F410934

General Info

Members Datasets Scaffolds Average Seq Length
332 212 267 238

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000065|Ga0157373_1000006538
Length 265
Sequence MSKYKHPSPNIKHQIFNNMITIQNLKKTYGNATVLNIENLEIQKGETFGLVGNNGAGKTTLFSLVLDLIQPTTGFVSVDDIKVNESEAWKNKVSAFIDETFLIGYLTPEEYFYFIGELRGQNKASVDEFLKQFHDLFNGEIVNSGKYVRDLSKGNQKKVGIVGALIGKPEIIILDEPFANLDPSTQIKLKNMIRDFANENGVTFLISSHDLAHTTEVCNRIVVVNKGEVVRDIQTTPETLQDLEKYFADQVSLGKQEISTEKTSL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
20 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
21 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
22 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
23 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
24 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
25 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
26 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
27 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
28 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
29 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
30 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
31 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
32 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
33 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
34 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
35 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
36 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
37 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
38 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
39 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
40 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
41 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
42 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
43 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
44 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
45 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
46 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
47 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
48 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
49 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
50 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
51 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
52 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
53 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
54 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
55 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
56 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
57 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
58 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
59 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
60 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
61 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
62 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
63 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
64 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
65 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
66 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
67 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
68 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
201 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
202 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
211 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
212 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.12
Metatranscriptomes 0
Isolates 19.88

Biome Distribution

Category Percentage (%)
Aerial Root 1.2
Bulb 0
Endosphere 6.02
Nodule 0.3
Rhizoplane 1.2
Rhizosphere 76.2
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_240638 2162886007 Bacteria 4396
2 JGI24737J22298_10008638 3300001990 Bacteria 3407
3 JGI24737J22298_10009113 3300001990 Bacteria 3307
4 JGI24735J21928_10000007 3300002067 Bacteria 333510
5 JGI25164J39214_1001335 3300002772 Bacteria 6104
6 JGI25165J46597_1000836 3300003214 Bacteria 22780
7 rootH2_10059393 3300003320 Bacteria 48659
8 rootH2_10140490 3300003320 Bacteria 1726
9 rootL2_10110098 3300003322 Bacteria 8832
10 rootH1_10004929 3300003316 Bacteria 39919
11 rootH1_10004929 3300003323 Bacteria 12397
12 rootH1_10006508 3300003323 Bacteria 33986
13 rootH1_10108336 3300003323 Unclassified 4483
14 Ga0065714_10064582 3300005288 Bacteria 32328
15 Ga0065714_10064996 3300005288 Bacteria 14304
16 Ga0065714_10073822 3300005288 Bacteria 3126
17 Ga0065704_10070940 3300005289 Bacteria 14324
18 Ga0065704_10071407 3300005289 Bacteria 11313
19 Ga0065704_10158986 3300005289 Bacteria 1369
