F410848

General Info

Members Datasets Scaffolds Average Seq Length
332 166 664 219

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100024220|Ga0070706_1000242207
Length 225
Sequence MNFIIVGCGRVGAELAYRMFKSGHRIVVVDSNKEAFNRLHPDFRGRTLEGEGLAESVLERAGIKEAHGLAAVTNSDTLNAVVAHTARAFYNVPVVVARNYDPSLRMVIEAFGLQTVSSTYWGAQRVEELLTNPSEKMVYSAGNGEVEVYEVVISEAWNGRTLSELLGSLEQCYPVAITRAGRSSLPEATMQLQTGDVLNVSSTFEGIGALSSRLASNSKDKKAEA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 0.3
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 31.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100024220 3300005467 Bacteria 5587
2 SwRhRL2b_contig_1033251 2162886007 Bacteria 14331
3 JGI25406J46586_10001015 3300003203 Bacteria 13153
4 Ga0065704_10012577 3300005289 Unclassified 2503
5 Ga0065704_10070402 3300005289 Bacteria 26643
6 Ga0065715_10015290 3300005293 Bacteria 1828
7 Ga0065707_10082149 3300005295 Bacteria 20712
8 Ga0065707_10087037 3300005295 Bacteria 5197
9 Ga0065707_10099026 3300005295 Bacteria 3027
10 Ga0065707_10130045 3300005295 Unclassified 1935
11 Ga0070676_10060614 3300005328 Bacteria 2248
12 Ga0070690_100053498 3300005330 Bacteria 2582
13 Ga0068869_100072891 3300005334 Bacteria 2545
14 Ga0068869_100892162 3300005334 Bacteria 769
15 Ga0068868_100015724 3300005338 Bacteria 5605
16 Ga0070689_100068774 3300005340 Unclassified 2762
17 Ga0070689_100083549 3300005340 Bacteria 2509
18 Ga0070687_100050432 3300005343 Bacteria 2149
19 Ga0070692_10100654 3300005345 Unclassified 1583
20 Ga0070668_100021500 3300005347 Bacteria 4874
21 Ga0070674_100003035 3300005356 Bacteria 9339
22 Ga0070673_100019854 3300005364 Bacteria 4834
23 Ga0070688_100002509 3300005365 Bacteria 9281
24 Ga0070659_100158476 3300005366 Bacteria 1850
25 Ga0070667_100091232 3300005367 Bacteria 2620
26 Ga0070703_10079591 3300005406 Unclassified 1113
27 Ga0070701_10137526 3300005438 Unclassified 1394
28 Ga0070705_100007833 3300005440 Bacteria 5276
29 Ga0070705_100076496 3300005440 Bacteria 2041
30 Ga0070700_100126284 3300005441 Bacteria 1720
31 Ga0070700_100196100 3300005441 Unclassified 1415
32 Ga0070694_100051955 3300005444 Bacteria 2769
33 Ga0070694_100096887 3300005444 Unclassified 2080
34 Ga0070694_100124797 3300005444 Bacteria 1852
35 Ga0070708_100065548 3300005445 Bacteria 3257
36 Ga0070663_100014173 3300005455 Bacteria 5111
37 Ga0070662_100220032 3300005457 Unclassified 1515
38 Ga0068867_100014382 3300005459 Bacteria 5607
39 Ga0070685_10174453 3300005466 Unclassified 1380
40 Ga0070706_100011258 3300005467 Bacteria 8307
41 Ga0070706_100348659 3300005467 Unclassified 1380
42 Ga0070706_100711363 3300005467 Unclassified 931
43 Ga0070707_100028571 3300005468 Bacteria 5309
44 Ga0070707_100170528 3300005468 Bacteria 2121
45 Ga0070707_100401330 3300005468 Unclassified 1331
46 Ga0070698_100004210 3300005471 Bacteria 15812
47 Ga0070698_100065401 3300005471 Bacteria 3661
48 Ga0070698_100303795 3300005471 Bacteria 1526
49 Ga0070699_100025951 3300005518 Bacteria 5053
50 Ga0070699_100038062 3300005518 Bacteria 4165
51 Ga0070699_100093526 3300005518 Bacteria 2631
52 Ga0070699_100184954 3300005518 Bacteria 1850
53 Ga0070699_100243604 3300005518 Unclassified 1605
54 Ga0070699_100311929 3300005518 Bacteria 1412
55 Ga0070672_100020205 3300005543 Bacteria 4852
