F410804

General Info

Members Datasets Scaffolds Average Seq Length
332 181 664 223

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100069251|Ga0070661_1000692513
Length 234
Sequence MRPPSKGQATNSIYQIAMGSDFARLHPQIQKRFGFTSQDQIAAIGRGVMQKVWHGPHTLPFLYLGTWRRIMFPEYGTNIPFTIENYAYQDSLGRETVTWLRTFHTRKIRRFDAYMIYSQQRSRVVDYLGTHQHLAVDIDLSVDPATRGLRLQSGEQRFYEGPVAFRFPMYFSGIANVCEWYDDTTKNFQIEVEVINKTWGQLFGYRGSFDVTWRHTPPDQIPKHAKPKREERRE

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
179 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
180 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
181 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.6
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0.9
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 14.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100069251 3300005344 Bacteria 2594
2 rootH2_10073743 3300003320 Bacteria 2373
3 Ga0065712_10075877 3300005290 Bacteria 3773
4 Ga0065715_10091496 3300005293 Bacteria 5750
5 Ga0070658_10114846 3300005327 Bacteria 2233
6 Ga0070683_100001162 3300005329 Bacteria 19940
7 Ga0070683_100465262 3300005329 Bacteria 1207
8 Ga0068868_100001266 3300005338 Bacteria 17397
9 Ga0070660_100108718 3300005339 Bacteria 2204
10 Ga0070661_100020297 3300005344 Bacteria 4737
11 Ga0070661_100341457 3300005344 Unclassified 1173
12 Ga0070675_100394787 3300005354 Unclassified 1233
13 Ga0070671_100030976 3300005355 Bacteria 4416
14 Ga0070667_100151814 3300005367 Bacteria 2035
15 Ga0070714_100038948 3300005435 Bacteria 3999
16 Ga0070714_100114952 3300005435 Bacteria 2388
17 Ga0070714_100124459 3300005435 Unclassified 2296
18 Ga0070714_100533464 3300005435 Bacteria 1122
19 Ga0070714_100553242 3300005435 Bacteria 1102
20 Ga0070714_100623557 3300005435 Bacteria 1037
21 Ga0070713_100010555 3300005436 Bacteria 6677
22 Ga0070713_100313485 3300005436 Viruses 1447
23 Ga0070710_10097538 3300005437 Bacteria 1744
24 Ga0070711_100001046 3300005439 Bacteria 14752
25 Ga0070711_100056058 3300005439 Bacteria 2724
26 Ga0070711_100108799 3300005439 Bacteria 2031
27 Ga0070711_100150769 3300005439 Unclassified 1753
28 Ga0070694_100274021 3300005444 Bacteria 1284
29 Ga0070708_100067017 3300005445 Bacteria 3223
30 Ga0070708_100387190 3300005445 Bacteria 1318
31 Ga0070708_100525110 3300005445 Bacteria 1117
32 Ga0070706_100014497 3300005467 Bacteria 7282
33 Ga0070706_100060049 3300005467 Unclassified 3510
34 Ga0070706_100213990 3300005467 Bacteria 1799
35 Ga0070707_100009833 3300005468 Bacteria 8899
36 Ga0070698_100004052 3300005471 Bacteria 16117
37 Ga0070699_100114036 3300005518 Bacteria 2374
38 Ga0070699_100275356 3300005518 Bacteria 1507
39 Ga0070699_100620248 3300005518 Bacteria 986
40 Ga0070684_100001657 3300005535 Bacteria 16159
41 Ga0070684_100007132 3300005535 Bacteria 8683
42 Ga0070697_100147748 3300005536 Bacteria 1980
43 Ga0070697_100340229 3300005536 Unclassified 1295
44 Ga0068853_100001336 3300005539 Bacteria 17771
45 Ga0068853_100024555 3300005539 Bacteria 5055
46 Ga0068853_100125783 3300005539 Bacteria 2290
47 Ga0070686_100523768 3300005544 Bacteria 923