20 Ga0065715_10124072 3300005293 Bacteria 2093
21 Ga0065715_10144320 3300005293 Bacteria 1809
22 Ga0065715_10204706 3300005293 Bacteria 1340
23 Ga0065715_10377815 3300005293 Bacteria 912
24 Ga0070658_10113466 3300005327 Bacteria 2247
25 Ga0070683_100005684 3300005329 Bacteria 10414
26 Ga0070683_100530957 3300005329 Bacteria 1124
27 Ga0070670_100492200 3300005331 Unclassified 1090
28 Ga0070660_100049422 3300005339 Bacteria 3233
29 Ga0070692_10031746 3300005345 Bacteria 2650
30 Ga0070675_100986284 3300005354 Bacteria 773
31 Ga0070659_100028865 3300005366 Bacteria 4286
32 Ga0070663_100060751 3300005455 Bacteria 2719
33 Ga0070663_100577983 3300005455 Bacteria 942
34 Ga0070678_100566247 3300005456 Bacteria 1010
35 Ga0070681_10057428 3300005458 Bacteria 3872
36 Ga0070681_10236419 3300005458 Bacteria 1741
37 Ga0070679_100002915 3300005530 Bacteria 15555
38 Ga0070679_100184445 3300005530 Bacteria 2058
39 Ga0070684_100046832 3300005535 Bacteria 3747
40 Ga0070684_100299383 3300005535 Bacteria 1476
41 Ga0068853_100288211 3300005539 Bacteria 1515
42 Ga0068857_100033861 3300005577 Bacteria 4519
43 Ga0068857_100049788 3300005577 Bacteria 3717
44 Ga0068857_100301612 3300005577 Bacteria 1477
45 Ga0068852_100014878 3300005616 Bacteria 6013
46 Ga0075366_10006224 3300006195 Bacteria 6517
47 Ga0075366_10068418 3300006195 Bacteria 2113
48 Ga0075366_10327910 3300006195 Bacteria 938
49 Ga0097621_100031873 3300006237 Bacteria 4184
50 Ga0068871_100008672 3300006358 Bacteria 7313
51 Ga0105244_10000013 3300009036 Bacteria 258350
52 Ga0105250_10059027 3300009092 Bacteria 1540
53 Ga0105240_10000888 3300009093 Bacteria 53670
54 Ga0105240_10004520 3300009093 Bacteria 21135
55 Ga0105240_10146874 3300009093 Bacteria 2813
56 Ga0105240_10284116 3300009093 Bacteria 1900
57 Ga0105243_10333872 3300009148 Bacteria 1386
58 Ga0105237_10155271 3300009545 Bacteria 2285
59 Ga0105238_10080663 3300009551 Unclassified 3243
60 Ga0105238_10508146 3300009551 Bacteria 1207
61 Ga0105239_10000014 3300010375 Bacteria 325391
62 Ga0105239_10000639 3300010375 Bacteria 49788
63 Ga0105239_10003895 3300010375 Bacteria 18090
64 Ga0105239_10032802 3300010375 Bacteria 5706
65 Ga0105239_10081585 3300010375 Unclassified 3560
66 Ga0157339_1004893 3300012505 Bacteria 1036
67 Ga0157373_10000065 3300013100 Bacteria 93292
68 Ga0157373_10005223 3300013100 Bacteria 9751
69 Ga0157373_10008728 3300013100 Bacteria 7514
70 Ga0157373_10021728 3300013100 Bacteria 4657
71 Ga0157373_10144206 3300013100 Bacteria 1675
72 Ga0157373_10163685 3300013100 Bacteria 1565
73 Ga0157373_10452682 3300013100 Bacteria 924
74 Ga0157371_10000019 3300013102 Bacteria 307914
75 Ga0157371_10000121 3300013102 Bacteria 118793
76 Ga0157371_10009663 3300013102 Bacteria 7581
77 Ga0157371_10030263 3300013102 Bacteria 3906
78 Ga0157370_10002700 3300013104 Bacteria 21263
79 Ga0157370_10002702 3300013104 Bacteria 21259
80 Ga0157370_10002796 3300013104 Bacteria 20846
81 Ga0157370_10006012 3300013104 Bacteria 13503
82 Ga0157370_10013816 3300013104 Bacteria 8295
83 Ga0157370_10016397 3300013104 Bacteria 7499
84 Ga0157370_10043368 3300013104 Bacteria 4330
85 Ga0157370_10100172 3300013104 Bacteria 2715
86 Ga0157370_10154614 3300013104 Bacteria 2134
87 Ga0157370_10287245 3300013104 Bacteria 1519
88 Ga0157370_10287906 3300013104 Bacteria 1518
89 Ga0157370_10480001 3300013104 Bacteria 1142
90 Ga0157370_10501158 3300013104 Bacteria 1115
91 Ga0157369_10000019 3300013105 Bacteria 243437
92 Ga0157369_10085641 3300013105 Bacteria 3367
93 Ga0157369_10127976 3300013105 Bacteria 2692
94 Ga0157374_10385986 3300013296 Bacteria 1395
95 Ga0157378_10013816 3300013297 Bacteria 7061
96 Ga0163162_10046514 3300013306 Bacteria 4349
97 Ga0163162_10074938 3300013306 Bacteria 3444
98 Ga0163162_10193426 3300013306 Bacteria 2162
99 Ga0163162_10991843 3300013306 Bacteria 949
100 Ga0163162_11288571 3300013306 Bacteria 830
101 Ga0157372_10006328 3300013307 Bacteria 12597
102 Ga0157372_10008241 3300013307 Bacteria 11078
103 Ga0157372_10145472 3300013307 Bacteria 2733
104 Ga0157372_10213526 3300013307 Bacteria 2236
105 Ga0157375_10006462 3300013308 Bacteria 10210
106 Ga0157375_10034571 3300013308 Bacteria 4817
107 Ga0163163_11180495 3300014325 Bacteria 828
108 Ga0182008_10000005 3300014497 Bacteria 386556
109 Ga0182008_10150210 3300014497 Bacteria 1168
110 Ga0182006_1004204 3300015261 Bacteria 7140
111 Ga0163161_10003997 3300017792 Bacteria 10319
112 Ga0163161_10008375 3300017792 Bacteria 7158
113 Ga0163161_10066775 3300017792 Bacteria 2627
114 Ga0163161_10075003 3300017792 Bacteria 2481
115 Ga0209563_112262 3300025230 Bacteria 1181
116 Ga0207427_100072 3300025231 Bacteria 158364