56 Ga0070686_100011661 3300005544 Bacteria 4992
57 Ga0070695_100066847 3300005545 Unclassified 2344
58 Ga0070696_100005760 3300005546 Bacteria 8271
59 Ga0070696_100310638 3300005546 Unclassified 1210
60 Ga0070665_101055429 3300005548 Bacteria 824
61 Ga0070704_100011451 3300005549 Bacteria 5437
62 Ga0070704_100133286 3300005549 Bacteria 1929
63 Ga0070704_100483653 3300005549 Unclassified 1072
64 Ga0068857_100648976 3300005577 Bacteria 1000
65 Ga0068852_100140431 3300005616 Bacteria 2235
66 Ga0068859_100007883 3300005617 Bacteria 10807
67 Ga0068859_100050219 3300005617 Bacteria 4190
68 Ga0068864_100030510 3300005618 Unclassified 4570
69 Ga0068864_100590621 3300005618 Unclassified 1077
70 Ga0068861_100180878 3300005719 Unclassified 1755
71 Ga0068870_10028545 3300005840 Bacteria 2803
72 Ga0068863_100029212 3300005841 Bacteria 5264
73 Ga0068858_100008759 3300005842 Bacteria 9709
74 Ga0068860_100061043 3300005843 Bacteria 3581
75 Ga0068862_100017238 3300005844 Bacteria 6011
76 Ga0068862_100020193 3300005844 Bacteria 5564
77 Ga0068862_100236066 3300005844 Bacteria 1660
78 Ga0068862_100255713 3300005844 Bacteria 1597
79 Ga0081539_10004513 3300005985 Bacteria 15297
80 Ga0081539_10004539 3300005985 Bacteria 15230
81 Ga0075365_10024764 3300006038 Bacteria 3792
82 Ga0075363_100154441 3300006048 Unclassified 1297
83 Ga0075364_10015349 3300006051 Unclassified 4748
84 Ga0075362_10001927 3300006177 Bacteria 6816
85 Ga0075367_10034987 3300006178 Bacteria 2904
86 Ga0075369_10067138 3300006186 Unclassified 1574
87 Ga0075427_10000128 3300006194 Bacteria 6814
88 Ga0075366_10003460 3300006195 Bacteria 8334
89 Ga0075428_100006886 3300006844 Bacteria 12631
90 Ga0075428_100169860 3300006844 Unclassified 2364
91 Ga0075428_100206241 3300006844 Bacteria 2124
92 Ga0075428_100645714 3300006844 Unclassified 1129
93 Ga0075430_100067672 3300006846 Unclassified 2997
94 Ga0075431_100022524 3300006847 Bacteria 6441
95 Ga0075431_100039543 3300006847 Bacteria 4858
96 Ga0075431_100162071 3300006847 Bacteria 2299
97 Ga0075431_100264500 3300006847 Unclassified 1745
98 Ga0075431_100299961 3300006847 Bacteria 1623
99 Ga0075433_10010058 3300006852 Bacteria 7582
100 Ga0075433_10050292 3300006852 Bacteria 3628
101 Ga0075433_10327990 3300006852 Bacteria 1354
102 Ga0075433_10377990 3300006852 Bacteria 1251
103 Ga0075434_100050635 3300006871 Bacteria 4126
104 Ga0075434_100073474 3300006871 Bacteria 3412
105 Ga0075429_100003526 3300006880 Bacteria 13330
106 Ga0075429_100008414 3300006880 Bacteria 8977
107 Ga0075429_100168225 3300006880 Unclassified 1920
108 Ga0075429_100273508 3300006880 Unclassified 1479
109 Ga0075429_100352072 3300006880 Unclassified 1289
110 Ga0075429_100485773 3300006880 Unclassified 1082
111 Ga0097620_100007883 3300006931 Bacteria 10807
112 Ga0097620_100050219 3300006931 Bacteria 4190
113 Ga0075435_100018070 3300007076 Bacteria 5351
114 Ga0111539_10000603 3300009094 Bacteria 46477
115 Ga0111539_10057586 3300009094 Bacteria 4614
116 Ga0105245_10186968 3300009098 Bacteria 1982
117 Ga0114129_10001125 3300009147 Bacteria 35324
118 Ga0114129_10004628 3300009147 Bacteria 19421
119 Ga0114129_10037920 3300009147 Bacteria 6799
120 Ga0114129_10038499 3300009147 Bacteria 6744
121 Ga0114129_10098765 3300009147 Bacteria 4041
