0397589 Ga0501044_0397589_181_609 128
263 3300050490 nmdc:mga03n38_365582_c1 nmdc:mga03n38_365582_c1_113_541 128
264 3300050490 nmdc:mga03n38_77451_c1 nmdc:mga03n38_77451_c1_997_1425 128
265 3300050491 nmdc:mga00v17_407388_c1 nmdc:mga00v17_407388_c1_267_695 128
266 3300050491 nmdc:mga00v17_55705_c1 nmdc:mga00v17_55705_c1_223_651 128
267 3300050491 nmdc:mga00v17_79854_c1 nmdc:mga00v17_79854_c1_987_1415 128
268 3300050492 nmdc:mga0yw44_468331_c1 nmdc:mga0yw44_468331_c1_125_553 128
269 3300050492 nmdc:mga0yw44_614946_c1 nmdc:mga0yw44_614946_c1_269_697 128
270 3300050492 nmdc:mga0yw44_751864_c1 nmdc:mga0yw44_751864_c1_167_595 128
271 3300050494 nmdc:mga06z11_183749_c1 nmdc:mga06z11_183749_c1_142_570 128
272 3300050494 nmdc:mga06z11_228238_c1 nmdc:mga06z11_228238_c1_580_1008 128
273 3300050507 nmdc:mga05p37_23681_c1 nmdc:mga05p37_23681_c1_5885_6316 128
274 3300050507 nmdc:mga05p37_6779_c1 nmdc:mga05p37_6779_c1_2011_2436 128
275 3300050509 nmdc:mga0qj67_2387_c1 nmdc:mga0qj67_2387_c1_9273_9704 128
276 3300050510 nmdc:mga06r32_33942_c1 nmdc:mga06r32_33942_c1_2994_3425 128
277 3300050510 nmdc:mga06r32_803101_c1 nmdc:mga06r32_803101_c1_126_554 128
278 3300050512 nmdc:mga0n895_403134_c1 nmdc:mga0n895_403134_c1_373_804 128
279 3300050515 nmdc:mga0a205_698275_c1 nmdc:mga0a205_698275_c1_184_609 128
280 3300061734 Ga0530510_0419458 Ga0530510_0419458_121_549 128
281 2162886007 SwRhRL2b_contig_2239653 SwRhRL2b_0185.00001530 129
282 3300000531 CNBas_1001522 CNBas_10015223 129
283 3300005289 Ga0065704_10002671 Ga0065704_100026712 129
284 3300005295 Ga0065707_10087832 Ga0065707_100878323 129
285 3300005295 Ga0065707_10166685 Ga0065707_101666851 129
286 3300005336 Ga0070680_101067041 Ga0070680_1010670411 129
287 3300005345 Ga0070692_10065237 Ga0070692_100652373 129
288 3300005354 Ga0070675_100687385 Ga0070675_1006873852 129
289 3300005440 Ga0070705_100384238 Ga0070705_1003842381 129
290 3300005445 Ga0070708_100089969 Ga0070708_1000899692 129
291 3300005458 Ga0070681_10397571 Ga0070681_103975712 129
292 3300005536 Ga0070697_101728062 Ga0070697_1017280621 129
293 3300005546 Ga0070696_100624416 Ga0070696_1006244162 129
294 3300005577 Ga0068857_100683590 Ga0068857_1006835902 129
295 3300005617 Ga0068859_100252435 Ga0068859_1002524352 129
296 3300005617 Ga0068859_100686818 Ga0068859_1006868181 129
297 3300005840 Ga0068870_10006408 Ga0068870_100064083 129
298 3300005844 Ga0068862_100038306 Ga0068862_1000383062 129
299 3300006852 Ga0075433_10473900 Ga0075433_104739002 129
300 3300006931 Ga0097620_100252438 Ga0097620_1002524382 129
301 3300006931 Ga0097620_100686836 Ga0097620_1006868361 129
302 3300009094 Ga0111539_10138076 Ga0111539_101380762 129
303 3300009174 Ga0105241_10040674 Ga0105241_100406744 129
304 3300009176 Ga0105242_10169529 Ga0105242_101695293 129
305 3300009177 Ga0105248_10595803 Ga0105248_105958032 129
306 3300009553 Ga0105249_10109274 Ga0105249_101092743 129
307 3300011119 Ga0105246_10022281 Ga0105246_100222814 129
308 3300013100 Ga0157373_10001972 Ga0157373_1000197212 129
309 3300013102 Ga0157371_10251270 Ga0157371_102512702 129
310 3300013306 Ga0163162_10100233 Ga0163162_101002333 129
311 3300013306 Ga0163162_10678184 Ga0163162_106781842 129
312 3300025908 Ga0207643_10003648 Ga0207643_100036486 129
313 3300025912 Ga0207707_10610067 Ga0207707_106100672 129
314 3300025925 Ga0207650_10254793 Ga0207650_102547931 129
315 3300025926 Ga0207659_10474078 Ga0207659_104740782 129
316 3300025932 Ga0207690_10642852 Ga0207690_106428522 129
317 3300026116 Ga0207674_10287490 Ga0207674_102874902 129
318 3300027907 Ga0207428_10006714 Ga0207428_100067145 129
319 3300028380 Ga0268265_10058787 Ga0268265_100587873 129
320 3300031548 Ga0307408_100071219 Ga0307408_1000712194 129
321 3300031731 Ga0307405_11854544 Ga0307405_118545441 129
322 3300031911 Ga0307412_10081762 Ga0307412_100817622 129
323 3300048913 Ga0496110_1016288 Ga0496110_1016288_263_700 129
324 3300048915 Ga0496112_1047296 Ga0496112_1047296_245_682 129
325 3300049666 Ga0501228_021344 Ga0501228_021344_118_546 129
326 3300049683 Ga0501253_110961 Ga0501253_110961_76_504 129
327 3300049770 Ga0501273_047719 Ga0501273_047719_168_596 129
328 3300049851 Ga0501212_035813 Ga0501212_035813_111_539 129
329 3300050511 nmdc:mga08y16_3367_c1 nmdc:mga08y16_3367_c1_15192_15620 129
330 3300050512 nmdc:mga0n895_870800_c1 nmdc:mga0n895_870800_c1_164_601 129
331 3300050515 nmdc:mga0a205_514158_c1 nmdc:mga0a205_514158_c1_546_974 129
332 3300059492 Ga0587073_0219997 Ga0587073_0219997_97_564 129
333 3300059642 Ga0587069_076806 Ga0587069_076806_23_490 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

59

158

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.9273 19 129
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9016 19 129
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.8993 19 129
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8989 19 129
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.8916 34 127
ID Description Score Start End Superfamily
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.954 26 129 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9333 24 128 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9003 19 129 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9002 33 129 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8905 33 129 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9981 34 129 GO:0004601
GO:0006979
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9878 34 129 GO:0004601
GO:0006979
AF-A0A7V9TFE3-F1-model_v4 OsmC family peroxiredoxin 0.9844 34 129 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9823 31 129 GO:0004601
GO:0006979
AF-A0A2V6D478-F1-model_v4 Peroxiredoxin 0.9819 63 129

Feature Viewer

pLDDT pTM Quality
88.84 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map