F411052

General Info

Members Datasets Scaffolds Average Seq Length
332 120 664 108

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1834687|Ga0466967_1834687_59_415
Length 118
Sequence VAAVSADEAGMSEFAGTLRERIVIEQPISVRNEMGLQEPGWEEVCRCLASVTLDSVGAESEGQALSAMPRFRVTIRWREGIALDQRVTWNGRKLIVRQLLDDPRAKDRIAMRCEEVRA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1834687 3300045976 Bacteria 603
2 JGI24737J22298_10057249 3300001990 Viruses 1177
3 JGI24738J21930_10072189 3300002075 Viruses 716
4 JGI25406J46586_10111884 3300003203 Bacteria 808
5 Ga0065715_10228824 3300005293 Bacteria 1242
6 Ga0070658_10002136 3300005327 Bacteria 16589
7 Ga0070658_10015078 3300005327 Bacteria 6186
8 Ga0070658_10035318 3300005327 Bacteria 4026
9 Ga0070658_10117391 3300005327 Viruses 2209
10 Ga0070658_10317731 3300005327 Bacteria 1330
11 Ga0070658_10454724 3300005327 Bacteria 1103
12 Ga0070658_10467748 3300005327 Viruses 1087
13 Ga0070658_10472585 3300005327 Bacteria 1081
14 Ga0070676_10504663 3300005328 Viruses 859
15 Ga0070676_10629739 3300005328 Bacteria 776
16 Ga0070683_100000827 3300005329 Bacteria 22909
17 Ga0070683_100012971 3300005329 Bacteria 7254
18 Ga0070683_100217993 3300005329 Bacteria 1813
19 Ga0070683_101538825 3300005329 Viruses 639
20 Ga0070670_101833564 3300005331 Viruses 558
21 Ga0068869_100042644 3300005334 Bacteria 3254
22 Ga0070666_10188677 3300005335 Bacteria 1448
23 Ga0070666_10442128 3300005335 Bacteria 938
24 Ga0070680_100000190 3300005336 Bacteria 39640
25 Ga0070682_100530323 3300005337 Viruses 918
26 Ga0070682_100812766 3300005337 Viruses 760
27 Ga0070660_100000012 3300005339 Bacteria 123961
28 Ga0070660_100133655 3300005339 Bacteria 1987
29 Ga0070660_100133737 3300005339 Bacteria 1986
30 Ga0070660_100162618 3300005339 Bacteria 1799
31 Ga0070660_100172449 3300005339 Viruses 1747
32 Ga0070660_100372207 3300005339 Bacteria 1179
33 Ga0070661_100002395 3300005344 Bacteria 12857
34 Ga0070661_100017889 3300005344 Bacteria 5033
35 Ga0070661_100124386 3300005344 Bacteria 1934
36 Ga0070661_100182657 3300005344 Bacteria 1596
37 Ga0070661_100650013 3300005344 Viruses 856
38 Ga0070692_11072031 3300005345 Viruses 567
39 Ga0070668_100013070 3300005347 Bacteria 6185
40 Ga0070671_100100152 3300005355 Bacteria 2431
41 Ga0070659_100001385 3300005366 Bacteria 17481
42 Ga0070659_100010954 3300005366 Bacteria 6694
43 Ga0070659_100024427 3300005366 Bacteria 4633
44 Ga0070667_100229135 3300005367 Viruses 1656
45 Ga0070667_100436536 3300005367 Bacteria 1195
46 Ga0070667_100993780 3300005367 Bacteria 783
47 Ga0070667_101156619 3300005367 Viruses 724
48 Ga0070714_100162430 3300005435 Bacteria 2022
49 Ga0070663_100333760 3300005455 Viruses 1223
50 Ga0070663_101494986 3300005455 Bacteria 600
51 Ga0070662_100001593 3300005457 Bacteria 14026
52 Ga0070662_100137735 3300005457 Bacteria 1889
53 Ga0070662_100386810 3300005457 Bacteria 1152
54 Ga0070679_100178993 3300005530 Bacteria 2093
55 Ga0070679_100267071 3300005530 Bacteria 1666
56 Ga0070679_100395804 3300005530 Bacteria 1328
57 Ga0070679_100938252 3300005530 Bacteria 809
58 Ga0070684_100098534 3300005535 Bacteria 2608
59 Ga0070684_100375495 3300005535 Viruses 1309