122 Ga0114129_10105716 3300009147 Bacteria 3889
123 Ga0114129_10158321 3300009147 Unclassified 3096
124 Ga0114129_10160139 3300009147 Bacteria 3075
125 Ga0114129_10198007 3300009147 Bacteria 2723
126 Ga0114129_11167470 3300009147 Unclassified 961
127 Ga0105243_10011131 3300009148 Bacteria 6806
128 Ga0105243_10039059 3300009148 Bacteria 3699
129 Ga0105243_10041942 3300009148 Archaea 3580
130 Ga0105243_10217677 3300009148 Bacteria 1686
131 Ga0105248_10022141 3300009177 Bacteria 7045
132 Ga0105249_10126810 3300009553 Bacteria 2431
133 Ga0105249_10160318 3300009553 Bacteria 2173
134 Ga0105249_10352911 3300009553 Unclassified 1490
135 Ga0157378_10061001 3300013297 Bacteria 3365
136 Ga0157375_10014556 3300013308 Bacteria 7022
137 Ga0157380_10014948 3300014326 Bacteria 5692
138 Ga0157380_11005191 3300014326 Unclassified 868
139 Ga0157379_10251198 3300014968 Unclassified 1605
140 Ga0163161_10069419 3300017792 Bacteria 2576
141 Ga0207645_10068631 3300025907 Bacteria 2267
142 Ga0207643_10015242 3300025908 Bacteria 4181
143 Ga0207684_10021019 3300025910 Bacteria 5573
144 Ga0207684_10022300 3300025910 Bacteria 5405
145 Ga0207662_10000998 3300025918 Bacteria 13214
146 Ga0207646_10085355 3300025922 Unclassified 2824
147 Ga0207646_10181750 3300025922 Unclassified 1899
148 Ga0207646_10414424 3300025922 Unclassified 1216
149 Ga0207659_10080181 3300025926 Bacteria 2410
150 Ga0207706_10019464 3300025933 Bacteria 6107
151 Ga0207709_10029400 3300025935 Unclassified 3187
152 Ga0207670_10120416 3300025936 Bacteria 1907
153 Ga0207670_10213976 3300025936 Bacteria 1471
154 Ga0207691_10042276 3300025940 Bacteria 4202
155 Ga0207689_10027103 3300025942 Bacteria 4797
156 Ga0207679_10316151 3300025945 Bacteria 1351
157 Ga0207651_10488581 3300025960 Unclassified 1062
158 Ga0207712_10099203 3300025961 Bacteria 2162
159 Ga0207712_10280270 3300025961 Bacteria 1360
160 Ga0207668_10013982 3300025972 Bacteria 4959
161 Ga0207658_10109716 3300025986 Bacteria 2179
162 Ga0207677_10080027 3300026023 Bacteria 2339
163 Ga0207703_10338831 3300026035 Bacteria 1381
164 Ga0207678_10018034 3300026067 Bacteria 6201
165 Ga0207708_10023760 3300026075 Bacteria 4633
166 Ga0207708_10136278 3300026075 Unclassified 1923
167 Ga0207641_10531951 3300026088 Unclassified 1144
168 Ga0207641_10842129 3300026088 Unclassified 909
169 Ga0207648_10001348 3300026089 Bacteria 27180
170 Ga0207676_10303424 3300026095 Unclassified 1459
171 Ga0207674_10212376 3300026116 Bacteria 1884
172 Ga0207674_10397946 3300026116 Bacteria 1331
173 Ga0207675_100078380 3300026118 Bacteria 3096
174 Ga0207675_100148499 3300026118 Unclassified 2230
175 Ga0207683_10019003 3300026121 Bacteria 5864
176 Ga0207698_10332702 3300026142 Unclassified 1427
177 Ga0207428_10000174 3300027907 Bacteria 89762
178 Ga0268265_10054344 3300028380 Bacteria 3038
179 Ga0268265_10155468 3300028380 Bacteria 1934
180 Ga0307408_100407672 3300031548 Unclassified 1169
181 Ga0316575_10009460 3300031665 Unclassified 3570
182 Ga0316579_10001456 3300031691 Bacteria 8604
183 Ga0316579_10107935 3300031691 Bacteria 1335
184 Ga0316576_10068799 3300031727 Bacteria 2610
185 Ga0316577_10117165 3300031733 Bacteria 1496
186 Ga0307410_10169854 3300031852 Unclassified 1642
187 Ga0307410_10326567 3300031852 Bacteria 1219
188 Ga0307407_10050741 3300031903 Bacteria 2375