117 Ga0209437_100026 3300025233 Bacteria 542698
118 Ga0209437_100144 3300025233 Bacteria 164794
119 Ga0209026_1002432 3300025250 Bacteria 7004
120 Ga0209233_1000111 3300025261 Bacteria 260262
121 Ga0209233_1000829 3300025261 Bacteria 13693
122 Ga0209675_1000034 3300025291 Bacteria 267827
123 Ga0207655_1000031 3300025728 Bacteria 392265
124 Ga0207647_10002584 3300025904 Bacteria 13697
125 Ga0207705_10122045 3300025909 Bacteria 1934
126 Ga0207705_10148182 3300025909 Bacteria 1757
127 Ga0207707_10105284 3300025912 Bacteria 2466
128 Ga0207707_10354422 3300025912 Unclassified 1264
129 Ga0207695_10000066 3300025913 Bacteria 334103
130 Ga0207695_10000584 3300025913 Bacteria 73948
131 Ga0207695_10087551 3300025913 Bacteria 3137
132 Ga0207671_10088451 3300025914 Bacteria 2330
133 Ga0207660_10055392 3300025917 Bacteria 2834
134 Ga0207660_10457725 3300025917 Bacteria 1032
135 Ga0207657_10041839 3300025919 Bacteria 4048
136 Ga0207657_10225252 3300025919 Bacteria 1501
137 Ga0207652_10000276 3300025921 Bacteria 53325
138 Ga0207652_10001442 3300025921 Bacteria 21070
139 Ga0207694_10072870 3300025924 Unclassified 2686
140 Ga0207690_10007983 3300025932 Bacteria 6283
141 Ga0207690_10016116 3300025932 Bacteria 4543
142 Ga0207709_10307336 3300025935 Bacteria 1181
143 Ga0207661_10003882 3300025944 Bacteria 10420
144 Ga0207661_10290599 3300025944 Bacteria 1463
145 Ga0207667_10192116 3300025949 Bacteria 2095
146 Ga0207668_10018985 3300025972 Bacteria 4336
147 Ga0207703_10004670 3300026035 Bacteria 11187
148 Ga0207678_10018619 3300026067 Bacteria 6096
149 Ga0207674_10084932 3300026116 Bacteria 3162
150 Ga0207674_10512301 3300026116 Bacteria 1159
151 Ga0307517_10130728 3300028786 Bacteria 1809
152 Ga0307515_10120225 3300028794 Bacteria 2982
153 Ga0307515_10142426 3300028794 Bacteria 2563
154 Ga0307408_100000600 3300031548 Bacteria 30960
155 Ga0307405_10000001 3300031731 Bacteria 1731270
156 Ga0307405_10022408 3300031731 Bacteria 3571
157 Ga0307413_10000001 3300031824 Bacteria 159157
158 Ga0307413_10440806 3300031824 Bacteria 1031
159 Ga0307410_10000024 3300031852 Bacteria 59872
160 Ga0307406_10000023 3300031901 Bacteria 96825
161 Ga0307406_10000979 3300031901 Bacteria 15930
162 Ga0307407_10000144 3300031903 Bacteria 22043
163 Ga0307412_10000006 3300031911 Bacteria 506878
164 Ga0307412_10000168 3300031911 Bacteria 46531
165 Ga0307412_10003820 3300031911 Bacteria 8377
166 Ga0307412_10139424 3300031911 Unclassified 1774
167 Ga0307416_100000016 3300032002 Bacteria 205465
168 Ga0307414_10000022 3300032004 Bacteria 212123
169 Ga0307414_10000031 3300032004 Bacteria 186808
170 Ga0307414_10160271 3300032004 Bacteria 1786
171 Ga0307414_10175130 3300032004 Bacteria 1719
172 Ga0307414_10540960 3300032004 Bacteria 1036
173 Ga0307411_10000003 3300032005 Bacteria 477556
174 Ga0307411_10280859 3300032005 Bacteria 1325
175 Ga0307510_10072724 3300033180 Bacteria 3414
176 Ga0395899_0000626 3300037312 Bacteria 36835
177 Ga0395899_0303617 3300037312 Bacteria 1079
178 Ga0395900_0016526 3300037418 Bacteria 7527
179 Ga0395900_0166298 3300037418 Bacteria 2248
180 Ga0395900_0566883 3300037418 Bacteria 1078
181 Ga0395898_0001310 3300037466 Bacteria 36272
182 Ga0395898_0013209 3300037466 Bacteria 8507
183 Ga0395898_0494441 3300037466 Bacteria 1163
184 Ga0395898_0897606 3300037466 Unclassified 824
185 Ga0395905_0006438 3300037471 Bacteria 11822
186 Ga0395901_0036832 3300038443 Bacteria 5057
187 Ga0395901_0342082 3300038443 Bacteria 1545
188 Ga0395901_0470937 3300038443 Bacteria 1282
189 Ga0395901_0819130 3300038443 Unclassified 918
190 Ga0439447_000482 3300041407 Bacteria 14812
191 Ga0439466_0000086 3300041411 Bacteria 36124
192 Ga0439445_0036606 3300042004 Bacteria 1291
193 Ga0466964_0012596 3300044706 Bacteria 3202
194 Ga0466968_0077195 3300044735 Bacteria 1459
195 Ga0495627_000030 3300046453 Bacteria 228883
196 Ga0495638_0020531 3300046460 Bacteria 4363
197 Ga0495585_0000097 3300046492 Bacteria 93394
198 Ga0495606_0002300 3300046507 Bacteria 22573
199 Ga0495606_0003337 3300046507 Bacteria 17133
200 Ga0495606_0013513 3300046507 Bacteria 6441
201 Ga0495606_0050507 3300046507 Bacteria 2720
202 Ga0495606_0108881 3300046507 Bacteria 1674
203 Ga0495606_0124610 3300046507 Bacteria 1538
204 Ga0495610_0000005 3300046512 Bacteria 924111
205 Ga0495610_0000500 3300046512 Bacteria 40127
206 Ga0495610_0026294 3300046512 Bacteria 3109
207 Ga0495632_0001079 3300046519 Bacteria 23399
208 Ga0495637_0101469 3300046520 Bacteria 1124
209 Ga0495643_0051819 3300046522 Bacteria 2206
210 Ga0495643_0151159 3300046522 Bacteria 1149
211 Ga0495663_0000136 3300046525 Bacteria 29901
212 Ga0495663_0006297 3300046525 Bacteria 3279
