F410933

General Info

Members Datasets Scaffolds Average Seq Length
332 180 664 127

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_12554790|Ga0105246_125547901
Length 146
Sequence VPYPEIESWLKSGITGGIMLPQFLLPETTVREAGTGADLEIGDHEGGTLILTLGITRIIEQESIDVSIWGSADGTEWGARPLLTFPQKFYCGTYQILLDLSDRPEVKYLRAKWAVNRWGKGDPKPLFTVYLFVQEMSRQLSAVGAA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.4
Metatranscriptomes 25.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 42.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_12554790 3300011119 Unclassified 504
2 Ga0006778J45830_1037287 3300003162 Unclassified 678
3 Ga0006770J48903_1030199 3300003305 Unclassified 589
4 Ga0006777J48905_1031076 3300003308 Unclassified 536
5 Ga0007417J51691_1023637 3300003544 Unclassified 584
6 Ga0007410J51695_1030686 3300003574 Unclassified 556
7 Ga0007409J51694_1044490 3300003575 Unclassified 571
8 Ga0007416J51690_1033305 3300003577 Unclassified 568
9 Ga0007429J51699_1043152 3300003579 Unclassified 621
10 Ga0032354_1043362 3300003693 Unclassified 540
11 Ga0032354_1091262 3300003693 Unclassified 639
12 Ga0006780_1038952 3300003735 Unclassified 595
13 Ga0058858_1321187 3300004785 Unclassified 556
14 Ga0058859_11221988 3300004798 Unclassified 561
15 Ga0058859_11681501 3300004798 Bacteria 740
16 Ga0058859_11696555 3300004798 Unclassified 602
17 Ga0058863_10030668 3300004799 Bacteria 635
18 Ga0058863_11585906 3300004799 Bacteria 713
19 Ga0058861_11553600 3300004800 Unclassified 544
20 Ga0058861_11634086 3300004800 Bacteria 614
21 Ga0058861_11663860 3300004800 Unclassified 537
22 Ga0058861_11676370 3300004800 Bacteria 657
23 Ga0058861_11694126 3300004800 Bacteria 856
24 Ga0058861_11878654 3300004800 Unclassified 624
25 Ga0058861_11894300 3300004800 Unclassified 556
26 Ga0058861_12020851 3300004800 Unclassified 527
27 Ga0058860_11656635 3300004801 Unclassified 670
28 Ga0058860_11952772 3300004801 Bacteria 640
29 Ga0058860_11981391 3300004801 Unclassified 562
30 Ga0058862_12273786 3300004803 Bacteria 1305
31 Ga0058862_12282725 3300004803 Bacteria 693
32 Ga0058862_12523177 3300004803 Unclassified 784
33 Ga0058862_12809908 3300004803 Unclassified 560
34 Ga0058862_12816631 3300004803 Bacteria 688
35 Ga0058862_12884353 3300004803 Unclassified 585
36 Ga0070683_100000039 3300005329 Bacteria 119209
37 Ga0070670_100486246 3300005331 Bacteria 1097
38 Ga0068869_101562423 3300005334 Unclassified 587
39 Ga0068869_101790849 3300005334 Unclassified 549
40 Ga0070680_100175311 3300005336 Bacteria 1805
41 Ga0068868_100331340 3300005338 Unclassified 1299
42 Ga0068868_100449789 3300005338 Unclassified 1120
43 Ga0070689_100306700 3300005340 Bacteria 1323
44 Ga0070689_100471541 3300005340 Bacteria 1071
45 Ga0070687_100541854 3300005343 Bacteria 790
46 Ga0070661_101317537 3300005344 Unclassified 606
47 Ga0070671_100534028 3300005355 Bacteria 1011
48 Ga0070673_100555041 3300005364 Bacteria 1044
49 Ga0070688_100324289 3300005365 Bacteria 1120
50 Ga0070667_101268310 3300005367 Bacteria 690
51 Ga0070667_101493411 3300005367 Bacteria 635
52 Ga0070709_10030876 3300005434 Bacteria 3219
53 Ga0070714_100015658 3300005435 Bacteria 6105
54 Ga0070714_100921142 3300005435 Bacteria 849
55 Ga0070714_101749926 3300005435 Unclassified 607