60 Ga0070684_100402418 3300005535 Viruses 1262
61 Ga0068853_100134289 3300005539 Bacteria 2217
62 Ga0068853_100338547 3300005539 Bacteria 1397
63 Ga0068853_100722124 3300005539 Viruses 951
64 Ga0068853_100802732 3300005539 Bacteria 901
65 Ga0068853_101620391 3300005539 Viruses 627
66 Ga0068853_102320734 3300005539 Viruses 520
67 Ga0070686_101276532 3300005544 Viruses 612
68 Ga0070665_100305923 3300005548 Bacteria 1593
69 Ga0068855_100185919 3300005563 Bacteria 2347
70 Ga0068855_100279126 3300005563 Bacteria 1856
71 Ga0068855_100315973 3300005563 Viruses 1727
72 Ga0068855_100424836 3300005563 Viruses 1453
73 Ga0070664_100008417 3300005564 Bacteria 8341
74 Ga0070664_100076135 3300005564 Bacteria 2882
75 Ga0070664_100242939 3300005564 Bacteria 1617
76 Ga0070664_100550989 3300005564 Bacteria 1066
77 Ga0070664_101924421 3300005564 Bacteria 561
78 Ga0068857_100074611 3300005577 Viruses 3023
79 Ga0068857_100146885 3300005577 Bacteria 2134
80 Ga0068857_100782892 3300005577 Bacteria 910
81 Ga0068857_100840411 3300005577 Viruses 878
82 Ga0068857_101154353 3300005577 Viruses 749
83 Ga0068854_100163818 3300005578 Bacteria 1724
84 Ga0068854_100239606 3300005578 Viruses 1444
85 Ga0068854_100336210 3300005578 Bacteria 1232
86 Ga0068854_101350842 3300005578 Bacteria 643
87 Ga0068854_101478477 3300005578 Viruses 616
88 Ga0068856_100008883 3300005614 Bacteria 9777
89 Ga0068856_100963960 3300005614 Viruses 871
90 Ga0068856_101373323 3300005614 Bacteria 721
91 Ga0068852_100040248 3300005616 Bacteria 3942
92 Ga0068852_100095160 3300005616 Bacteria 2674
93 Ga0068852_100347037 3300005616 Bacteria 1448
94 Ga0068852_100781687 3300005616 Bacteria 968
95 Ga0068852_100841324 3300005616 Viruses 933
96 Ga0068852_101031904 3300005616 Viruses 841
97 Ga0068852_101680847 3300005616 Bacteria 657
98 Ga0068859_100015139 3300005617 Bacteria 7742
99 Ga0068859_102070830 3300005617 Viruses 628
100 Ga0068866_10366115 3300005718 Bacteria 920
101 Ga0068863_100100052 3300005841 Bacteria 2755
102 Ga0068858_100012736 3300005842 Bacteria 7925
103 Ga0068858_100789211 3300005842 Viruses 926
104 Ga0068862_100290008 3300005844 Bacteria 1502
105 Ga0081539_10129122 3300005985 Bacteria 1244
106 Ga0075433_10016556 3300006852 Bacteria 6082
107 Ga0075434_102005202 3300006871 Viruses 584
108 Ga0097620_100015137 3300006931 Bacteria 7742
109 Ga0097620_102069899 3300006931 Viruses 628
110 Ga0105240_11523092 3300009093 Bacteria 701
111 Ga0105240_11985547 3300009093 Bacteria 605
112 Ga0105248_10000238 3300009177 Bacteria 63658
113 Ga0105237_11354581 3300009545 Unclassified 718
114 Ga0105249_10413845 3300009553 Bacteria 1381
115 Ga0105246_10877436 3300011119 Viruses 803
116 Ga0157373_10401712 3300013100 Bacteria 982
117 Ga0157373_10843263 3300013100 Viruses 678
118 Ga0157371_10005247 3300013102 Bacteria 11002
119 Ga0157371_10112327 3300013102 Bacteria 1934
120 Ga0157371_10453960 3300013102 Bacteria 942
121 Ga0157371_10741494 3300013102 Bacteria 737
122 Ga0157371_11132845 3300013102 Viruses 601
123 Ga0157371_11425579 3300013102 Viruses 538
124 Ga0157370_10141248 3300013104 Bacteria 2244
125 Ga0157370_10282229 3300013104 Viruses 1534
126 Ga0157370_10948363 3300013104 Bacteria 780