189 Ga0307412_10297675 3300031911 Bacteria 1274
190 Ga0307412_11012693 3300031911 Unclassified 734
191 Ga0307409_100772341 3300031995 Unclassified 966
192 Ga0307416_100066053 3300032002 Unclassified 2976
193 Ga0307411_10628110 3300032005 Unclassified 927
194 Ga0316585_10066279 3300032137 Bacteria 1170
195 Ga0373940_0095331 3300035088 Unclassified 897
196 Ga0316574_0379640 3300035398 Bacteria 892
197 Ga0316582_0031804 3300036647 Bacteria 3229
198 Ga0316582_0043863 3300036647 Unclassified 2808
199 Ga0316584_0065922 3300036712 Unclassified 2713
200 Ga0316584_0292903 3300036712 Bacteria 1180
201 Ga0316581_0000465 3300037588 Bacteria 7756
202 Ga0439446_0067477 3300042156 Bacteria 1090
203 Ga0451577_0030296 3300042876 Bacteria 4889
204 Ga0451577_0042206 3300042876 Bacteria 4092
205 Ga0451577_0088300 3300042876 Bacteria 2766
206 Ga0451577_0121650 3300042876 Bacteria 2338
207 Ga0451577_0126328 3300042876 Bacteria 2292
208 Ga0451577_0140865 3300042876 Bacteria 2167
209 Ga0451577_0157311 3300042876 Bacteria 2046
210 Ga0451577_0232501 3300042876 Unclassified 1667
211 Ga0451577_0294896 3300042876 Bacteria 1469
212 Ga0451577_0308503 3300042876 Bacteria 1434
213 Ga0451577_0361718 3300042876 Bacteria 1316
214 Ga0453683_0000523 3300044673 Bacteria 43101
215 Ga0453683_0044497 3300044673 Unclassified 2786
216 Ga0453683_0236031 3300044673 Unclassified 1164
217 Ga0453683_0378765 3300044673 Unclassified 911
218 Ga0453683_0582378 3300044673 Unclassified 729
219 Ga0453684_0001487 3300044712 Bacteria 66111
220 Ga0453684_0001638 3300044712 Bacteria 60803
221 Ga0453684_0002811 3300044712 Bacteria 41136
222 Ga0453684_0006097 3300044712 Bacteria 23247
223 Ga0453684_0017807 3300044712 Bacteria 10964
224 Ga0453684_0028334 3300044712 Bacteria 7997
225 Ga0453684_0052223 3300044712 Bacteria 5348
226 Ga0453684_0074149 3300044712 Unclassified 4286
227 Ga0453684_0091254 3300044712 Unclassified 3761
228 Ga0453684_0091802 3300044712 Bacteria 3747
229 Ga0453684_0104923 3300044712 Bacteria 3449
230 Ga0453684_0105312 3300044712 Viruses 3440
231 Ga0453684_0154715 3300044712 Unclassified 2720
232 Ga0453684_0162847 3300044712 Bacteria 2636
233 Ga0453684_0173953 3300044712 Bacteria 2535
234 Ga0453684_0197645 3300044712 Unclassified 2346
235 Ga0453684_0207356 3300044712 Bacteria 2280
236 Ga0453684_0208211 3300044712 Bacteria 2275
237 Ga0453684_0246445 3300044712 Unclassified 2054
238 Ga0453684_0306496 3300044712 Bacteria 1804
239 Ga0453684_0328855 3300044712 Bacteria 1729
240 Ga0453684_0396117 3300044712 Unclassified 1547
241 Ga0453684_0454811 3300044712 Unclassified 1424
242 Ga0453684_0458237 3300044712 Bacteria 1418
243 Ga0453684_0478105 3300044712 Bacteria 1382
244 Ga0453684_0478170 3300044712 Bacteria 1382
245 Ga0453684_0498521 3300044712 Bacteria 1349
246 Ga0453684_0541677 3300044712 Unclassified 1283
247 Ga0453684_0587341 3300044712 Unclassified 1222
248 Ga0453684_0664832 3300044712 Unclassified 1135
249 Ga0453684_0905300 3300044712 Unclassified 944
250 Ga0451576_0008815 3300045051 Bacteria 11785
251 Ga0451576_0026604 3300045051 Bacteria 6221
252 Ga0451576_0027131 3300045051 Bacteria 6155
253 Ga0451576_0033663 3300045051 Bacteria 5446
254 Ga0451576_0039081 3300045051 Bacteria 5022
255 Ga0451576_0146888 3300045051 Bacteria 2458