48 Ga0070665_100000085 3300005548 Bacteria 180238
49 Ga0070704_100498337 3300005549 Bacteria 1056
50 Ga0068855_100012686 3300005563 Bacteria 10169
51 Ga0068855_100040066 3300005563 Bacteria 5561
52 Ga0068855_100288133 3300005563 Unclassified 1821
53 Ga0068855_100440446 3300005563 Bacteria 1423
54 Ga0070664_100222493 3300005564 Bacteria 1689
55 Ga0070664_100436083 3300005564 Unclassified 1201
56 Ga0070664_100541880 3300005564 Unclassified 1075
57 Ga0068857_100000870 3300005577 Bacteria 22717
58 Ga0068857_100036245 3300005577 Bacteria 4371
59 Ga0068854_100061141 3300005578 Bacteria 2727
60 Ga0068856_100002738 3300005614 Bacteria 18050
61 Ga0068856_100006061 3300005614 Bacteria 11881
62 Ga0068856_100007238 3300005614 Bacteria 10828
63 Ga0068856_100186520 3300005614 Bacteria 2088
64 Ga0068852_100001018 3300005616 Bacteria 18514
65 Ga0068852_100015642 3300005616 Bacteria 5894
66 Ga0068859_100050732 3300005617 Bacteria 4168
67 Ga0068859_100212081 3300005617 Bacteria 2023
68 Ga0068864_100495656 3300005618 Bacteria 1174
69 Ga0068851_10002819 3300005834 Bacteria 7666
70 Ga0068851_10021001 3300005834 Bacteria 3167
71 Ga0068851_10272550 3300005834 Unclassified 965
72 Ga0068863_100000455 3300005841 Bacteria 41700
73 Ga0068863_100370247 3300005841 Bacteria 1398
74 Ga0068863_100370627 3300005841 Bacteria 1397
75 Ga0068858_100011907 3300005842 Bacteria 8198
76 Ga0068860_100001340 3300005843 Bacteria 26791
77 Ga0068860_100289294 3300005843 Bacteria 1603
78 Ga0070717_10002559 3300006028 Bacteria 12820
79 Ga0070717_10003070 3300006028 Bacteria 11904
80 Ga0070717_10409245 3300006028 Bacteria 1219
81 Ga0070715_10112898 3300006163 Viruses 1284
82 Ga0070716_100204067 3300006173 Bacteria 1316
83 Ga0070712_100000196 3300006175 Bacteria 33763
84 Ga0070712_100026640 3300006175 Bacteria 3854
85 Ga0070712_100055081 3300006175 Bacteria 2783
86 Ga0097621_100004990 3300006237 Bacteria 9305
87 Ga0097621_100048321 3300006237 Bacteria 3452
88 Ga0097621_100208515 3300006237 Bacteria 1699
89 Ga0068871_100001078 3300006358 Bacteria 18304
90 Ga0068871_100344847 3300006358 Bacteria 1316
91 Ga0068871_100387188 3300006358 Bacteria 1243
92 Ga0075431_100008940 3300006847 Bacteria 10039
93 Ga0075434_100021758 3300006871 Bacteria 6237
94 Ga0075434_100067651 3300006871 Bacteria 3558
95 Ga0075436_100000421 3300006914 Bacteria 27135
96 Ga0097620_100050734 3300006931 Bacteria 4168
97 Ga0097620_100212064 3300006931 Bacteria 2023
98 Ga0075435_100000835 3300007076 Bacteria 19219
99 Ga0099794_10002725 3300007265 Bacteria 6586
100 Ga0099794_10063764 3300007265 Unclassified 1794
101 Ga0105240_10000001 3300009093 Bacteria 2887840
102 Ga0105240_10001213 3300009093 Bacteria 44943
103 Ga0105240_10012837 3300009093 Bacteria 11539
104 Ga0105240_10030881 3300009093 Bacteria 6959
105 Ga0105240_10040530 3300009093 Bacteria 5955
106 Ga0105240_10804677 3300009093 Bacteria 1018
107 Ga0111539_10697431 3300009094 Unclassified 1182
108 Ga0105245_10000532 3300009098 Bacteria 34970
109 Ga0105245_10160688 3300009098 Bacteria 2132
110 Ga0105245_10248271 3300009098 Bacteria 1728