56 Ga0070713_100038321 3300005436 Unclassified 3883
57 Ga0070713_100245058 3300005436 Bacteria 1633
58 Ga0070713_101840975 3300005436 Unclassified 587
59 Ga0070710_10270358 3300005437 Unclassified 1099
60 Ga0070711_100010044 3300005439 Bacteria 5844
61 Ga0070705_100160610 3300005440 Unclassified 1502
62 Ga0070678_101090209 3300005456 Bacteria 737
63 Ga0070681_10214943 3300005458 Bacteria 1839
64 Ga0068867_100254546 3300005459 Bacteria 1429
65 Ga0070685_10236014 3300005466 Bacteria 1205
66 Ga0070707_100770122 3300005468 Bacteria 926
67 Ga0070698_100680171 3300005471 Bacteria 971
68 Ga0070679_100395037 3300005530 Bacteria 1329
69 Ga0070684_100000027 3300005535 Bacteria 119209
70 Ga0070684_100128925 3300005535 Bacteria 2281
71 Ga0070684_100148402 3300005535 Bacteria 2123
72 Ga0070684_100202785 3300005535 Bacteria 1807
73 Ga0070684_100667406 3300005535 Unclassified 968
74 Ga0070684_100940463 3300005535 Unclassified 810
75 Ga0070686_101806603 3300005544 Unclassified 520
76 Ga0070695_100093706 3300005545 Unclassified 2010
77 Ga0070696_100002088 3300005546 Bacteria 13130
78 Ga0070665_100225581 3300005548 Bacteria 1874
79 Ga0070665_100351246 3300005548 Bacteria 1480
80 Ga0070665_100581251 3300005548 Unclassified 1133
81 Ga0068857_102269599 3300005577 Bacteria 533
82 Ga0068852_100281005 3300005616 Bacteria 1605
83 Ga0068852_101463576 3300005616 Unclassified 705
84 Ga0068859_100206198 3300005617 Bacteria 2051
85 Ga0068859_100542299 3300005617 Bacteria 1258
86 Ga0068859_101156026 3300005617 Bacteria 852
87 Ga0068859_101625967 3300005617 Unclassified 713
88 Ga0068864_100285754 3300005618 Bacteria 1541
89 Ga0068864_100389280 3300005618 Bacteria 1323
90 Ga0068863_101119868 3300005841 Unclassified 792
91 Ga0068863_101484753 3300005841 Unclassified 686
92 Ga0068858_101733391 3300005842 Bacteria 617
93 Ga0068858_101945205 3300005842 Unclassified 581
94 Ga0068860_100749736 3300005843 Bacteria 988
95 Ga0070717_10059399 3300006028 Bacteria 3164
96 Ga0070717_10107259 3300006028 Bacteria 2379
97 Ga0070717_10351424 3300006028 Bacteria 1318
98 Ga0097621_100252862 3300006237 Bacteria 1543
99 Ga0097621_101341788 3300006237 Bacteria 676
100 Ga0068871_100481315 3300006358 Bacteria 1116
101 Ga0068871_101567382 3300006358 Unclassified 623
102 Ga0075430_100691969 3300006846 Unclassified 840
103 Ga0068865_101552466 3300006881 Bacteria 594
104 Ga0068865_101660013 3300006881 Unclassified 575
105 Ga0097620_100206192 3300006931 Bacteria 2051
106 Ga0097620_100542310 3300006931 Bacteria 1258
107 Ga0097620_101156221 3300006931 Bacteria 852
108 Ga0097620_101626017 3300006931 Unclassified 713
109 Ga0105240_10053055 3300009093 Bacteria 5093
110 Ga0105247_10665983 3300009101 Unclassified 779
111 Ga0105241_10598603 3300009174 Bacteria 996
112 Ga0105241_10757587 3300009174 Bacteria 891
113 Ga0105242_10857154 3300009176 Bacteria 904
114 Ga0105242_10995696 3300009176 Bacteria 845
115 Ga0105242_11059850 3300009176 Bacteria 822
116 Ga0105242_11833270 3300009176 Bacteria 646
117 Ga0105248_10272333 3300009177 Bacteria 1906
118 Ga0105248_10407164 3300009177 Bacteria 1532
119 Ga0105248_10708064 3300009177 Bacteria 1136
120 Ga0105248_11264431 3300009177 Bacteria 835
121 Ga0105237_10015334 3300009545 Bacteria 7981
122 Ga0105237_10458988 3300009545 Bacteria 1280