127 Ga0157369_10003598 3300013105 Bacteria 18411
128 Ga0157369_10006542 3300013105 Bacteria 13485
129 Ga0157369_10106596 3300013105 Bacteria 2982
130 Ga0157369_10244741 3300013105 Bacteria 1872
131 Ga0157369_10476125 3300013105 Bacteria 1292
132 Ga0157369_10624789 3300013105 Bacteria 1111
133 Ga0157369_10689571 3300013105 Bacteria 1052
134 Ga0157369_12192164 3300013105 Viruses 560
135 Ga0157374_11898663 3300013296 Viruses 621
136 Ga0157372_13098396 3300013307 Viruses 531
137 Ga0157375_10267098 3300013308 Bacteria 1873
138 Ga0163163_10071339 3300014325 Bacteria 3461
139 Ga0157379_10225384 3300014968 Bacteria 1699
140 Ga0207680_10093751 3300025903 Bacteria 1916
141 Ga0207647_10179537 3300025904 Viruses 1230
142 Ga0207645_10446680 3300025907 Bacteria 872
143 Ga0207645_10685725 3300025907 Viruses 696
144 Ga0207705_10002883 3300025909 Bacteria 13161
145 Ga0207705_10007403 3300025909 Bacteria 8075
146 Ga0207705_10181807 3300025909 Viruses 1587
147 Ga0207705_10213066 3300025909 Bacteria 1465
148 Ga0207705_10285331 3300025909 Viruses 1264
149 Ga0207705_10735289 3300025909 Viruses 767
150 Ga0207707_10812268 3300025912 Bacteria 778
151 Ga0207660_10002027 3300025917 Bacteria 13479
152 Ga0207657_10000038 3300025919 Bacteria 123940
153 Ga0207657_10009215 3300025919 Bacteria 9949
154 Ga0207657_10090070 3300025919 Viruses 2561
155 Ga0207657_10138285 3300025919 Viruses 1992
156 Ga0207657_10142082 3300025919 Bacteria 1961
157 Ga0207657_10282620 3300025919 Bacteria 1317
158 Ga0207657_10687184 3300025919 Bacteria 795
159 Ga0207657_10858081 3300025919 Viruses 700
160 Ga0207649_10019459 3300025920 Archaea 3880
161 Ga0207649_10075314 3300025920 Viruses 2168
162 Ga0207649_10162280 3300025920 Viruses 1549
163 Ga0207649_10820452 3300025920 Viruses 727
164 Ga0207649_11116063 3300025920 Viruses 622
165 Ga0207652_10244489 3300025921 Bacteria 1618
166 Ga0207652_10855503 3300025921 Bacteria 805
167 Ga0207652_11898681 3300025921 Viruses 501
168 Ga0207650_10426678 3300025925 Viruses 1101
169 Ga0207644_10148753 3300025931 Bacteria 1811
170 Ga0207690_10000237 3300025932 Bacteria 40107
171 Ga0207690_10597603 3300025932 Viruses 900
172 Ga0207690_11035609 3300025932 Bacteria 683
173 Ga0207690_11130517 3300025932 Bacteria 653
174 Ga0207690_11619916 3300025932 Viruses 541
175 Ga0207706_10000211 3300025933 Bacteria 63984
176 Ga0207706_10022935 3300025933 Bacteria 5604
177 Ga0207706_10163415 3300025933 Bacteria 1957
178 Ga0207691_10707947 3300025940 Bacteria 849
179 Ga0207711_10037634 3300025941 Bacteria 4111
180 Ga0207689_10057199 3300025942 Bacteria 3208
181 Ga0207661_10012008 3300025944 Bacteria 6293
182 Ga0207661_10230711 3300025944 Viruses 1639
183 Ga0207661_11333144 3300025944 Viruses 659
184 Ga0207661_11496769 3300025944 Bacteria 619
185 Ga0207679_10035456 3300025945 Bacteria 3530
186 Ga0207679_10106668 3300025945 Bacteria 2203
187 Ga0207679_10520732 3300025945 Bacteria 1063
188 Ga0207667_10227942 3300025949 Bacteria 1908
189 Ga0207667_10361650 3300025949 Bacteria 1480
190 Ga0207667_10471787 3300025949 Bacteria 1274
191 Ga0207667_10939116 3300025949 Viruses 855
192 Ga0207640_10143045 3300025981 Bacteria 1746
193 Ga0207640_10289695 3300025981 Bacteria 1290