111 Ga0105245_10446553 3300009098 Unclassified 1301
112 Ga0105247_10004315 3300009101 Bacteria 9085
113 Ga0114129_10039390 3300009147 Bacteria 6662
114 Ga0114129_10052253 3300009147 Bacteria 5735
115 Ga0105243_10036224 3300009148 Bacteria 3829
116 Ga0105241_10002052 3300009174 Bacteria 15210
117 Ga0105241_10003068 3300009174 Bacteria 12456
118 Ga0105242_10203587 3300009176 Unclassified 1759
119 Ga0105248_10000432 3300009177 Bacteria 47503
120 Ga0105248_10219998 3300009177 Unclassified 2138
121 Ga0105248_10284920 3300009177 Bacteria 1860
122 Ga0105248_10296590 3300009177 Bacteria 1820
123 Ga0105237_10036134 3300009545 Bacteria 4998
124 Ga0105237_10057060 3300009545 Bacteria 3908
125 Ga0105237_10099162 3300009545 Unclassified 2905
126 Ga0105237_10233833 3300009545 Bacteria 1839
127 Ga0105237_10305793 3300009545 Bacteria 1593
128 Ga0105238_10002746 3300009551 Bacteria 17543
129 Ga0105238_10007165 3300009551 Bacteria 11152
130 Ga0105238_10167672 3300009551 Bacteria 2172
131 Ga0105238_10224836 3300009551 Bacteria 1853
132 Ga0105238_10777514 3300009551 Unclassified 972
133 Ga0105249_10035313 3300009553 Bacteria 4534
134 Ga0105249_10254345 3300009553 Bacteria 1743
135 Ga0099796_10005903 3300010159 Bacteria 3093
136 Ga0105239_10003678 3300010375 Bacteria 18718
137 Ga0105239_10010762 3300010375 Bacteria 10219
138 Ga0105239_10448462 3300010375 Bacteria 1463
139 Ga0105239_11010314 3300010375 Bacteria 956
140 Ga0105246_10001615 3300011119 Bacteria 13422
141 Ga0105246_10078675 3300011119 Bacteria 2343
142 Ga0105246_10370958 3300011119 Unclassified 1179
143 Ga0157373_10371135 3300013100 Bacteria 1022
144 Ga0157369_10005542 3300013105 Bacteria 14664
145 Ga0157369_10005978 3300013105 Bacteria 14135
146 Ga0157369_10073741 3300013105 Bacteria 3662
147 Ga0157369_10191371 3300013105 Bacteria 2150
148 Ga0157369_10277659 3300013105 Bacteria 1745
149 Ga0157374_10005569 3300013296 Bacteria 10606
150 Ga0157374_10464237 3300013296 Unclassified 1268
151 Ga0157374_10465037 3300013296 Unclassified 1267
152 Ga0157378_10014237 3300013297 Bacteria 6962
153 Ga0157378_10047848 3300013297 Bacteria 3802
154 Ga0157378_10182243 3300013297 Bacteria 1976
155 Ga0163162_10839566 3300013306 Unclassified 1034
156 Ga0157372_10013285 3300013307 Bacteria 8788
157 Ga0157372_10045418 3300013307 Bacteria 4873
158 Ga0157372_10050056 3300013307 Bacteria 4648
159 Ga0157372_10054681 3300013307 Bacteria 4455
160 Ga0157372_10060793 3300013307 Bacteria 4228
161 Ga0157372_10187954 3300013307 Bacteria 2392
162 Ga0157372_10423075 3300013307 Bacteria 1552
163 Ga0157372_10849436 3300013307 Unclassified 1060
164 Ga0157372_11312893 3300013307 Bacteria 835
165 Ga0163163_10000396 3300014325 Bacteria 41149
166 Ga0157379_10044125 3300014968 Bacteria 3980
167 Ga0157376_10002999 3300014969 Bacteria 11581
168 Ga0157376_10048070 3300014969 Bacteria 3525
169 Ga0224570_100372 3300022730 Unclassified 3504
170 Ga0228598_1000944 3300024227 Bacteria 6331
171 Ga0228598_1001264 3300024227 Bacteria 5565
172 Ga0209675_1049124 3300025291 Bacteria 879