123 Ga0105237_11175566 3300009545 Unclassified 774
124 Ga0105237_11849185 3300009545 Unclassified 612
125 Ga0105238_10260866 3300009551 Bacteria 1712
126 Ga0105238_10581237 3300009551 Bacteria 1127
127 Ga0105239_10116101 3300010375 Unclassified 2970
128 Ga0157370_10478372 3300013104 Unclassified 1144
129 Ga0157370_11395241 3300013104 Bacteria 630
130 Ga0157369_10105839 3300013105 Bacteria 2994
131 Ga0157369_10193850 3300013105 Bacteria 2134
132 Ga0157369_11849606 3300013105 Unclassified 613
133 Ga0157374_10337907 3300013296 Bacteria 1495
134 Ga0157374_10787224 3300013296 Bacteria 966
135 Ga0157374_11798342 3300013296 Unclassified 638
136 Ga0157378_11298153 3300013297 Unclassified 769
137 Ga0163162_10545543 3300013306 Bacteria 1288
138 Ga0163162_11366335 3300013306 Bacteria 806
139 Ga0163162_11869260 3300013306 Bacteria 687
140 Ga0157372_10036674 3300013307 Bacteria 5404
141 Ga0157372_11048893 3300013307 Unclassified 944
142 Ga0157372_11608167 3300013307 Bacteria 748
143 Ga0157375_10160455 3300013308 Bacteria 2390
144 Ga0157375_11558441 3300013308 Bacteria 781
145 Ga0157375_11569903 3300013308 Bacteria 778
146 Ga0163163_10032848 3300014325 Bacteria 5015
147 Ga0163163_10351590 3300014325 Unclassified 1530
148 Ga0163163_10563772 3300014325 Bacteria 1202
149 Ga0163163_10953226 3300014325 Bacteria 921
150 Ga0163163_11993613 3300014325 Unclassified 640
151 Ga0157379_10216492 3300014968 Bacteria 1735
152 Ga0157376_10002513 3300014969 Bacteria 12431
153 Ga0157376_10069113 3300014969 Bacteria 2993
154 Ga0157376_10141879 3300014969 Bacteria 2156
155 Ga0157376_10636371 3300014969 Bacteria 1065
156 Ga0157376_11814279 3300014969 Unclassified 646
157 Ga0157376_12759240 3300014969 Unclassified 531
158 Ga0163161_10998755 3300017792 Unclassified 714
159 Ga0163161_11075625 3300017792 Unclassified 690
160 Ga0197907_10518191 3300020069 Unclassified 510
161 Ga0197907_10632273 3300020069 Unclassified 523
162 Ga0197907_10862370 3300020069 Unclassified 870
163 Ga0197907_10910544 3300020069 Bacteria 877
164 Ga0197907_10934271 3300020069 Bacteria 786
165 Ga0197907_11305510 3300020069 Unclassified 515
166 Ga0206356_10354316 3300020070 Unclassified 509
167 Ga0206356_10558598 3300020070 Unclassified 536
168 Ga0206356_10761569 3300020070 Unclassified 575
169 Ga0206356_11651142 3300020070 Bacteria 648
170 Ga0206356_11751056 3300020070 Unclassified 647
171 Ga0206356_11771230 3300020070 Unclassified 796
172 Ga0206349_1105546 3300020075 Unclassified 607
173 Ga0206355_1029909 3300020076 Unclassified 535
174 Ga0206355_1287567 3300020076 Bacteria 643
175 Ga0206355_1531760 3300020076 Unclassified 628
176 Ga0206351_10462493 3300020077 Unclassified 659
177 Ga0206352_10067798 3300020078 Unclassified 556
178 Ga0206352_10456337 3300020078 Bacteria 558
179 Ga0206352_10480346 3300020078 Bacteria 782
180 Ga0206352_10516400 3300020078 Unclassified 593
181 Ga0206352_10592464 3300020078 Unclassified 979
182 Ga0206352_10708447 3300020078 Bacteria 949
183 Ga0206352_10736598 3300020078 Unclassified 507
184 Ga0206350_11409542 3300020080 Unclassified 567
185 Ga0206354_10111828 3300020081 Unclassified 508
186 Ga0206354_11244565 3300020081 Unclassified 513
187 Ga0206353_10512181 3300020082 Unclassified 735
188 Ga0206353_10874207 3300020082 Unclassified 862