194 Ga0207640_10437565 3300025981 Bacteria 1074
195 Ga0207658_10222937 3300025986 Viruses 1587
196 Ga0207703_10006071 3300026035 Bacteria 9661
197 Ga0207703_10725694 3300026035 Viruses 946
198 Ga0207639_10095258 3300026041 Bacteria 2392
199 Ga0207639_10203116 3300026041 Bacteria 1701
200 Ga0207639_10791138 3300026041 Viruses 883
201 Ga0207678_10006278 3300026067 Bacteria 10556
202 Ga0207702_10001427 3300026078 Bacteria 23821
203 Ga0207641_10031841 3300026088 Bacteria 4376
204 Ga0207674_10225507 3300026116 Bacteria 1822
205 Ga0207674_10332855 3300026116 Bacteria 1468
206 Ga0207698_10315595 3300026142 Bacteria 1462
207 Ga0207698_10636066 3300026142 Viruses 1055
208 Ga0207698_11370172 3300026142 Viruses 722
209 Ga0207698_11474003 3300026142 Bacteria 696
210 Ga0268265_10011669 3300028380 Bacteria 5942
211 Ga0307408_100001579 3300031548 Bacteria 16814
212 Ga0307408_100409099 3300031548 Viruses 1167
213 Ga0307405_10000840 3300031731 Bacteria 12095
214 Ga0307413_10002154 3300031824 Bacteria 7911
215 Ga0307413_10227608 3300031824 Bacteria 1367
216 Ga0307410_10000320 3300031852 Bacteria 18645
217 Ga0307410_10366503 3300031852 Bacteria 1155
218 Ga0307406_10001145 3300031901 Bacteria 14817
219 Ga0307407_10000701 3300031903 Bacteria 10890
220 Ga0307407_11498246 3300031903 Viruses 533
221 Ga0307412_10002837 3300031911 Bacteria 9608
222 Ga0307412_10116871 3300031911 Bacteria 1914
223 Ga0307409_100024024 3300031995 Bacteria 4240
224 Ga0307416_100000488 3300032002 Bacteria 20200
225 Ga0307416_100001975 3300032002 Bacteria 11499
226 Ga0307416_100191911 3300032002 Viruses 1928
227 Ga0307416_103758007 3300032002 Viruses 508
228 Ga0307414_10002972 3300032004 Bacteria 8971
229 Ga0307411_10000370 3300032005 Bacteria 15258
230 Ga0307411_10264900 3300032005 Bacteria 1359
231 Ga0307411_11080775 3300032005 Bacteria 722
232 Ga0307415_100000453 3300032126 Bacteria 17622
233 Ga0307415_100016940 3300032126 Bacteria 4359
234 Ga0395899_0006573 3300037312 Bacteria 9010
235 Ga0395899_0008103 3300037312 Bacteria 8092
236 Ga0395899_0118494 3300037312 Viruses 1898
237 Ga0395899_0162783 3300037312 Viruses 1575
238 Ga0395899_0215946 3300037312 Viruses 1330
239 Ga0395899_0240741 3300037312 Viruses 1245
240 Ga0395899_0569588 3300037312 Unclassified 725
241 Ga0395899_0711139 3300037312 Bacteria 629
242 Ga0395900_0001087 3300037418 Bacteria 34570
243 Ga0395900_0094352 3300037418 Bacteria 3073
244 Ga0395900_0109018 3300037418 Bacteria 2844
245 Ga0395900_0169220 3300037418 Viruses 2225
246 Ga0395900_0292179 3300037418 Bacteria 1618
247 Ga0395900_0386539 3300037418 Viruses 1366
248 Ga0395900_0650719 3300037418 Bacteria 990
249 Ga0395900_0772188 3300037418 Bacteria 890
250 Ga0395900_0840234 3300037418 Bacteria 844
251 Ga0395900_1551664 3300037418 Viruses 574
252 Ga0395900_1797913 3300037418 Bacteria 523
253 Ga0395898_0013743 3300037466 Bacteria 8326
254 Ga0395898_0055698 3300037466 Bacteria 3857
255 Ga0395898_0195105 3300037466 Bacteria 1934
256 Ga0395898_0261608 3300037466 Bacteria 1650
257 Ga0395898_0389491 3300037466 Viruses 1329
258 Ga0395898_1274116 3300037466 Bacteria 665
259 Ga0395905_0007794 3300037471 Bacteria 10620
260 Ga0395905_0034030 3300037471 Bacteria 4785