256 Ga0495656_0052612 3300046615 Bacteria 1747
257 Ga0496106_0144065 3300048909 Bacteria 1876
258 Ga0501031_0200132 3300049568 Unclassified 1303
259 Ga0501036_0295699 3300049572 Unclassified 1354
260 Ga0501039_0284717 3300049575 Unclassified 1299
261 Ga0501041_0156730 3300049577 Unclassified 1423
262 Ga0501042_0079932 3300049578 Unclassified 2343
263 Ga0501046_0289150 3300049580 Unclassified 1199
264 Ga0501048_0194419 3300049582 Unclassified 1438
265 Ga0501048_0352057 3300049582 Unclassified 1050
266 Ga0501072_0111749 3300049588 Unclassified 2175
267 Ga0501072_0321278 3300049588 Unclassified 1230
268 Ga0501074_0590937 3300049590 Unclassified 785
269 Ga0501075_0004325 3300049591 Bacteria 9611
270 Ga0501075_0080437 3300049591 Bacteria 2467
271 Ga0501075_0102834 3300049591 Unclassified 2170
272 Ga0501075_0440892 3300049591 Bacteria 993
273 Ga0501075_0637155 3300049591 Bacteria 813
274 Ga0501076_0001634 3300049592 Bacteria 15122
275 Ga0501076_0017751 3300049592 Bacteria 5410
276 Ga0501076_0245175 3300049592 Bacteria 1466
277 Ga0501076_0738935 3300049592 Bacteria 812
278 Ga0501077_0255786 3300049593 Unclassified 1114
279 Ga0501227_050791 3300049665 Unclassified 1046
280 Ga0501257_054301 3300049686 Bacteria 1004
281 Ga0501079_0180746 3300049741 Unclassified 1646
282 Ga0501079_0731388 3300049741 Unclassified 779
283 Ga0501080_0174576 3300049742 Unclassified 1981
284 Ga0501080_0329733 3300049742 Unclassified 1380
285 Ga0501080_0572535 3300049742 Bacteria 1005
286 Ga0501080_0810237 3300049742 Bacteria 821
287 Ga0501081_0146668 3300049743 Bacteria 1694
288 Ga0501081_0226474 3300049743 Bacteria 1361
289 Ga0501081_0466571 3300049743 Bacteria 939
290 Ga0501044_0967665 3300049823 Unclassified 724
291 Ga0501045_0129221 3300049824 Unclassified 1878
292 nmdc:mga03683_79740_c1 3300050489 Unclassified 1412
293 nmdc:mga00v17_384266_c1 3300050491 Unclassified 913
294 nmdc:mga0yw44_31492_c1 3300050492 Unclassified 3085
295 nmdc:mga0k408_3466_c1 3300050493 Bacteria 8347
296 nmdc:mga06z11_8833_c1 3300050494 Bacteria 4221
297 nmdc:mga04h51_61728_c1 3300050495 Bacteria 1286
298 nmdc:mga05p37_101744_c1 3300050507 Bacteria 3538
299 nmdc:mga05p37_158288_c1 3300050507 Bacteria 2767
300 nmdc:mga05p37_2237_c1 3300050507 Bacteria 22548
301 nmdc:mga05p37_39732_c1 3300050507 Bacteria 5777
302 nmdc:mga05p37_42479_c1 3300050507 Bacteria 5586
303 nmdc:mga05p37_4443_c1 3300050507 Bacteria 16393
304 nmdc:mga05p37_652092_c1 3300050507 Bacteria 1179
305 nmdc:mga05p37_90454_c2 3300050507 Bacteria 2952
306 nmdc:mga09592_143453_c1 3300050508 Unclassified 2059
307 nmdc:mga09592_25117_c1 3300050508 Bacteria 4929
308 nmdc:mga09592_396668_c1 3300050508 Unclassified 1193
309 nmdc:mga09592_471524_c1 3300050508 Unclassified 1082
310 nmdc:mga0qj67_168388_c1 3300050509 Unclassified 1779
311 nmdc:mga06r32_121395_c1 3300050510 Bacteria 2578
312 nmdc:mga06r32_167264_c1 3300050510 Bacteria 2182
313 nmdc:mga06r32_36780_c1 3300050510 Bacteria 4629
314 nmdc:mga06r32_63400_c1 3300050510 Bacteria 3562
315 nmdc:mga06r32_714811_c1 3300050510 Bacteria 967
316 nmdc:mga06r32_88300_c1 3300050510 Bacteria 3026
317 nmdc:mga08y16_9058_c1 3300050511 Bacteria 10448
318 nmdc:mga0n895_17829_c1 3300050512 Bacteria 6555
319 nmdc:mga0n895_980747_c1 3300050512 Bacteria 827