189 Ga0206353_11143060 3300020082 Unclassified 511
190 Ga0206353_12051758 3300020082 Bacteria 626
191 Ga0154015_1324229 3300020610 Unclassified 720
192 Ga0154015_1470264 3300020610 Unclassified 513
193 Ga0224712_10067354 3300022467 Bacteria 1444
194 Ga0224712_10219199 3300022467 Unclassified 870
195 Ga0224712_10289556 3300022467 Unclassified 764
196 Ga0224712_10526696 3300022467 Unclassified 573
197 Ga0224712_10652077 3300022467 Unclassified 516
198 Ga0224712_10659016 3300022467 Bacteria 513
199 Ga0224572_1009416 3300024225 Bacteria 1822
200 Ga0228598_1000162 3300024227 Bacteria 11846
201 Ga0207692_10339132 3300025898 Bacteria 924
202 Ga0207680_10173495 3300025903 Bacteria 1454
203 Ga0207699_10021322 3300025906 Bacteria 3490
204 Ga0207643_10204909 3300025908 Bacteria 1202
205 Ga0207707_10354124 3300025912 Bacteria 1264
206 Ga0207695_10005952 3300025913 Bacteria 15960
207 Ga0207695_10045155 3300025913 Bacteria 4680
208 Ga0207671_10248486 3300025914 Unclassified 1398
209 Ga0207663_10007697 3300025916 Bacteria 5604
210 Ga0207660_10157151 3300025917 Bacteria 1751
211 Ga0207652_10957310 3300025921 Unclassified 754
212 Ga0207646_10526471 3300025922 Bacteria 1064
213 Ga0207694_10177320 3300025924 Bacteria 1727
214 Ga0207694_11025440 3300025924 Bacteria 698
215 Ga0207700_10007567 3300025928 Bacteria 6655
216 Ga0207700_10802987 3300025928 Bacteria 842
217 Ga0207664_10011128 3300025929 Bacteria 6377
218 Ga0207664_11276042 3300025929 Bacteria 654
219 Ga0207686_10939692 3300025934 Unclassified 699
220 Ga0207670_10307249 3300025936 Bacteria 1244
221 Ga0207691_10733269 3300025940 Bacteria 832
222 Ga0207711_10032406 3300025941 Bacteria 4419
223 Ga0207711_10628238 3300025941 Bacteria 1002
224 Ga0207711_10655977 3300025941 Bacteria 979
225 Ga0207711_11398188 3300025941 Unclassified 642
226 Ga0207689_11330506 3300025942 Unclassified 603
227 Ga0207661_10000043 3300025944 Bacteria 119208
228 Ga0207661_10663313 3300025944 Unclassified 959
229 Ga0207651_10774330 3300025960 Unclassified 849
230 Ga0207703_11876309 3300026035 Unclassified 575
231 Ga0207702_11026864 3300026078 Bacteria 818
232 Ga0207641_10121694 3300026088 Bacteria 2330
233 Ga0207641_10302207 3300026088 Unclassified 1512
234 Ga0207641_12373636 3300026088 Unclassified 529
235 Ga0207676_10192765 3300026095 Bacteria 1795
236 Ga0207676_10346224 3300026095 Bacteria 1373
237 Ga0207683_10185323 3300026121 Bacteria 1888
238 Ga0207683_11967557 3300026121 Unclassified 533
239 Ga0268266_10258474 3300028379 Bacteria 1613
240 Ga0268266_10825050 3300028379 Unclassified 896
241 Ga0265323_10000246 3300028653 Bacteria 31656
242 Ga0265338_10161226 3300028800 Bacteria 1732
243 Ga0265762_1083617 3300030760 Unclassified 687
244 Ga0265762_1106179 3300030760 Unclassified 628
245 Ga0265777_103466 3300030877 Bacteria 969
246 Ga0265776_101493 3300030880 Unclassified 1001
247 Ga0265772_106532 3300030886 Unclassified 538
248 Ga0265330_10145907 3300031235 Unclassified 1006
249 Ga0265330_10523731 3300031235 Unclassified 505
250 Ga0265325_10281491 3300031241 Bacteria 746
251 Ga0265329_10206736 3300031242 Bacteria 647
252 Ga0265339_10395409 3300031249 Unclassified 646
253 Ga0265339_10401470 3300031249 Bacteria 640
254 Ga0265331_10013985 3300031250 Bacteria 4293