213 Ga0495654_0000003 3300046530 Bacteria 863485
214 Ga0495609_0000003 3300046538 Bacteria 711547
215 Ga0495633_0000001 3300046558 Bacteria 801972
216 Ga0495633_0000454 3300046558 Bacteria 42027
217 Ga0495633_0017809 3300046558 Bacteria 3620
218 Ga0495625_0000040 3300046660 Bacteria 207320
219 Ga0495661_0001872 3300046665 Bacteria 16798
220 Ga0495661_0015450 3300046665 Bacteria 5096
221 Ga0495671_0089832 3300046692 Bacteria 1504
222 Ga0495687_008710 3300047443 Bacteria 5765
223 Ga0495673_0024700 3300047469 Bacteria 2897
224 Ga0495686_0000243 3300047472 Bacteria 98394
225 Ga0495686_0000729 3300047472 Bacteria 44005
226 Ga0495686_0017718 3300047472 Bacteria 4793
227 Ga0496100_0776255 3300048903 Bacteria 750
228 Ga0496113_0027638 3300048916 Bacteria 4070
229 Ga0496115_0102246 3300048918 Bacteria 2350
230 Ga0496116_0000068 3300048919 Bacteria 259724
231 Ga0496117_0000062 3300048920 Bacteria 257535
232 Ga0496118_0002099 3300048921 Bacteria 27997
233 Ga0496119_0000024 3300048922 Bacteria 257750
234 Ga0496121_0096300 3300048924 Bacteria 2297
235 Ga0496121_0147493 3300048924 Bacteria 1736
236 Ga0496122_0000171 3300048925 Bacteria 154143
237 Ga0496122_0002633 3300048925 Bacteria 25096
238 Ga0496122_0008794 3300048925 Bacteria 10789
239 Ga0496123_0000745 3300048926 Bacteria 52660
240 Ga0496123_0207867 3300048926 Bacteria 997
241 Ga0496125_0000267 3300048928 Bacteria 107026
242 Ga0496125_0001677 3300048928 Bacteria 30975
243 Ga0496125_0029810 3300048928 Bacteria 4894
244 Ga0496126_0000495 3300048929 Bacteria 77686
245 Ga0496126_0020142 3300048929 Bacteria 6548
246 Ga0501032_0349308 3300049569 Bacteria 953
247 Ga0501034_0022764 3300049571 Bacteria 6383
248 Ga0501038_0305479 3300049574 Bacteria 1248
249 Ga0501040_0183049 3300049576 Bacteria 1485
250 Ga0501070_0048492 3300049586 Bacteria 3528
251 Ga0501224_020531 3300049664 Bacteria 983
252 Ga0501238_000038 3300049671 Bacteria 23040
253 Ga0501249_000032 3300049679 Bacteria 73488
254 Ga0501249_001297 3300049679 Bacteria 5203
255 Ga0501241_000028 3300049758 Bacteria 58273
256 Ga0501266_000003 3300049763 Bacteria 388836
257 Ga0501269_000019 3300049766 Bacteria 55763
258 Ga0501269_001759 3300049766 Bacteria 2759
259 Ga0501280_000823 3300049776 Bacteria 6715
260 nmdc:mga0k408_15724_c1 3300050493 Bacteria 4189
261 Ga0500644_0044811 3300053088 Bacteria 1487
262 Ga0500646_0012847 3300053090 Bacteria 2165
263 Ga0500641_0000005 3300053096 Bacteria 226810
264 Ga0500641_0000106 3300053096 Bacteria 31895
265 Ga0500594_0045537 3300053118 Bacteria 1217
266 Ga0500658_0000015 3300053134 Bacteria 151134
267 Ga0500559_0057033 3300053136 Bacteria 1735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0897606 Ga0395898_0897606_144_794 216
2 iso_pu_bacteria 2984527788 2984529374 225
3 iso_pu_bacteria 2984532647 2984535480 225
4 iso_pu_bacteria 2511231000 2511232436 227
5 iso_pu_bacteria 2513020052 2513234693 227
6 iso_pu_bacteria 2523533629 2524005130 227
7 iso_pu_bacteria 2582581278 2585142064 227
8 iso_pu_bacteria 2582581281 2585158040 227
9 iso_pu_bacteria 2582581282 2585161383 227
10 iso_pu_bacteria 2582581873 2585426277 227
11 iso_pu_bacteria 2585428060 2587747549 227
12 iso_pu_bacteria 2585428061 2587753291 227
13 iso_pu_bacteria 2585428095 2587866340 227
14 iso_pu_bacteria 2585428115 2587944862 227
15 iso_pu_bacteria 2585428182 2588211904 227
16 iso_pu_bacteria 2585428183 2588216431 227
17 iso_pu_bacteria 2585428184 2588221001 227
18 iso_pu_bacteria 2585428185 2588225448 227
19 iso_pu_bacteria 2585428187 2588232476 227
20 iso_pu_bacteria 2588253712 2588448219 227
21 iso_pu_bacteria 2588254257 2590609491 227
22 iso_pu_bacteria 2599185184 2599479802 227
23 iso_pu_bacteria 2643221600 2644012144 227
24 iso_pu_bacteria 2643221667 2644374544 227
25 iso_pu_bacteria 2643221725 2644682465 227
26 iso_pu_bacteria 2728369107 2729201511 227
27 iso_pu_bacteria 2738541273 2738698579 227
28 iso_pu_bacteria 2738543014 2739252905 227
29 iso_pu_bacteria 2739367857 2740000371 227
30 iso_pu_bacteria 2739367858 2740005187 227
31 iso_pu_bacteria 2739367874 2740059774 227
32 iso_pu_bacteria 2765235839 2765574953 227
33 iso_pu_bacteria 2772190705 2772604441 227
34 iso_pu_bacteria 2775506739 2775674915 227
35 iso_pu_bacteria 2802428842 2802651237 227
36 iso_pu_bacteria 2816332188 2816876239 227
37 iso_pu_bacteria 2842083920 2842084371 227
38 iso_pu_bacteria 2857613821 2857617806 227
39 iso_pu_bacteria 2857618242 2857621378 227
40 iso_pu_bacteria 2871720351 2871722039 227
41 iso_pu_bacteria 2881247448 2881248868 227
42 iso_pu_bacteria 2881359912 2881361424 227
43 iso_pu_bacteria 2889290771 2889294488 227
44 iso_pu_bacteria 2896344016 2896345581 227