173 Ga0207656_10042558 3300025321 Bacteria 1933
174 Ga0207656_10225592 3300025321 Unclassified 912
175 Ga0207710_10092713 3300025900 Bacteria 1416
176 Ga0207685_10009583 3300025905 Bacteria 2819
177 Ga0207685_10054352 3300025905 Bacteria 1559
178 Ga0207705_10090725 3300025909 Bacteria 2237
179 Ga0207684_10394667 3300025910 Bacteria 1189
180 Ga0207684_10433454 3300025910 Bacteria 1129
181 Ga0207654_10000675 3300025911 Bacteria 19136
182 Ga0207654_10001415 3300025911 Bacteria 12727
183 Ga0207654_10049349 3300025911 Bacteria 2413
184 Ga0207695_10000001 3300025913 Bacteria 2888630
185 Ga0207695_10000063 3300025913 Bacteria 349527
186 Ga0207695_10002364 3300025913 Bacteria 28019
187 Ga0207695_10042521 3300025913 Bacteria 4852
188 Ga0207695_10560209 3300025913 Bacteria 1024
189 Ga0207695_10756324 3300025913 Unclassified 852
190 Ga0207671_10001836 3300025914 Bacteria 23699
191 Ga0207671_10001923 3300025914 Bacteria 23048
192 Ga0207671_10049622 3300025914 Bacteria 3107
193 Ga0207671_10343135 3300025914 Bacteria 1183
194 Ga0207693_10000221 3300025915 Bacteria 51982
195 Ga0207693_10005184 3300025915 Bacteria 10910
196 Ga0207693_10283403 3300025915 Bacteria 1298
197 Ga0207663_10003561 3300025916 Bacteria 7640
198 Ga0207663_10089463 3300025916 Unclassified 2039
199 Ga0207649_10012350 3300025920 Bacteria 4737
200 Ga0207649_10056411 3300025920 Bacteria 2453
201 Ga0207649_10374379 3300025920 Unclassified 1060
202 Ga0207646_10001550 3300025922 Bacteria 28163
203 Ga0207646_10005652 3300025922 Bacteria 13121
204 Ga0207694_10000429 3300025924 Bacteria 39058
205 Ga0207694_10000943 3300025924 Bacteria 25664
206 Ga0207694_10009849 3300025924 Bacteria 7216
207 Ga0207694_10267026 3300025924 Unclassified 1403
208 Ga0207694_10330961 3300025924 Bacteria 1258
209 Ga0207650_10005037 3300025925 Bacteria 9020
210 Ga0207659_10861667 3300025926 Unclassified 779
211 Ga0207687_10002191 3300025927 Bacteria 13347
212 Ga0207687_10031055 3300025927 Bacteria 3608
213 Ga0207687_10077946 3300025927 Bacteria 2385
214 Ga0207700_10231225 3300025928 Bacteria 1572
215 Ga0207700_10272992 3300025928 Viruses 1452
216 Ga0207664_10019920 3300025929 Bacteria 4966
217 Ga0207664_10026499 3300025929 Bacteria 4383
218 Ga0207664_10047832 3300025929 Bacteria 3362
219 Ga0207664_10056643 3300025929 Unclassified 3113
220 Ga0207644_10014827 3300025931 Bacteria 5225
221 Ga0207644_10093990 3300025931 Bacteria 2239
222 Ga0207686_10094652 3300025934 Bacteria 1981
223 Ga0207709_10110360 3300025935 Bacteria 1838
224 Ga0207665_10028268 3300025939 Unclassified 3704
225 Ga0207665_10143041 3300025939 Bacteria 1707
226 Ga0207665_10190763 3300025939 Bacteria 1489
227 Ga0207711_10015988 3300025941 Bacteria 6226
228 Ga0207711_10248139 3300025941 Bacteria 1634
229 Ga0207689_10001181 3300025942 Bacteria 25124
230 Ga0207661_10001470 3300025944 Bacteria 15929
231 Ga0207679_10430898 3300025945 Bacteria 1166
232 Ga0207667_10000253 3300025949 Bacteria 75314
233 Ga0207667_10006161 3300025949 Bacteria 14566
234 Ga0207658_10361532 3300025986 Bacteria 1266
235 Ga0207677_10001506 3300026023 Bacteria 12300