255 Ga0265331_10033806 3300031250 Bacteria 2527
256 Ga0265316_10006475 3300031344 Bacteria 11174
257 Ga0265316_10035583 3300031344 Bacteria 4034
258 Ga0265316_10159262 3300031344 Unclassified 1688
259 Ga0265316_10195032 3300031344 Bacteria 1503
260 Ga0265316_10600809 3300031344 Unclassified 780
261 Ga0265342_10659600 3300031712 Unclassified 525
262 Ga0373953_0188944 3300035117 Bacteria 889
263 Ga0373954_0227550 3300035118 Unclassified 918
264 Ga0373957_0185083 3300035120 Bacteria 864
265 Ga0373924_0520093 3300035410 Unclassified 535
266 Ga0373935_0005236 3300035692 Bacteria 7639
267 Ga0373935_0988952 3300035692 Unclassified 625
268 Ga0373927_0265465 3300035695 Bacteria 1129
269 Ga0373927_0790691 3300035695 Unclassified 627
270 Ga0373933_0587766 3300035724 Unclassified 731
271 Ga0373947_0116979 3300035725 Unclassified 1691
272 Ga0373937_0003732 3300036401 Bacteria 12871
273 Ga0373937_0171055 3300036401 Bacteria 2039
274 Ga0373937_0204311 3300036401 Bacteria 1858
275 Ga0373925_0125956 3300037068 Unclassified 1993
276 Ga0451577_0135068 3300042876 Bacteria 2215
277 Ga0451576_0024794 3300045051 Bacteria 6473
278 Ga0451576_0287546 3300045051 Bacteria 1719
279 Ga0451576_0896279 3300045051 Bacteria 931
280 Ga0451576_0931262 3300045051 Unclassified 911
281 Ga0495629_0587298 3300046459 Unclassified 746
282 Ga0495580_0004640 3300046472 Bacteria 11531
283 Ga0495580_0008148 3300046472 Bacteria 8349
284 Ga0495580_0093613 3300046472 Archaea 2091
285 Ga0495582_0160827 3300046473 Bacteria 1277
286 Ga0495639_0152311 3300046475 Bacteria 1116
287 Ga0495664_0092791 3300046477 Bacteria 1816
288 Ga0495585_0511259 3300046492 Unclassified 570
289 Ga0495594_0379503 3300046499 Unclassified 804
290 Ga0495608_0673190 3300046511 Bacteria 617
291 Ga0495628_0087059 3300046516 Bacteria 2422
292 Ga0495665_0108279 3300046531 Bacteria 1458
293 Ga0495665_0193197 3300046531 Bacteria 1056
294 Ga0495645_0058893 3300046543 Bacteria 2786
295 Ga0495645_0467073 3300046543 Bacteria 794
296 Ga0495645_0600897 3300046543 Unclassified 677
297 Ga0495667_0140213 3300046559 Bacteria 1558
298 Ga0495635_0184700 3300046663 Bacteria 1417
299 Ga0495635_0522417 3300046663 Bacteria 780
300 Ga0495635_0621638 3300046663 Unclassified 704
301 Ga0495657_0782216 3300046675 Unclassified 546
302 Ga0495599_0153931 3300046678 Bacteria 1423
303 Ga0495599_0339379 3300046678 Bacteria 902
304 Ga0495623_0055251 3300046679 Bacteria 2504
305 Ga0495658_0558338 3300046683 Bacteria 733
306 Ga0495669_0186715 3300046684 Unclassified 989
307 Ga0495581_0539772 3300047315 Unclassified 677
308 Ga0495674_0071919 3300047319 Bacteria 2984
309 Ga0495674_0112822 3300047319 Bacteria 2303
310 Ga0495674_0707392 3300047319 Unclassified 790
311 Ga0495675_0154335 3300047444 Bacteria 1417
312 Ga0495675_0228082 3300047444 Bacteria 1125
313 Ga0495675_0478765 3300047444 Bacteria 717
314 Ga0495675_0503755 3300047444 Bacteria 695
315 Ga0495684_0138338 3300047471 Unclassified 1827
316 Ga0495684_0256751 3300047471 Bacteria 1269
317 Ga0495684_0270451 3300047471 Bacteria 1230
318 Ga0495593_0135474 3300047673 Bacteria 1249
319 Ga0495602_0368577 3300048088 Bacteria 1032
320 Ga0495602_0494755 3300048088 Bacteria 856
321 Ga0496112_0672768 3300048915 Bacteria 964