45 iso_pu_bacteria 2904555929 2904557744 227
46 iso_pu_bacteria 2905999023 2906002970 227
47 iso_pu_bacteria 2919097161 2919099754 227
48 iso_pu_bacteria 2919191525 2919192383 227
49 iso_pu_bacteria 2919399522 2919401949 227
50 iso_pu_bacteria 2919509842 2919512694 227
51 iso_pu_bacteria 2919683626 2919684210 227
52 iso_pu_bacteria 2928078545 2928084104 227
53 iso_pu_bacteria 2928147474 2928153068 227
54 iso_pu_bacteria 2929150217 2929151260 227
55 iso_pu_bacteria 2932082852 2932086975 227
56 iso_pu_bacteria 2945924605 2945925030 227
57 iso_pu_bacteria 2946019816 2946023420 227
58 iso_pu_bacteria 2958512119 2958515566 227
59 iso_pu_bacteria 2977243572 2977243786 227
60 iso_pu_bacteria 2977268062 2977272651 227
61 iso_pu_bacteria 2984572630 2984573883 227
62 iso_pu_bacteria 2984606641 2984607329 227
63 iso_pu_bacteria 2993372514 2993375337 227
64 iso_pu_bacteria 2993480792 2993482202 227
65 iso_pu_bacteria 8054307821 8054310881 227
66 iso_pu_bacteria 8055592153 8055597028 227
67 iso_pu_bacteria 8056440228 8056440888 227
68 3300001990 JGI24737J22298_10008638 JGI24737J22298_100086382 230
69 3300005329 Ga0070683_100530957 Ga0070683_1005309571 230
70 3300005456 Ga0070678_100566247 Ga0070678_1005662471 230
71 3300005458 Ga0070681_10236419 Ga0070681_102364192 230
72 3300005530 Ga0070679_100002915 Ga0070679_1000029156 230
73 3300005577 Ga0068857_100033861 Ga0068857_1000338611 230
74 3300005577 Ga0068857_100049788 Ga0068857_1000497883 230
75 3300006195 Ga0075366_10068418 Ga0075366_100684182 230
76 3300009093 Ga0105240_10146874 Ga0105240_101468742 230
77 3300010375 Ga0105239_10000014 Ga0105239_10000014119 230
78 3300013100 Ga0157373_10005223 Ga0157373_100052234 230
79 3300013100 Ga0157373_10008728 Ga0157373_100087285 230
80 3300013100 Ga0157373_10144206 Ga0157373_101442062 230
81 3300013102 Ga0157371_10000121 Ga0157371_100001212 230
82 3300013102 Ga0157371_10030263 Ga0157371_100302633 230
83 3300013104 Ga0157370_10154614 Ga0157370_101546142 230
84 3300013105 Ga0157369_10085641 Ga0157369_100856412 230
85 3300013105 Ga0157369_10127976 Ga0157369_101279762 230
86 3300013296 Ga0157374_10385986 Ga0157374_103859862 230
87 3300013307 Ga0157372_10008241 Ga0157372_1000824110 230
88 3300013307 Ga0157372_10145472 Ga0157372_101454723 230
89 3300025250 Ga0209026_1002432 Ga0209026_10024327 230
90 3300025261 Ga0209233_1000829 Ga0209233_10008296 230
91 3300025904 Ga0207647_10002584 Ga0207647_100025845 230
92 3300025913 Ga0207695_10087551 Ga0207695_100875512 230
93 3300025917 Ga0207660_10055392 Ga0207660_100553923 230
94 3300025921 Ga0207652_10000276 Ga0207652_1000027611 230
95 3300025932 Ga0207690_10016116 Ga0207690_100161162 230
96 3300026116 Ga0207674_10084932 Ga0207674_100849324 230
97 3300026116 Ga0207674_10512301 Ga0207674_105123012 230
98 3300037312 Ga0395899_0000626 Ga0395899_0000626_22144_22836 230
99 3300037312 Ga0395899_0303617 Ga0395899_0303617_227_919 230
100 3300037418 Ga0395900_0016526 Ga0395900_0016526_1384_2076 230
101 3300037418 Ga0395900_0166298 Ga0395900_0166298_955_1704 230
102 3300037418 Ga0395900_0566883 Ga0395900_0566883_227_919 230
103 3300037466 Ga0395898_0001310 Ga0395898_0001310_11139_11831 230
104 3300037466 Ga0395898_0013209 Ga0395898_0013209_3486_4178 230
105 3300037471 Ga0395905_0006438 Ga0395905_0006438_6446_7138 230
106 3300038443 Ga0395901_0036832 Ga0395901_0036832_146_838 230
107 3300038443 Ga0395901_0342082 Ga0395901_0342082_707_1399 230
108 3300038443 Ga0395901_0819130 Ga0395901_0819130_29_721 230
109 3300046507 Ga0495606_0050507 Ga0495606_0050507_942_1649 230
110 3300047472 Ga0495686_0000729 Ga0495686_0000729_40543_41295 230
111 2162886007 SwRhRL2b_contig_240638 SwRhRL2b_0987.00007440 231
112 3300001990 JGI24737J22298_10009113 JGI24737J22298_100091132 231
113 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007159 231
114 3300002772 JGI25164J39214_1001335 JGI25164J39214_10013354 231
115 3300003214 JGI25165J46597_1000836 JGI25165J46597_10008369 231
116 3300003320 rootH2_10059393 rootH2_1005939343 231
117 3300003320 rootH2_10140490 rootH2_101404903 231
118 3300003322 rootL2_10110098 rootL2_101100985 231
119 3300003323 rootH1_10004929 rootH1_100049299 231
120 3300003323 rootH1_10006508 rootH1_100065083 231
121 3300003323 rootH1_10108336 rootH1_101083362 231
122 3300005288 Ga0065714_10064582 Ga0065714_100645829 231
123 3300005288 Ga0065714_10064996 Ga0065714_1006499611 231
124 3300005288 Ga0065714_10073822 Ga0065714_100738222 231
125 3300005289 Ga0065704_10070940 Ga0065704_1007094010 231
126 3300005289 Ga0065704_10071407 Ga0065704_100714076 231
127 3300005289 Ga0065704_10158986 Ga0065704_101589861 231
128 3300005293 Ga0065715_10124072 Ga0065715_101240722 231