261 Ga0395905_0056348 3300037471 Bacteria 3677
262 Ga0395905_0104704 3300037471 Bacteria 2656
263 Ga0395905_0192636 3300037471 Bacteria 1912
264 Ga0395905_0193981 3300037471 Bacteria 1904
265 Ga0395905_0385581 3300037471 Viruses 1295
266 Ga0395905_0394972 3300037471 Bacteria 1277
267 Ga0395905_0400115 3300037471 Bacteria 1268
268 Ga0395905_0559719 3300037471 Viruses 1045
269 Ga0395905_0781668 3300037471 Viruses 857
270 Ga0395905_1023572 3300037471 Viruses 729
271 Ga0395905_1321646 3300037471 Viruses 625
272 Ga0395901_0000140 3300038443 Bacteria 94487
273 Ga0395901_0006958 3300038443 Bacteria 11427
274 Ga0395901_0034799 3300038443 Bacteria 5203
275 Ga0395901_0068732 3300038443 Viruses 3690
276 Ga0395901_0101699 3300038443 Bacteria 3015
277 Ga0395901_0214522 3300038443 Bacteria 2013
278 Ga0395901_0221725 3300038443 Viruses 1976
279 Ga0395901_0224333 3300038443 Bacteria 1963
280 Ga0395901_0235768 3300038443 Bacteria 1909
281 Ga0395901_0350019 3300038443 Bacteria 1525
282 Ga0395901_0421690 3300038443 Bacteria 1368
283 Ga0395901_0524866 3300038443 Bacteria 1202
284 Ga0395901_0568104 3300038443 Bacteria 1147
285 Ga0395901_0669933 3300038443 Viruses 1038
286 Ga0395901_0889755 3300038443 Viruses 873
287 Ga0395901_0995608 3300038443 Bacteria 814
288 Ga0466965_0562214 3300044683 Bacteria 645
289 Ga0466966_0203560 3300044684 Bacteria 1197
290 Ga0466961_0034097 3300044693 Bacteria 3268
291 Ga0466961_0120444 3300044693 Bacteria 1648
292 Ga0466961_0903476 3300044693 Bacteria 526
293 Ga0466963_0016506 3300044694 Bacteria 4592
294 Ga0466963_0077110 3300044694 Bacteria 2251
295 Ga0466963_0138487 3300044694 Bacteria 1685
296 Ga0466963_0225722 3300044694 Bacteria 1312
297 Ga0466963_0429957 3300044694 Bacteria 931
298 Ga0466963_0531379 3300044694 Viruses 830
299 Ga0466963_0538419 3300044694 Bacteria 825
300 Ga0466963_0730178 3300044694 Bacteria 699
301 Ga0466963_1188171 3300044694 Bacteria 536
302 Ga0466971_0039474 3300044719 Viruses 2119
303 Ga0466970_0131142 3300044765 Viruses 1377
304 Ga0466957_0252770 3300044842 Bacteria 1172
305 Ga0466957_0539470 3300044842 Viruses 812
306 Ga0466959_0336949 3300045049 Viruses 1029
307 Ga0466959_0394939 3300045049 Viruses 940
308 Ga0466959_0797591 3300045049 Bacteria 631
309 Ga0466958_0022190 3300045836 Bacteria 3717
310 Ga0466958_0026458 3300045836 Bacteria 3429
311 Ga0466958_0691724 3300045836 Bacteria 664
312 Ga0466958_0817503 3300045836 Bacteria 608
313 Ga0466958_1025342 3300045836 Viruses 538
314 Ga0466967_0020644 3300045976 Bacteria 5330
315 Ga0466967_0038883 3300045976 Bacteria 4084
316 Ga0466967_0075476 3300045976 Viruses 3030
317 Ga0466967_0089171 3300045976 Bacteria 2800
318 Ga0466967_0093338 3300045976 Bacteria 2738
319 Ga0466967_0136728 3300045976 Bacteria 2279
320 Ga0466967_0224415 3300045976 Bacteria 1787
321 Ga0466967_0228601 3300045976 Bacteria 1770
322 Ga0466967_1234347 3300045976 Viruses 745
323 Ga0466967_2197236 3300045976 Bacteria 548
324 Ga0466967_2205304 3300045976 Viruses 547
325 Ga0495669_0043282 3300046684 Viruses 2004
326 Ga0495677_0179192 3300047445 Viruses 821
327 Ga0495685_082764 3300047447 Viruses 1068
328 Ga0496107_1083146 3300048910 Viruses 579