320 nmdc:mga0rr50_15993_c1 3300050513 Bacteria 4969
321 nmdc:mga0a205_166564_c1 3300050515 Unclassified 2099
322 nmdc:mga0a205_181901_c1 3300050515 Unclassified 1996
323 nmdc:mga0a205_245221_c1 3300050515 Bacteria 1672
324 nmdc:mga0a205_31786_c1 3300050515 Bacteria 5060
325 nmdc:mga0a205_68914_c1 3300050515 Bacteria 3416
326 nmdc:mga0sz30_249259_c1 3300050516 Unclassified 790
327 Ga0501084_0472622 3300054114 Bacteria 1060
328 Ga0501082_0087707 3300060353 Bacteria 2685
329 Ga0501082_0168842 3300060353 Unclassified 1902
330 Ga0501082_0181034 3300060353 Bacteria 1833
331 Ga0530510_0096509 3300061734 Bacteria 2161
332 Ga0530510_0720799 3300061734 Bacteria 760
333 Ga0070706_100024220
334 SwRhRL2b_contig_1033251
335 JGI25406J46586_10001015
336 Ga0065704_10012577
337 Ga0065704_10070402
338 Ga0065715_10015290
339 Ga0065707_10082149
340 Ga0065707_10087037
341 Ga0065707_10099026
342 Ga0065707_10130045
343 Ga0070676_10060614
344 Ga0070690_100053498
345 Ga0068869_100072891
346 Ga0068869_100892162
347 Ga0068868_100015724
348 Ga0070689_100068774
349 Ga0070689_100083549
350 Ga0070687_100050432
351 Ga0070692_10100654
352 Ga0070668_100021500
353 Ga0070674_100003035
354 Ga0070673_100019854
355 Ga0070688_100002509
356 Ga0070659_100158476
357 Ga0070667_100091232
358 Ga0070703_10079591
359 Ga0070701_10137526
360 Ga0070705_100007833
361 Ga0070705_100076496
362 Ga0070700_100126284
363 Ga0070700_100196100
364 Ga0070694_100051955
365 Ga0070694_100096887
366 Ga0070694_100124797
367 Ga0070708_100065548
368 Ga0070663_100014173
369 Ga0070662_100220032
370 Ga0068867_100014382
371 Ga0070685_10174453
372 Ga0070706_100011258
373 Ga0070706_100348659
374 Ga0070706_100711363
375 Ga0070707_100028571
376 Ga0070707_100170528
377 Ga0070707_100401330
378 Ga0070698_100004210
379 Ga0070698_100065401
380 Ga0070698_100303795
381 Ga0070699_100025951
382 Ga0070699_100038062
383 Ga0070699_100093526
384 Ga0070699_100184954
385 Ga0070699_100243604
386 Ga0070699_100311929
387 Ga0070672_100020205
388 Ga0070686_100011661
389 Ga0070695_100066847
390 Ga0070696_100005760
391 Ga0070696_100310638
392 Ga0070665_101055429
393 Ga0070704_100011451
394 Ga0070704_100133286
395 Ga0070704_100483653
396 Ga0068857_100648976
397 Ga0068852_100140431
398 Ga0068859_100007883
399 Ga0068859_100050219
400 Ga0068864_100030510
401 Ga0068864_100590621
402 Ga0068861_100180878
403 Ga0068870_10028545
404 Ga0068863_100029212
405 Ga0068858_100008759
406 Ga0068860_100061043
407 Ga0068862_100017238
408 Ga0068862_100020193
409 Ga0068862_100236066
410 Ga0068862_100255713
411 Ga0081539_10004513
412 Ga0081539_10004539
413 Ga0075365_10024764
414 Ga0075363_100154441
415 Ga0075364_10015349
416 Ga0075362_10001927
417 Ga0075367_10034987
418 Ga0075369_10067138
419 Ga0075427_10000128
420 Ga0075366_10003460
421 Ga0075428_100006886
422 Ga0075428_100169860
423 Ga0075428_100206241
424 Ga0075428_100645714
425 Ga0075430_100067672
426 Ga0075431_100022524
427 Ga0075431_100039543
428 Ga0075431_100162071
429 Ga0075431_100264500
430 Ga0075431_100299961
431 Ga0075433_10010058
432 Ga0075433_10050292
433 Ga0075433_10327990
434 Ga0075433_10377990
435 Ga0075434_100050635
436 Ga0075434_100073474
437 Ga0075429_100003526
438 Ga0075429_100008414
439 Ga0075429_100168225
440 Ga0075429_100273508
441 Ga0075429_100352072
442 Ga0075429_100485773