322 nmdc:mga0qj67_640500_c1 3300050509 Unclassified 848
323 Ga0495612_0496378 3300053078 Unclassified 560
324 Ga0495619_0315929 3300053085 Bacteria 1082
325 Ga0587084_118116 3300059477 Unclassified 555
326 Ga0587066_164232 3300059490 Unclassified 560
327 Ga0587077_260607 3300059493 Unclassified 505
328 Ga0587091_191795 3300059511 Unclassified 544
329 Ga0587072_118990 3300059643 Unclassified 610
330 Ga0587075_081011 3300059644 Unclassified 619
331 Ga0587071_131846 3300060344 Bacteria 606
332 Ga0501082_0000716 3300060353 Bacteria 29168
333 Ga0105246_12554790
334 Ga0006778J45830_1037287
335 Ga0006770J48903_1030199
336 Ga0006777J48905_1031076
337 Ga0007417J51691_1023637
338 Ga0007410J51695_1030686
339 Ga0007409J51694_1044490
340 Ga0007416J51690_1033305
341 Ga0007429J51699_1043152
342 Ga0032354_1043362
343 Ga0032354_1091262
344 Ga0006780_1038952
345 Ga0058858_1321187
346 Ga0058859_11221988
347 Ga0058859_11681501
348 Ga0058859_11696555
349 Ga0058863_10030668
350 Ga0058863_11585906
351 Ga0058861_11553600
352 Ga0058861_11634086
353 Ga0058861_11663860
354 Ga0058861_11676370
355 Ga0058861_11694126
356 Ga0058861_11878654
357 Ga0058861_11894300
358 Ga0058861_12020851
359 Ga0058860_11656635
360 Ga0058860_11952772
361 Ga0058860_11981391
362 Ga0058862_12273786
363 Ga0058862_12282725
364 Ga0058862_12523177
365 Ga0058862_12809908
366 Ga0058862_12816631
367 Ga0058862_12884353
368 Ga0070683_100000039
369 Ga0070670_100486246
370 Ga0068869_101562423
371 Ga0068869_101790849
372 Ga0070680_100175311
373 Ga0068868_100331340
374 Ga0068868_100449789
375 Ga0070689_100306700
376 Ga0070689_100471541
377 Ga0070687_100541854
378 Ga0070661_101317537
379 Ga0070671_100534028
380 Ga0070673_100555041
381 Ga0070688_100324289
382 Ga0070667_101268310
383 Ga0070667_101493411
384 Ga0070709_10030876
385 Ga0070714_100015658
386 Ga0070714_100921142
387 Ga0070714_101749926
388 Ga0070713_100038321
389 Ga0070713_100245058
390 Ga0070713_101840975
391 Ga0070710_10270358
392 Ga0070711_100010044
393 Ga0070705_100160610
394 Ga0070678_101090209
395 Ga0070681_10214943
396 Ga0068867_100254546
397 Ga0070685_10236014
398 Ga0070707_100770122
399 Ga0070698_100680171
400 Ga0070679_100395037
401 Ga0070684_100000027
402 Ga0070684_100128925
403 Ga0070684_100148402
404 Ga0070684_100202785
405 Ga0070684_100667406
406 Ga0070684_100940463
407 Ga0070686_101806603
408 Ga0070695_100093706
409 Ga0070696_100002088
410 Ga0070665_100225581
411 Ga0070665_100351246
412 Ga0070665_100581251
413 Ga0068857_102269599
414 Ga0068852_100281005
415 Ga0068852_101463576
416 Ga0068859_100206198
417 Ga0068859_100542299
418 Ga0068859_101156026
419 Ga0068859_101625967
420 Ga0068864_100285754
421 Ga0068864_100389280
422 Ga0068863_101119868
423 Ga0068863_101484753
424 Ga0068858_101733391
425 Ga0068858_101945205
426 Ga0068860_100749736
427 Ga0070717_10059399
428 Ga0070717_10107259
429 Ga0070717_10351424
430 Ga0097621_100252862
431 Ga0097621_101341788
432 Ga0068871_100481315
433 Ga0068871_101567382
434 Ga0075430_100691969
435 Ga0068865_101552466
436 Ga0068865_101660013
437 Ga0097620_100206192
438 Ga0097620_100542310
439 Ga0097620_101156221
440 Ga0097620_101626017
441 Ga0105240_10053055
442 Ga0105247_10665983
443 Ga0105241_10598603
444 Ga0105241_10757587
445 Ga0105242_10857154
446 Ga0105242_10995696