129 3300005293 Ga0065715_10144320 Ga0065715_101443202 231
130 3300005293 Ga0065715_10204706 Ga0065715_102047061 231
131 3300005293 Ga0065715_10377815 Ga0065715_103778152 231
132 3300005327 Ga0070658_10113466 Ga0070658_101134663 231
133 3300005329 Ga0070683_100005684 Ga0070683_1000056847 231
134 3300005331 Ga0070670_100492200 Ga0070670_1004922002 231
135 3300005339 Ga0070660_100049422 Ga0070660_1000494222 231
136 3300005345 Ga0070692_10031746 Ga0070692_100317462 231
137 3300005354 Ga0070675_100986284 Ga0070675_1009862841 231
138 3300005366 Ga0070659_100028865 Ga0070659_1000288656 231
139 3300005455 Ga0070663_100060751 Ga0070663_1000607512 231
140 3300005455 Ga0070663_100577983 Ga0070663_1005779831 231
141 3300005458 Ga0070681_10057428 Ga0070681_100574283 231
142 3300005530 Ga0070679_100184445 Ga0070679_1001844452 231
143 3300005535 Ga0070684_100046832 Ga0070684_1000468322 231
144 3300005535 Ga0070684_100299383 Ga0070684_1002993832 231
145 3300005539 Ga0068853_100288211 Ga0068853_1002882112 231
146 3300005577 Ga0068857_100301612 Ga0068857_1003016122 231
147 3300005616 Ga0068852_100014878 Ga0068852_1000148783 231
148 3300006195 Ga0075366_10006224 Ga0075366_100062246 231
149 3300006195 Ga0075366_10327910 Ga0075366_103279101 231
150 3300006237 Ga0097621_100031873 Ga0097621_1000318735 231
151 3300006358 Ga0068871_100008672 Ga0068871_1000086722 231
152 3300009036 Ga0105244_10000013 Ga0105244_10000013174 231
153 3300009092 Ga0105250_10059027 Ga0105250_100590272 231
154 3300009093 Ga0105240_10000888 Ga0105240_1000088835 231
155 3300009093 Ga0105240_10004520 Ga0105240_100045208 231
156 3300009093 Ga0105240_10284116 Ga0105240_102841162 231
157 3300009148 Ga0105243_10333872 Ga0105243_103338721 231
158 3300009545 Ga0105237_10155271 Ga0105237_101552712 231
159 3300009551 Ga0105238_10080663 Ga0105238_100806632 231
160 3300009551 Ga0105238_10508146 Ga0105238_105081461 231
161 3300010375 Ga0105239_10000639 Ga0105239_1000063940 231
162 3300010375 Ga0105239_10003895 Ga0105239_100038956 231
163 3300010375 Ga0105239_10032802 Ga0105239_100328023 231
164 3300010375 Ga0105239_10081585 Ga0105239_100815853 231
165 3300012505 Ga0157339_1004893 Ga0157339_10048932 231
166 3300013100 Ga0157373_10000065 Ga0157373_1000006538 231
167 3300013100 Ga0157373_10021728 Ga0157373_100217282 231
168 3300013100 Ga0157373_10163685 Ga0157373_101636851 231
169 3300013100 Ga0157373_10452682 Ga0157373_104526821 231
170 3300013102 Ga0157371_10000019 Ga0157371_1000001962 231
171 3300013102 Ga0157371_10009663 Ga0157371_100096639 231
172 3300013104 Ga0157370_10002700 Ga0157370_100027003 231
173 3300013104 Ga0157370_10002702 Ga0157370_1000270210 231
174 3300013104 Ga0157370_10002796 Ga0157370_1000279615 231
175 3300013104 Ga0157370_10006012 Ga0157370_100060126 231
176 3300013104 Ga0157370_10013816 Ga0157370_100138162 231
177 3300013104 Ga0157370_10016397 Ga0157370_100163975 231
178 3300013104 Ga0157370_10043368 Ga0157370_100433681 231
179 3300013104 Ga0157370_10100172 Ga0157370_101001723 231
180 3300013104 Ga0157370_10287245 Ga0157370_102872452 231
181 3300013104 Ga0157370_10287906 Ga0157370_102879062 231
182 3300013104 Ga0157370_10480001 Ga0157370_104800011 231
183 3300013104 Ga0157370_10501158 Ga0157370_105011581 231
184 3300013105 Ga0157369_10000019 Ga0157369_10000019200 231
185 3300013297 Ga0157378_10013816 Ga0157378_100138164 231
186 3300013306 Ga0163162_10046514 Ga0163162_100465143 231
187 3300013306 Ga0163162_10074938 Ga0163162_100749384 231
188 3300013306 Ga0163162_10193426 Ga0163162_101934262 231
189 3300013306 Ga0163162_10991843 Ga0163162_109918432 231
190 3300013306 Ga0163162_11288571 Ga0163162_112885712 231
191 3300013307 Ga0157372_10006328 Ga0157372_1000632812 231
192 3300013307 Ga0157372_10213526 Ga0157372_102135263 231
193 3300013308 Ga0157375_10006462 Ga0157375_100064624 231
194 3300013308 Ga0157375_10034571 Ga0157375_100345712 231
195 3300014325 Ga0163163_11180495 Ga0163163_111804951 231
196 3300014497 Ga0182008_10000005 Ga0182008_1000000575 231
197 3300014497 Ga0182008_10150210 Ga0182008_101502102 231
198 3300015261 Ga0182006_1004204 Ga0182006_10042042 231
199 3300017792 Ga0163161_10003997 Ga0163161_100039978 231
200 3300017792 Ga0163161_10008375 Ga0163161_100083757 231
201 3300017792 Ga0163161_10066775 Ga0163161_100667752 231
202 3300017792 Ga0163161_10075003 Ga0163161_100750032 231
203 3300025230 Ga0209563_112262 Ga0209563_1122622 231
204 3300025231 Ga0207427_100072 Ga0207427_10007230 231
205 3300025233 Ga0209437_100026 Ga0209437_100026312 231
206 3300025233 Ga0209437_100144 Ga0209437_1001446 231
207 3300025261 Ga0209233_1000111 Ga0209233_1000111206 231