329 Ga0496114_0000092 3300048917 Bacteria 64974
330 Ga0501225_0281740 3300049705 Viruses 557
331 nmdc:mga0a205_25484_c1 3300050515 Bacteria 5635
332 Ga0466962_0178771 3300061719 Bacteria 1034
333 Ga0466967_1834687
334 JGI24737J22298_10057249
335 JGI24738J21930_10072189
336 JGI25406J46586_10111884
337 Ga0065715_10228824
338 Ga0070658_10002136
339 Ga0070658_10015078
340 Ga0070658_10035318
341 Ga0070658_10117391
342 Ga0070658_10317731
343 Ga0070658_10454724
344 Ga0070658_10467748
345 Ga0070658_10472585
346 Ga0070676_10504663
347 Ga0070676_10629739
348 Ga0070683_100000827
349 Ga0070683_100012971
350 Ga0070683_100217993
351 Ga0070683_101538825
352 Ga0070670_101833564
353 Ga0068869_100042644
354 Ga0070666_10188677
355 Ga0070666_10442128
356 Ga0070680_100000190
357 Ga0070682_100530323
358 Ga0070682_100812766
359 Ga0070660_100000012
360 Ga0070660_100133655
361 Ga0070660_100133737
362 Ga0070660_100162618
363 Ga0070660_100172449
364 Ga0070660_100372207
365 Ga0070661_100002395
366 Ga0070661_100017889
367 Ga0070661_100124386
368 Ga0070661_100182657
369 Ga0070661_100650013
370 Ga0070692_11072031
371 Ga0070668_100013070
372 Ga0070671_100100152
373 Ga0070659_100001385
374 Ga0070659_100010954
375 Ga0070659_100024427
376 Ga0070667_100229135
377 Ga0070667_100436536
378 Ga0070667_100993780
379 Ga0070667_101156619
380 Ga0070714_100162430
381 Ga0070663_100333760
382 Ga0070663_101494986
383 Ga0070662_100001593
384 Ga0070662_100137735
385 Ga0070662_100386810
386 Ga0070679_100178993
387 Ga0070679_100267071
388 Ga0070679_100395804
389 Ga0070679_100938252
390 Ga0070684_100098534
391 Ga0070684_100375495
392 Ga0070684_100402418
393 Ga0068853_100134289
394 Ga0068853_100338547
395 Ga0068853_100722124
396 Ga0068853_100802732
397 Ga0068853_101620391
398 Ga0068853_102320734
399 Ga0070686_101276532
400 Ga0070665_100305923
401 Ga0068855_100185919
402 Ga0068855_100279126
403 Ga0068855_100315973
404 Ga0068855_100424836
405 Ga0070664_100008417
406 Ga0070664_100076135
407 Ga0070664_100242939
408 Ga0070664_100550989
409 Ga0070664_101924421
410 Ga0068857_100074611
411 Ga0068857_100146885
412 Ga0068857_100782892
413 Ga0068857_100840411
414 Ga0068857_101154353
415 Ga0068854_100163818
416 Ga0068854_100239606
417 Ga0068854_100336210
418 Ga0068854_101350842
419 Ga0068854_101478477
420 Ga0068856_100008883
421 Ga0068856_100963960
422 Ga0068856_101373323
423 Ga0068852_100040248
424 Ga0068852_100095160
425 Ga0068852_100347037
426 Ga0068852_100781687
427 Ga0068852_100841324
428 Ga0068852_101031904
429 Ga0068852_101680847
430 Ga0068859_100015139
431 Ga0068859_102070830
432 Ga0068866_10366115
433 Ga0068863_100100052
434 Ga0068858_100012736
435 Ga0068858_100789211
436 Ga0068862_100290008
437 Ga0081539_10129122
438 Ga0075433_10016556
439 Ga0075434_102005202
440 Ga0097620_100015137
441 Ga0097620_102069899
442 Ga0105240_11523092
443 Ga0105240_11985547
444 Ga0105248_10000238
445 Ga0105237_11354581
446 Ga0105249_10413845
447 Ga0105246_10877436
448 Ga0157373_10401712
449 Ga0157373_10843263
450 Ga0157371_10005247
451 Ga0157371_10112327
452 Ga0157371_10453960
453 Ga0157371_10741494
454 Ga0157371_11132845
455 Ga0157371_11425579
456 Ga0157370_10141248
457 Ga0157370_10282229