236 Ga0207677_10062966 3300026023 Bacteria 2576
237 Ga0207677_10947963 3300026023 Unclassified 778
238 Ga0207703_10091123 3300026035 Bacteria 2564
239 Ga0207639_10000614 3300026041 Bacteria 24554
240 Ga0207639_10013701 3300026041 Bacteria 5684
241 Ga0207702_10002766 3300026078 Bacteria 16422
242 Ga0207702_10003964 3300026078 Bacteria 13294
243 Ga0207702_10198844 3300026078 Bacteria 1857
244 Ga0207641_10332759 3300026088 Bacteria 1443
245 Ga0207676_10177389 3300026095 Bacteria 1862
246 Ga0207674_10000488 3300026116 Bacteria 52346
247 Ga0207674_10012186 3300026116 Bacteria 9620
248 Ga0207698_10000403 3300026142 Bacteria 24927
249 Ga0207698_10015668 3300026142 Bacteria 5085
250 Ga0207698_10425687 3300026142 Bacteria 1275
251 Ga0209588_1106356 3300027671 Unclassified 902
252 Ga0265356_1000340 3300028017 Bacteria 8569
253 Ga0268266_10000145 3300028379 Bacteria 135284
254 Ga0268264_10011143 3300028381 Bacteria 7427
255 Ga0268264_10053878 3300028381 Bacteria 3357
256 Ga0268264_10258185 3300028381 Bacteria 1622
257 Ga0265762_1003070 3300030760 Unclassified 2985
258 Ga0265760_10000089 3300031090 Bacteria 23460
259 Ga0307408_100900438 3300031548 Bacteria 810
260 Ga0307508_10193946 3300031616 Unclassified 1633
261 Ga0307413_10284669 3300031824 Bacteria 1245
262 Ga0307414_10055865 3300032004 Bacteria 2766
263 Ga0307415_100728082 3300032126 Bacteria 898
264 Ga0373926_0012899 3300035083 Bacteria 2830
265 Ga0373936_0124234 3300035113 Bacteria 1105
266 Ga0373945_0063814 3300035116 Bacteria 1380
267 Ga0373943_0009121 3300035170 Bacteria 4447
268 Ga0373955_0358903 3300035172 Unclassified 883
269 Ga0373961_0035947 3300035241 Unclassified 1408
270 Ga0373935_0006531 3300035692 Bacteria 6967
271 Ga0373935_0100190 3300035692 Bacteria 1909
272 Ga0373927_0381044 3300035695 Unclassified 930
273 Ga0373947_0003387 3300035725 Bacteria 9432
274 Ga0373937_0053313 3300036401 Bacteria 3710
275 Ga0373937_0211772 3300036401 Bacteria 1824
276 Ga0373925_0003314 3300037068 Bacteria 12512
277 Ga0373925_0008962 3300037068 Bacteria 7292
278 Ga0436364_0537250 3300037853 Bacteria 1041
279 Ga0436364_1260136 3300037853 Bacteria 3599
280 Ga0436365_0569856 3300039437 Bacteria 936
281 Ga0436365_0910109 3300039437 Bacteria 7067
282 Ga0451577_0000001 3300042876 Bacteria 2461803
283 Ga0451577_1185103 3300042876 Bacteria 682
284 Ga0453684_1235925 3300044712 Unclassified 782
285 Ga0495580_0050512 3300046472 Bacteria 2941
286 Ga0495582_0000937 3300046473 Bacteria 16278
287 Ga0495630_0000893 3300046517 Bacteria 20878
288 Ga0495630_0184633 3300046517 Unclassified 1591
289 Ga0495666_0034394 3300046526 Bacteria 2474
290 Ga0495665_0000475 3300046531 Bacteria 20220
291 Ga0495640_0056695 3300046533 Bacteria 2676
292 Ga0495586_0026716 3300046535 Unclassified 3090
293 Ga0495667_0107690 3300046559 Unclassified 1801
294 Ga0495669_0097534 3300046684 Bacteria 1363
295 Ga0495624_0015055 3300046690 Bacteria 5236
296 Ga0495581_0100074 3300047315 Bacteria 1684
297 Ga0495675_0400805 3300047444 Unclassified 800
298 Ga0495684_0012417 3300047471 Bacteria 6569
299 Ga0496108_0743917 3300048911 Unclassified 848