443 Ga0097620_100007883
444 Ga0097620_100050219
445 Ga0075435_100018070
446 Ga0111539_10000603
447 Ga0111539_10057586
448 Ga0105245_10186968
449 Ga0114129_10001125
450 Ga0114129_10004628
451 Ga0114129_10037920
452 Ga0114129_10038499
453 Ga0114129_10098765
454 Ga0114129_10105716
455 Ga0114129_10158321
456 Ga0114129_10160139
457 Ga0114129_10198007
458 Ga0114129_11167470
459 Ga0105243_10011131
460 Ga0105243_10039059
461 Ga0105243_10041942
462 Ga0105243_10217677
463 Ga0105248_10022141
464 Ga0105249_10126810
465 Ga0105249_10160318
466 Ga0105249_10352911
467 Ga0157378_10061001
468 Ga0157375_10014556
469 Ga0157380_10014948
470 Ga0157380_11005191
471 Ga0157379_10251198
472 Ga0163161_10069419
473 Ga0207645_10068631
474 Ga0207643_10015242
475 Ga0207684_10021019
476 Ga0207684_10022300
477 Ga0207662_10000998
478 Ga0207646_10085355
479 Ga0207646_10181750
480 Ga0207646_10414424
481 Ga0207659_10080181
482 Ga0207706_10019464
483 Ga0207709_10029400
484 Ga0207670_10120416
485 Ga0207670_10213976
486 Ga0207691_10042276
487 Ga0207689_10027103
488 Ga0207679_10316151
489 Ga0207651_10488581
490 Ga0207712_10099203
491 Ga0207712_10280270
492 Ga0207668_10013982
493 Ga0207658_10109716
494 Ga0207677_10080027
495 Ga0207703_10338831
496 Ga0207678_10018034
497 Ga0207708_10023760
498 Ga0207708_10136278
499 Ga0207641_10531951
500 Ga0207641_10842129
501 Ga0207648_10001348
502 Ga0207676_10303424
503 Ga0207674_10212376
504 Ga0207674_10397946
505 Ga0207675_100078380
506 Ga0207675_100148499
507 Ga0207683_10019003
508 Ga0207698_10332702
509 Ga0207428_10000174
510 Ga0268265_10054344
511 Ga0268265_10155468
512 Ga0307408_100407672
513 Ga0316575_10009460
514 Ga0316579_10001456
515 Ga0316579_10107935
516 Ga0316576_10068799
517 Ga0316577_10117165
518 Ga0307410_10169854
519 Ga0307410_10326567
520 Ga0307407_10050741
521 Ga0307412_10297675
522 Ga0307412_11012693
523 Ga0307409_100772341
524 Ga0307416_100066053
525 Ga0307411_10628110
526 Ga0316585_10066279
527 Ga0373940_0095331
528 Ga0316574_0379640
529 Ga0316582_0031804
530 Ga0316582_0043863
531 Ga0316584_0065922
532 Ga0316584_0292903
533 Ga0316581_0000465
534 Ga0439446_0067477
535 Ga0451577_0030296
536 Ga0451577_0042206
537 Ga0451577_0088300
538 Ga0451577_0121650
539 Ga0451577_0126328
540 Ga0451577_0140865
541 Ga0451577_0157311
542 Ga0451577_0232501
543 Ga0451577_0294896
544 Ga0451577_0308503
545 Ga0451577_0361718
546 Ga0453683_0000523
547 Ga0453683_0044497
548 Ga0453683_0236031
549 Ga0453683_0378765
550 Ga0453683_0582378
551 Ga0453684_0001487
552 Ga0453684_0001638
553 Ga0453684_0002811
554 Ga0453684_0006097
555 Ga0453684_0017807
556 Ga0453684_0028334
557 Ga0453684_0052223
558 Ga0453684_0074149
559 Ga0453684_0091254
560 Ga0453684_0091802
561 Ga0453684_0104923
562 Ga0453684_0105312
563 Ga0453684_0154715
564 Ga0453684_0162847
565 Ga0453684_0173953
566 Ga0453684_0197645
567 Ga0453684_0207356
568 Ga0453684_0208211
569 Ga0453684_0246445
570 Ga0453684_0306496
571 Ga0453684_0328855
572 Ga0453684_0396117
573 Ga0453684_0454811
574 Ga0453684_0458237
575 Ga0453684_0478105
576 Ga0453684_0478170
577 Ga0453684_0498521
578 Ga0453684_0541677
579 Ga0453684_0587341
580 Ga0453684_0664832
581 Ga0453684_0905300
582 Ga0451576_0008815
583 Ga0451576_0026604
584 Ga0451576_0027131
585 Ga0451576_0033663
586 Ga0451576_0039081