458 Ga0157370_10948363
459 Ga0157369_10003598
460 Ga0157369_10006542
461 Ga0157369_10106596
462 Ga0157369_10244741
463 Ga0157369_10476125
464 Ga0157369_10624789
465 Ga0157369_10689571
466 Ga0157369_12192164
467 Ga0157374_11898663
468 Ga0157372_13098396
469 Ga0157375_10267098
470 Ga0163163_10071339
471 Ga0157379_10225384
472 Ga0207680_10093751
473 Ga0207647_10179537
474 Ga0207645_10446680
475 Ga0207645_10685725
476 Ga0207705_10002883
477 Ga0207705_10007403
478 Ga0207705_10181807
479 Ga0207705_10213066
480 Ga0207705_10285331
481 Ga0207705_10735289
482 Ga0207707_10812268
483 Ga0207660_10002027
484 Ga0207657_10000038
485 Ga0207657_10009215
486 Ga0207657_10090070
487 Ga0207657_10138285
488 Ga0207657_10142082
489 Ga0207657_10282620
490 Ga0207657_10687184
491 Ga0207657_10858081
492 Ga0207649_10019459
493 Ga0207649_10075314
494 Ga0207649_10162280
495 Ga0207649_10820452
496 Ga0207649_11116063
497 Ga0207652_10244489
498 Ga0207652_10855503
499 Ga0207652_11898681
500 Ga0207650_10426678
501 Ga0207644_10148753
502 Ga0207690_10000237
503 Ga0207690_10597603
504 Ga0207690_11035609
505 Ga0207690_11130517
506 Ga0207690_11619916
507 Ga0207706_10000211
508 Ga0207706_10022935
509 Ga0207706_10163415
510 Ga0207691_10707947
511 Ga0207711_10037634
512 Ga0207689_10057199
513 Ga0207661_10012008
514 Ga0207661_10230711
515 Ga0207661_11333144
516 Ga0207661_11496769
517 Ga0207679_10035456
518 Ga0207679_10106668
519 Ga0207679_10520732
520 Ga0207667_10227942
521 Ga0207667_10361650
522 Ga0207667_10471787
523 Ga0207667_10939116
524 Ga0207640_10143045
525 Ga0207640_10289695
526 Ga0207640_10437565
527 Ga0207658_10222937
528 Ga0207703_10006071
529 Ga0207703_10725694
530 Ga0207639_10095258
531 Ga0207639_10203116
532 Ga0207639_10791138
533 Ga0207678_10006278
534 Ga0207702_10001427
535 Ga0207641_10031841
536 Ga0207674_10225507
537 Ga0207674_10332855
538 Ga0207698_10315595
539 Ga0207698_10636066
540 Ga0207698_11370172
541 Ga0207698_11474003
542 Ga0268265_10011669
543 Ga0307408_100001579
544 Ga0307408_100409099
545 Ga0307405_10000840
546 Ga0307413_10002154
547 Ga0307413_10227608
548 Ga0307410_10000320
549 Ga0307410_10366503
550 Ga0307406_10001145
551 Ga0307407_10000701
552 Ga0307407_11498246
553 Ga0307412_10002837
554 Ga0307412_10116871
555 Ga0307409_100024024
556 Ga0307416_100000488
557 Ga0307416_100001975
558 Ga0307416_100191911
559 Ga0307416_103758007
560 Ga0307414_10002972
561 Ga0307411_10000370
562 Ga0307411_10264900
563 Ga0307411_11080775
564 Ga0307415_100000453
565 Ga0307415_100016940
566 Ga0395899_0006573
567 Ga0395899_0008103
568 Ga0395899_0118494
569 Ga0395899_0162783
570 Ga0395899_0215946
571 Ga0395899_0240741
572 Ga0395899_0569588
573 Ga0395899_0711139
574 Ga0395900_0001087
575 Ga0395900_0094352
576 Ga0395900_0109018
577 Ga0395900_0169220
578 Ga0395900_0292179
579 Ga0395900_0386539
580 Ga0395900_0650719
581 Ga0395900_0772188
582 Ga0395900_0840234
583 Ga0395900_1551664
584 Ga0395900_1797913
585 Ga0395898_0013743
586 Ga0395898_0055698
587 Ga0395898_0195105
588 Ga0395898_0261608
589 Ga0395898_0389491
590 Ga0395898_1274116
591 Ga0395905_0007794
592 Ga0395905_0034030
593 Ga0395905_0056348
594 Ga0395905_0104704
595 Ga0395905_0192636
596 Ga0395905_0193981