447 Ga0105242_11059850
448 Ga0105242_11833270
449 Ga0105248_10272333
450 Ga0105248_10407164
451 Ga0105248_10708064
452 Ga0105248_11264431
453 Ga0105237_10015334
454 Ga0105237_10458988
455 Ga0105237_11175566
456 Ga0105237_11849185
457 Ga0105238_10260866
458 Ga0105238_10581237
459 Ga0105239_10116101
460 Ga0157370_10478372
461 Ga0157370_11395241
462 Ga0157369_10105839
463 Ga0157369_10193850
464 Ga0157369_11849606
465 Ga0157374_10337907
466 Ga0157374_10787224
467 Ga0157374_11798342
468 Ga0157378_11298153
469 Ga0163162_10545543
470 Ga0163162_11366335
471 Ga0163162_11869260
472 Ga0157372_10036674
473 Ga0157372_11048893
474 Ga0157372_11608167
475 Ga0157375_10160455
476 Ga0157375_11558441
477 Ga0157375_11569903
478 Ga0163163_10032848
479 Ga0163163_10351590
480 Ga0163163_10563772
481 Ga0163163_10953226
482 Ga0163163_11993613
483 Ga0157379_10216492
484 Ga0157376_10002513
485 Ga0157376_10069113
486 Ga0157376_10141879
487 Ga0157376_10636371
488 Ga0157376_11814279
489 Ga0157376_12759240
490 Ga0163161_10998755
491 Ga0163161_11075625
492 Ga0197907_10518191
493 Ga0197907_10632273
494 Ga0197907_10862370
495 Ga0197907_10910544
496 Ga0197907_10934271
497 Ga0197907_11305510
498 Ga0206356_10354316
499 Ga0206356_10558598
500 Ga0206356_10761569
501 Ga0206356_11651142
502 Ga0206356_11751056
503 Ga0206356_11771230
504 Ga0206349_1105546
505 Ga0206355_1029909
506 Ga0206355_1287567
507 Ga0206355_1531760
508 Ga0206351_10462493
509 Ga0206352_10067798
510 Ga0206352_10456337
511 Ga0206352_10480346
512 Ga0206352_10516400
513 Ga0206352_10592464
514 Ga0206352_10708447
515 Ga0206352_10736598
516 Ga0206350_11409542
517 Ga0206354_10111828
518 Ga0206354_11244565
519 Ga0206353_10512181
520 Ga0206353_10874207
521 Ga0206353_11143060
522 Ga0206353_12051758
523 Ga0154015_1324229
524 Ga0154015_1470264
525 Ga0224712_10067354
526 Ga0224712_10219199
527 Ga0224712_10289556
528 Ga0224712_10526696
529 Ga0224712_10652077
530 Ga0224712_10659016
531 Ga0224572_1009416
532 Ga0228598_1000162
533 Ga0207692_10339132
534 Ga0207680_10173495
535 Ga0207699_10021322
536 Ga0207643_10204909
537 Ga0207707_10354124
538 Ga0207695_10005952
539 Ga0207695_10045155
540 Ga0207671_10248486
541 Ga0207663_10007697
542 Ga0207660_10157151
543 Ga0207652_10957310
544 Ga0207646_10526471
545 Ga0207694_10177320
546 Ga0207694_11025440
547 Ga0207700_10007567
548 Ga0207700_10802987
549 Ga0207664_10011128
550 Ga0207664_11276042
551 Ga0207686_10939692
552 Ga0207670_10307249
553 Ga0207691_10733269
554 Ga0207711_10032406
555 Ga0207711_10628238
556 Ga0207711_10655977
557 Ga0207711_11398188
558 Ga0207689_11330506
559 Ga0207661_10000043
560 Ga0207661_10663313
561 Ga0207651_10774330
562 Ga0207703_11876309
563 Ga0207702_11026864
564 Ga0207641_10121694
565 Ga0207641_10302207
566 Ga0207641_12373636
567 Ga0207676_10192765
568 Ga0207676_10346224
569 Ga0207683_10185323
570 Ga0207683_11967557
571 Ga0268266_10258474
572 Ga0268266_10825050
573 Ga0265323_10000246
574 Ga0265338_10161226
575 Ga0265762_1083617
576 Ga0265762_1106179
577 Ga0265777_103466
578 Ga0265776_101493
579 Ga0265772_106532
580 Ga0265330_10145907
581 Ga0265330_10523731
582 Ga0265325_10281491
583 Ga0265329_10206736
584 Ga0265339_10395409
585 Ga0265339_10401470
586 Ga0265331_10013985
587 Ga0265331_10033806
588 Ga0265316_10006475