587 Ga0451576_0146888
588 Ga0495656_0052612
589 Ga0496106_0144065
590 Ga0501031_0200132
591 Ga0501036_0295699
592 Ga0501039_0284717
593 Ga0501041_0156730
594 Ga0501042_0079932
595 Ga0501046_0289150
596 Ga0501048_0194419
597 Ga0501048_0352057
598 Ga0501072_0111749
599 Ga0501072_0321278
600 Ga0501074_0590937
601 Ga0501075_0004325
602 Ga0501075_0080437
603 Ga0501075_0102834
604 Ga0501075_0440892
605 Ga0501075_0637155
606 Ga0501076_0001634
607 Ga0501076_0017751
608 Ga0501076_0245175
609 Ga0501076_0738935
610 Ga0501077_0255786
611 Ga0501227_050791
612 Ga0501257_054301
613 Ga0501079_0180746
614 Ga0501079_0731388
615 Ga0501080_0174576
616 Ga0501080_0329733
617 Ga0501080_0572535
618 Ga0501080_0810237
619 Ga0501081_0146668
620 Ga0501081_0226474
621 Ga0501081_0466571
622 Ga0501044_0967665
623 Ga0501045_0129221
624 nmdc:mga03683_79740_c1
625 nmdc:mga00v17_384266_c1
626 nmdc:mga0yw44_31492_c1
627 nmdc:mga0k408_3466_c1
628 nmdc:mga06z11_8833_c1
629 nmdc:mga04h51_61728_c1
630 nmdc:mga05p37_101744_c1
631 nmdc:mga05p37_158288_c1
632 nmdc:mga05p37_2237_c1
633 nmdc:mga05p37_39732_c1
634 nmdc:mga05p37_42479_c1
635 nmdc:mga05p37_4443_c1
636 nmdc:mga05p37_652092_c1
637 nmdc:mga05p37_90454_c2
638 nmdc:mga09592_143453_c1
639 nmdc:mga09592_25117_c1
640 nmdc:mga09592_396668_c1
641 nmdc:mga09592_471524_c1
642 nmdc:mga0qj67_168388_c1
643 nmdc:mga06r32_121395_c1
644 nmdc:mga06r32_167264_c1
645 nmdc:mga06r32_36780_c1
646 nmdc:mga06r32_63400_c1
647 nmdc:mga06r32_714811_c1
648 nmdc:mga06r32_88300_c1
649 nmdc:mga08y16_9058_c1
650 nmdc:mga0n895_17829_c1
651 nmdc:mga0n895_980747_c1
652 nmdc:mga0rr50_15993_c1
653 nmdc:mga0a205_166564_c1
654 nmdc:mga0a205_181901_c1
655 nmdc:mga0a205_245221_c1
656 nmdc:mga0a205_31786_c1
657 nmdc:mga0a205_68914_c1
658 nmdc:mga0sz30_249259_c1
659 Ga0501084_0472622
660 Ga0501082_0087707
661 Ga0501082_0168842
662 Ga0501082_0181034
663 Ga0530510_0096509
664 Ga0530510_0720799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

3

119

0.96

PF13241

NAD_binding_7

Putative NAD(P)-binding

1

108

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 1.012 1 31
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9993 2 31
3zdn-assembly2.cif.gz_D d11-c mutant of monoamine oxidase from aspergillus niger 0.9987 2 31
2vvm-assembly1.cif.gz_A the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9986 2 31
2vvl-assembly1.cif.gz_E the structure of mao-n-d3, a variant of monoamine oxidase from aspergillus niger. 0.9984 2 31
ID Description Score Start End Superfamily
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1 3 29 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9973 2 31 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9967 3 31 3.50.50.60
5er0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9966 2 31 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9955 2 31 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2M8NK00-F1-model_v4 Potassium transporter TrkA 0.9807 2 79 GO:0005886
GO:0015079
AF-A0A1G8FLJ9-F1-model_v4 deleted 0.9752 1 113
AF-A0A3S9H2J3-F1-model_v4 deleted 0.9671 1 117
AF-X1INN7-F1-model_v4 RCK N-terminal domain-containing protein 0.9575 5 91 GO:0005886
GO:0015079
AF-A0A5J4PKC0-F1-model_v4 Trk system potassium uptake protein TrkA 0.947 1 86 GO:0005886
GO:0015079

Map