597 Ga0395905_0385581
598 Ga0395905_0394972
599 Ga0395905_0400115
600 Ga0395905_0559719
601 Ga0395905_0781668
602 Ga0395905_1023572
603 Ga0395905_1321646
604 Ga0395901_0000140
605 Ga0395901_0006958
606 Ga0395901_0034799
607 Ga0395901_0068732
608 Ga0395901_0101699
609 Ga0395901_0214522
610 Ga0395901_0221725
611 Ga0395901_0224333
612 Ga0395901_0235768
613 Ga0395901_0350019
614 Ga0395901_0421690
615 Ga0395901_0524866
616 Ga0395901_0568104
617 Ga0395901_0669933
618 Ga0395901_0889755
619 Ga0395901_0995608
620 Ga0466965_0562214
621 Ga0466966_0203560
622 Ga0466961_0034097
623 Ga0466961_0120444
624 Ga0466961_0903476
625 Ga0466963_0016506
626 Ga0466963_0077110
627 Ga0466963_0138487
628 Ga0466963_0225722
629 Ga0466963_0429957
630 Ga0466963_0531379
631 Ga0466963_0538419
632 Ga0466963_0730178
633 Ga0466963_1188171
634 Ga0466971_0039474
635 Ga0466970_0131142
636 Ga0466957_0252770
637 Ga0466957_0539470
638 Ga0466959_0336949
639 Ga0466959_0394939
640 Ga0466959_0797591
641 Ga0466958_0022190
642 Ga0466958_0026458
643 Ga0466958_0691724
644 Ga0466958_0817503
645 Ga0466958_1025342
646 Ga0466967_0020644
647 Ga0466967_0038883
648 Ga0466967_0075476
649 Ga0466967_0089171
650 Ga0466967_0093338
651 Ga0466967_0136728
652 Ga0466967_0224415
653 Ga0466967_0228601
654 Ga0466967_1234347
655 Ga0466967_2197236
656 Ga0466967_2205304
657 Ga0495669_0043282
658 Ga0495677_0179192
659 Ga0495685_082764
660 Ga0496107_1083146
661 Ga0496114_0000092
662 Ga0501225_0281740
663 nmdc:mga0a205_25484_c1
664 Ga0466962_0178771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05521

Phage_H_T_join

Phage head-tail joining protein

15

116

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z4w-assembly1.cif.gz_1 gp6/gp15/gp16 connector complex of bacteriophage spp1 0.7755 10 108
2pp6-assembly1.cif.gz_A crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium 0.7467 9 106
2kz4-assembly1.cif.gz_A solution structure of protein sf1141 from shigella flexneri 2a, northeast structural genomics consortium (nesg) target sft2 0.7218 4 105
7z4w-assembly1.cif.gz_1 gp6/gp15/gp16 connector complex of bacteriophage spp1 0.7118 10 108
8fwe-assembly1.cif.gz_AM neck structure of agrobacterium phage milano, c3 symmetry 0.7105 10 108
ID Description Score Start End Superfamily
2pp6A02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Phage tail proteins (gpFII-like) 0.7968 61 106 2.40.10.210
3iuwA00 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. 0.7701 82 106 2.30.130.30
af_Q2FWT7_10_107_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7268 10 102 2.40.10.10
af_Q2FX59_1_100_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7242 10 107 3.30.200.20
2kz4A00 Mainly Beta;Beta Barrel;Thrombin, subunit H;Bacteriophage SPP1 head-tail adaptor protein 0.7218 4 105 2.40.10.270
ID Description Score Start End GO Terms
AF-A0A419WMU6-F1-model_v4 SPP1 family predicted phage head-tail adaptor 0.8906 1 106
AF-A0A1E3U7K8-F1-model_v4 Phage head-tail joining protein 0.8808 10 108
AF-A0A519EFS2-F1-model_v4 Head-tail adaptor protein 0.8798 10 107
AF-A0A352KA91-F1-model_v4 Head-tail adaptor protein 0.8781 5 108
AF-W8WVV7-F1-model_v4 Phage head-tail adaptor 0.8777 5 107

Map