589 Ga0265316_10035583
590 Ga0265316_10159262
591 Ga0265316_10195032
592 Ga0265316_10600809
593 Ga0265342_10659600
594 Ga0373953_0188944
595 Ga0373954_0227550
596 Ga0373957_0185083
597 Ga0373924_0520093
598 Ga0373935_0005236
599 Ga0373935_0988952
600 Ga0373927_0265465
601 Ga0373927_0790691
602 Ga0373933_0587766
603 Ga0373947_0116979
604 Ga0373937_0003732
605 Ga0373937_0171055
606 Ga0373937_0204311
607 Ga0373925_0125956
608 Ga0451577_0135068
609 Ga0451576_0024794
610 Ga0451576_0287546
611 Ga0451576_0896279
612 Ga0451576_0931262
613 Ga0495629_0587298
614 Ga0495580_0004640
615 Ga0495580_0008148
616 Ga0495580_0093613
617 Ga0495582_0160827
618 Ga0495639_0152311
619 Ga0495664_0092791
620 Ga0495585_0511259
621 Ga0495594_0379503
622 Ga0495608_0673190
623 Ga0495628_0087059
624 Ga0495665_0108279
625 Ga0495665_0193197
626 Ga0495645_0058893
627 Ga0495645_0467073
628 Ga0495645_0600897
629 Ga0495667_0140213
630 Ga0495635_0184700
631 Ga0495635_0522417
632 Ga0495635_0621638
633 Ga0495657_0782216
634 Ga0495599_0153931
635 Ga0495599_0339379
636 Ga0495623_0055251
637 Ga0495658_0558338
638 Ga0495669_0186715
639 Ga0495581_0539772
640 Ga0495674_0071919
641 Ga0495674_0112822
642 Ga0495674_0707392
643 Ga0495675_0154335
644 Ga0495675_0228082
645 Ga0495675_0478765
646 Ga0495675_0503755
647 Ga0495684_0138338
648 Ga0495684_0256751
649 Ga0495684_0270451
650 Ga0495593_0135474
651 Ga0495602_0368577
652 Ga0495602_0494755
653 Ga0496112_0672768
654 nmdc:mga0qj67_640500_c1
655 Ga0495612_0496378
656 Ga0495619_0315929
657 Ga0587084_118116
658 Ga0587066_164232
659 Ga0587077_260607
660 Ga0587091_191795
661 Ga0587072_118990
662 Ga0587075_081011
663 Ga0587071_131846
664 Ga0501082_0000716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wce-assembly1.cif.gz_B crystal structure of the t13 ibdv viral particle reveals a missing link in icosahedral viruses evolution 0.6661 2 118
4w8j-assembly1.cif.gz_A-2 structure of the full-length insecticidal protein cry1ac reveals intriguing details of toxin packaging into in vivo formed crystals 0.6654 11 120
7vrn-assembly1.cif.gz_A structure of infectious bursal disease virus gt strain 0.6576 2 115
2df7-assembly1.cif.gz_P crystal structure of infectious bursal disease virus vp2 subviral particle 0.6439 2 115
2gsy-assembly1.cif.gz_A the 2.6a structure of infectious bursal virus derived t=1 particles 0.6423 2 118
ID Description Score Start End Superfamily
af_B8A5M7_1_464_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7106 9 118 2.60.120.260
af_Q59ZG1_17_112_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.6743 8 116 2.60.120.680
af_O13946_21_209_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6637 1 124 3.30.40.10
af_Q20196_1_163_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6636 7 120 2.60.120.430
af_Q19040_404_518_2.60.120.290 Mainly Beta;Sandwich;Jelly Rolls;Spermadhesin, CUB domain 0.6524 9 119 2.60.120.290
ID Description Score Start End GO Terms
AF-A0A2V8VII0-F1-model_v4 Uncharacterized protein 0.9912 1 91
AF-A0A2V9KQI8-F1-model_v4 Uncharacterized protein 0.9897 3 119
AF-A0A2V9J882-F1-model_v4 Uncharacterized protein 0.9827 2 121
AF-A0A2V9LNK3-F1-model_v4 Uncharacterized protein 0.97 3 119
AF-A0A2V8VII0-F1-model_v4 Uncharacterized protein 0.97 1 91

Map