300 Ga0496109_0127031 3300048912 Bacteria 2378
301 Ga0496110_0075676 3300048913 Bacteria 2992
302 Ga0496116_0009344 3300048919 Bacteria 8373
303 Ga0496122_0101716 3300048925 Bacteria 1918
304 Ga0496126_0003087 3300048929 Bacteria 21537
305 Ga0495682_0029276 3300049460 Bacteria 2040
306 Ga0501046_0291323 3300049580 Bacteria 1194
307 Ga0501072_0033558 3300049588 Bacteria 4022
308 Ga0501075_0029757 3300049591 Bacteria 4040
309 Ga0501076_0090368 3300049592 Bacteria 2463
310 Ga0501257_001565 3300049686 Bacteria 4773
311 Ga0501080_0031022 3300049742 Bacteria 4981
312 Ga0501081_0000533 3300049743 Bacteria 21486
313 nmdc:mga05p37_11751_c1 3300050507 Bacteria 10438
314 nmdc:mga05p37_57011_c1 3300050507 Bacteria 4811
315 nmdc:mga09592_399840_c1 3300050508 Unclassified 1187
316 nmdc:mga06r32_44732_c1 3300050510 Unclassified 4217
317 nmdc:mga08y16_641533_c1 3300050511 Unclassified 1067
318 nmdc:mga0n895_1066270_c1 3300050512 Unclassified 787
319 nmdc:mga0n895_477541_c1 3300050512 Bacteria 1257
320 nmdc:mga0rr50_3115_c1 3300050513 Bacteria 9477
321 nmdc:mga0rr50_409137_c1 3300050513 Bacteria 1147
322 nmdc:mga0rr50_60210_c1 3300050513 Bacteria 2855
323 nmdc:mga08x19_24143_c1 3300050514 Bacteria 3775
324 nmdc:mga08x19_39166_c1 3300050514 Bacteria 3013
325 nmdc:mga0a205_44586_c1 3300050515 Bacteria 4276
326 nmdc:mga0a205_764735_c1 3300050515 Bacteria 814
327 Ga0500583_0163998 3300053092 Unclassified 1107
328 Ga0501082_0387530 3300060353 Bacteria 1219
329 2512734196 2512564039 Bacteria 8739048
330 2888582370 2888578766 Bacteria 6743310
331 2889055371 2889049205 Bacteria 7524325
332 2929209463 2929206907 Bacteria 5918291
333 Ga0070661_100069251
334 rootH2_10073743
335 Ga0065712_10075877
336 Ga0065715_10091496
337 Ga0070658_10114846
338 Ga0070683_100001162
339 Ga0070683_100465262
340 Ga0068868_100001266
341 Ga0070660_100108718
342 Ga0070661_100020297
343 Ga0070661_100341457
344 Ga0070675_100394787
345 Ga0070671_100030976
346 Ga0070667_100151814
347 Ga0070714_100038948
348 Ga0070714_100114952
349 Ga0070714_100124459
350 Ga0070714_100533464
351 Ga0070714_100553242
352 Ga0070714_100623557
353 Ga0070713_100010555
354 Ga0070713_100313485
355 Ga0070710_10097538
356 Ga0070711_100001046
357 Ga0070711_100056058
358 Ga0070711_100108799
359 Ga0070711_100150769
360 Ga0070694_100274021
361 Ga0070708_100067017
362 Ga0070708_100387190
363 Ga0070708_100525110
364 Ga0070706_100014497
365 Ga0070706_100060049
366 Ga0070706_100213990
367 Ga0070707_100009833
368 Ga0070698_100004052
369 Ga0070699_100114036
370 Ga0070699_100275356
371 Ga0070699_100620248
372 Ga0070684_100001657
373 Ga0070684_100007132
374 Ga0070697_100147748
375 Ga0070697_100340229
376 Ga0068853_100001336
377 Ga0068853_100024555
378 Ga0068853_100125783
379 Ga0070686_100523768
380 Ga0070665_100000085
381 Ga0070704_100498337
382 Ga0068855_100012686
383 Ga0068855_100040066
384 Ga0068855_100288133
385 Ga0068855_100440446
386 Ga0070664_100222493
387 Ga0070664_100436083
388 Ga0070664_100541880
389 Ga0068857_100000870
390 Ga0068857_100036245
391 Ga0068854_100061141