208 3300025291 Ga0209675_1000034 Ga0209675_100003466 231
209 3300025728 Ga0207655_1000031 Ga0207655_1000031174 231
210 3300025909 Ga0207705_10122045 Ga0207705_101220451 231
211 3300025909 Ga0207705_10148182 Ga0207705_101481822 231
212 3300025912 Ga0207707_10105284 Ga0207707_101052842 231
213 3300025912 Ga0207707_10354422 Ga0207707_103544222 231
214 3300025913 Ga0207695_10000066 Ga0207695_10000066161 231
215 3300025913 Ga0207695_10000584 Ga0207695_1000058454 231
216 3300025914 Ga0207671_10088451 Ga0207671_100884512 231
217 3300025917 Ga0207660_10457725 Ga0207660_104577251 231
218 3300025919 Ga0207657_10041839 Ga0207657_100418393 231
219 3300025919 Ga0207657_10225252 Ga0207657_102252522 231
220 3300025921 Ga0207652_10001442 Ga0207652_1000144219 231
221 3300025924 Ga0207694_10072870 Ga0207694_100728701 231
222 3300025932 Ga0207690_10007983 Ga0207690_100079832 231
223 3300025935 Ga0207709_10307336 Ga0207709_103073362 231
224 3300025944 Ga0207661_10003882 Ga0207661_100038824 231
225 3300025944 Ga0207661_10290599 Ga0207661_102905992 231
226 3300025949 Ga0207667_10192116 Ga0207667_101921162 231
227 3300025972 Ga0207668_10018985 Ga0207668_100189855 231
228 3300026035 Ga0207703_10004670 Ga0207703_100046706 231
229 3300026067 Ga0207678_10018619 Ga0207678_100186197 231
230 3300028786 Ga0307517_10130728 Ga0307517_101307281 231
231 3300028794 Ga0307515_10120225 Ga0307515_101202253 231
232 3300028794 Ga0307515_10142426 Ga0307515_101424262 231
233 3300031548 Ga0307408_100000600 Ga0307408_1000006002 231
234 3300031731 Ga0307405_10000001 Ga0307405_1000000192 231
235 3300031731 Ga0307405_10022408 Ga0307405_100224082 231
236 3300031824 Ga0307413_10000001 Ga0307413_1000000162 231
237 3300031824 Ga0307413_10440806 Ga0307413_104408062 231
238 3300031852 Ga0307410_10000024 Ga0307410_1000002461 231
239 3300031901 Ga0307406_10000023 Ga0307406_1000002367 231
240 3300031901 Ga0307406_10000979 Ga0307406_1000097914 231
241 3300031903 Ga0307407_10000144 Ga0307407_1000014412 231
242 3300031911 Ga0307412_10000006 Ga0307412_10000006177 231
243 3300031911 Ga0307412_10000168 Ga0307412_1000016840 231
244 3300031911 Ga0307412_10003820 Ga0307412_100038204 231
245 3300031911 Ga0307412_10139424 Ga0307412_101394242 231
246 3300032002 Ga0307416_100000016 Ga0307416_10000001616 231
247 3300032004 Ga0307414_10000022 Ga0307414_1000002247 231
248 3300032004 Ga0307414_10000031 Ga0307414_1000003182 231
249 3300032004 Ga0307414_10160271 Ga0307414_101602712 231
250 3300032004 Ga0307414_10175130 Ga0307414_101751302 231
251 3300032004 Ga0307414_10540960 Ga0307414_105409601 231
252 3300032005 Ga0307411_10000003 Ga0307411_10000003283 231
253 3300032005 Ga0307411_10280859 Ga0307411_102808592 231
254 3300033180 Ga0307510_10072724 Ga0307510_100727243 231
255 3300037466 Ga0395898_0494441 Ga0395898_0494441_165_923 231
256 3300038443 Ga0395901_0470937 Ga0395901_0470937_426_1184 231
257 3300041407 Ga0439447_000482 Ga0439447_000482_6904_7599 231
258 3300041411 Ga0439466_0000086 Ga0439466_0000086_7973_8668 231
259 3300042004 Ga0439445_0036606 Ga0439445_0036606_199_921 231
260 3300044706 Ga0466964_0012596 Ga0466964_0012596_16_858 231
261 3300044735 Ga0466968_0077195 Ga0466968_0077195_44_787 231
262 3300046453 Ga0495627_000030 Ga0495627_000030_178503_179228 231
263 3300046460 Ga0495638_0020531 Ga0495638_0020531_981_1676 231
264 3300046492 Ga0495585_0000097 Ga0495585_0000097_34916_35632 231
265 3300046507 Ga0495606_0002300 Ga0495606_0002300_14863_15576 231
266 3300046507 Ga0495606_0003337 Ga0495606_0003337_13288_14001 231
267 3300046507 Ga0495606_0013513 Ga0495606_0013513_5135_5830 231
268 3300046507 Ga0495606_0108881 Ga0495606_0108881_698_1393 231
269 3300046507 Ga0495606_0124610 Ga0495606_0124610_256_996 231
270 3300046512 Ga0495610_0000005 Ga0495610_0000005_911330_912055 231
271 3300046512 Ga0495610_0000500 Ga0495610_0000500_17097_17816 231
272 3300046512 Ga0495610_0026294 Ga0495610_0026294_658_1377 231
273 3300046519 Ga0495632_0001079 Ga0495632_0001079_16526_17248 231
274 3300046520 Ga0495637_0101469 Ga0495637_0101469_386_1105 231
275 3300046522 Ga0495643_0051819 Ga0495643_0051819_1380_2102 231
276 3300046522 Ga0495643_0151159 Ga0495643_0151159_329_1042 231
277 3300046525 Ga0495663_0000136 Ga0495663_0000136_14036_14779 231
278 3300046525 Ga0495663_0006297 Ga0495663_0006297_2550_3263 231
279 3300046530 Ga0495654_0000003 Ga0495654_0000003_106226_106951 231
280 3300046538 Ga0495609_0000003 Ga0495609_0000003_108519_109274 231
281 3300046558 Ga0495633_0000001 Ga0495633_0000001_181856_182578 231
282 3300046558 Ga0495633_0000454 Ga0495633_0000454_10437_11159 231
283 3300046558 Ga0495633_0017809 Ga0495633_0017809_565_1284 231
284 3300046660 Ga0495625_0000040 Ga0495625_0000040_173313_174035 231
285 3300046665 Ga0495661_0001872 Ga0495661_0001872_8083_8823 231
286 3300046665 Ga0495661_0015450 Ga0495661_0015450_1771_2490 231
287 3300046692 Ga0495671_0089832 Ga0495671_0089832_182_877 231
288 3300047443 Ga0495687_008710 Ga0495687_008710_1237_1956 231
289 3300047469 Ga0495673_0024700 Ga0495673_0024700_1719_2438 231
290 3300047472 Ga0495686_0000243 Ga0495686_0000243_68345_69067 231
291 3300047472 Ga0495686_0017718 Ga0495686_0017718_3270_3995 231
292 3300048903 Ga0496100_0776255 Ga0496100_0776255_12_728 231
293 3300048916 Ga0496113_0027638 Ga0496113_0027638_1961_2677 231
294 3300048918 Ga0496115_0102246 Ga0496115_0102246_1412_2107 231
295 3300048919 Ga0496116_0000068 Ga0496116_0000068_69533_70249 231
296 3300048920 Ga0496117_0000062 Ga0496117_0000062_67517_68233 231
297 3300048921 Ga0496118_0002099 Ga0496118_0002099_20591_21307 231
298 3300048922 Ga0496119_0000024 Ga0496119_0000024_67528_68244 231
299 3300048924 Ga0496121_0096300 Ga0496121_0096300_946_1641 231
300 3300048924 Ga0496121_0147493 Ga0496121_0147493_530_1246 231
301 3300048925 Ga0496122_0000171 Ga0496122_0000171_111726_112442 231
302 3300048925 Ga0496122_0002633 Ga0496122_0002633_6200_6916 231
303 3300048925 Ga0496122_0008794 Ga0496122_0008794_5253_5972 231
304 3300048926 Ga0496123_0000745 Ga0496123_0000745_18489_19205 231
305 3300048926 Ga0496123_0207867 Ga0496123_0207867_138_854 231
306 3300048928 Ga0496125_0000267 Ga0496125_0000267_53551_54246 231
307 3300048928 Ga0496125_0001677 Ga0496125_0001677_17392_18108 231
308 3300048928 Ga0496125_0029810 Ga0496125_0029810_3284_4000 231
309 3300048929 Ga0496126_0000495 Ga0496126_0000495_39608_40324 231
310 3300048929 Ga0496126_0020142 Ga0496126_0020142_881_1576 231
311 3300049569 Ga0501032_0349308 Ga0501032_0349308_40_753 231
312 3300049571 Ga0501034_0022764 Ga0501034_0022764_4871_5584 231
313 3300049574 Ga0501038_0305479 Ga0501038_0305479_115_828 231
314 3300049576 Ga0501040_0183049 Ga0501040_0183049_80_775 231
315 3300049586 Ga0501070_0048492 Ga0501070_0048492_1961_2674 231
316 3300049664 Ga0501224_020531 Ga0501224_020531_19_714 231
317 3300049671 Ga0501238_000038 Ga0501238_000038_12517_13212 231
318 3300049679 Ga0501249_000032 Ga0501249_000032_66934_67629 231
319 3300049679 Ga0501249_001297 Ga0501249_001297_3558_4253 231
320 3300049758 Ga0501241_000028 Ga0501241_000028_7525_8241 231
321 3300049763 Ga0501266_000003 Ga0501266_000003_207645_208340 231
322 3300049766 Ga0501269_000019 Ga0501269_000019_51969_52685 231
323 3300049766 Ga0501269_001759 Ga0501269_001759_1788_2483 231
324 3300049776 Ga0501280_000823 Ga0501280_000823_2640_3335 231
325 3300050493 nmdc:mga0k408_15724_c1 nmdc:mga0k408_15724_c1_230_946 231
326 3300053088 Ga0500644_0044811 Ga0500644_0044811_377_1072 231
327 3300053090 Ga0500646_0012847 Ga0500646_0012847_1067_1762 231
328 3300053096 Ga0500641_0000005 Ga0500641_0000005_191561_192256 231
329 3300053096 Ga0500641_0000106 Ga0500641_0000106_7793_8488 231
330 3300053118 Ga0500594_0045537 Ga0500594_0045537_309_1004 231
331 3300053134 Ga0500658_0000015 Ga0500658_0000015_120966_121661 231
332 3300053136 Ga0500559_0057033 Ga0500559_0057033_578_1273 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

179

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

109

212

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9241 2 216
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9195 2 217
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.9193 2 217
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9176 2 217
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.903 2 216
ID Description Score Start End Superfamily
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9135 2 216 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9085 2 224 3.40.50.300
af_Q55EH8_3_247_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9043 2 226 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9026 2 229 3.40.50.300
af_E7F3Y5_15_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9014 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A226HKR0-F1-model_v4 ATP-binding protein 1 1 231 GO:0005524
GO:0016887
AF-C0BL21-F1-model_v4 ABC transporter-related protein 0.9996 1 230 GO:0005524
GO:0016887
AF-C0BL21-F1-model_v4 ABC transporter-related protein 0.9909 1 230 GO:0005524
GO:0016887
AF-A0A368D1K3-F1-model_v4 ABC transporter ATP-binding protein 0.9897 30 231 GO:0005524
GO:0016887
AF-A0A1H3XBR7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9879 1 231 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
95.89 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map