392 Ga0068856_100002738
393 Ga0068856_100006061
394 Ga0068856_100007238
395 Ga0068856_100186520
396 Ga0068852_100001018
397 Ga0068852_100015642
398 Ga0068859_100050732
399 Ga0068859_100212081
400 Ga0068864_100495656
401 Ga0068851_10002819
402 Ga0068851_10021001
403 Ga0068851_10272550
404 Ga0068863_100000455
405 Ga0068863_100370247
406 Ga0068863_100370627
407 Ga0068858_100011907
408 Ga0068860_100001340
409 Ga0068860_100289294
410 Ga0070717_10002559
411 Ga0070717_10003070
412 Ga0070717_10409245
413 Ga0070715_10112898
414 Ga0070716_100204067
415 Ga0070712_100000196
416 Ga0070712_100026640
417 Ga0070712_100055081
418 Ga0097621_100004990
419 Ga0097621_100048321
420 Ga0097621_100208515
421 Ga0068871_100001078
422 Ga0068871_100344847
423 Ga0068871_100387188
424 Ga0075431_100008940
425 Ga0075434_100021758
426 Ga0075434_100067651
427 Ga0075436_100000421
428 Ga0097620_100050734
429 Ga0097620_100212064
430 Ga0075435_100000835
431 Ga0099794_10002725
432 Ga0099794_10063764
433 Ga0105240_10000001
434 Ga0105240_10001213
435 Ga0105240_10012837
436 Ga0105240_10030881
437 Ga0105240_10040530
438 Ga0105240_10804677
439 Ga0111539_10697431
440 Ga0105245_10000532
441 Ga0105245_10160688
442 Ga0105245_10248271
443 Ga0105245_10446553
444 Ga0105247_10004315
445 Ga0114129_10039390
446 Ga0114129_10052253
447 Ga0105243_10036224
448 Ga0105241_10002052
449 Ga0105241_10003068
450 Ga0105242_10203587
451 Ga0105248_10000432
452 Ga0105248_10219998
453 Ga0105248_10284920
454 Ga0105248_10296590
455 Ga0105237_10036134
456 Ga0105237_10057060
457 Ga0105237_10099162
458 Ga0105237_10233833
459 Ga0105237_10305793
460 Ga0105238_10002746
461 Ga0105238_10007165
462 Ga0105238_10167672
463 Ga0105238_10224836
464 Ga0105238_10777514
465 Ga0105249_10035313
466 Ga0105249_10254345
467 Ga0099796_10005903
468 Ga0105239_10003678
469 Ga0105239_10010762
470 Ga0105239_10448462
471 Ga0105239_11010314
472 Ga0105246_10001615
473 Ga0105246_10078675
474 Ga0105246_10370958
475 Ga0157373_10371135
476 Ga0157369_10005542
477 Ga0157369_10005978
478 Ga0157369_10073741
479 Ga0157369_10191371
480 Ga0157369_10277659
481 Ga0157374_10005569
482 Ga0157374_10464237
483 Ga0157374_10465037
484 Ga0157378_10014237
485 Ga0157378_10047848
486 Ga0157378_10182243
487 Ga0163162_10839566
488 Ga0157372_10013285
489 Ga0157372_10045418
490 Ga0157372_10050056
491 Ga0157372_10054681
492 Ga0157372_10060793
493 Ga0157372_10187954
494 Ga0157372_10423075
495 Ga0157372_10849436
496 Ga0157372_11312893
497 Ga0163163_10000396
498 Ga0157379_10044125
499 Ga0157376_10002999
500 Ga0157376_10048070
501 Ga0224570_100372
502 Ga0228598_1000944
503 Ga0228598_1001264
504 Ga0209675_1049124
505 Ga0207656_10042558
506 Ga0207656_10225592
507 Ga0207710_10092713
508 Ga0207685_10009583
509 Ga0207685_10054352
510 Ga0207705_10090725
511 Ga0207684_10394667
512 Ga0207684_10433454
513 Ga0207654_10000675
514 Ga0207654_10001415
515 Ga0207654_10049349
516 Ga0207695_10000001
517 Ga0207695_10000063
518 Ga0207695_10002364
519 Ga0207695_10042521
520 Ga0207695_10560209
521 Ga0207695_10756324
522 Ga0207671_10001836
523 Ga0207671_10001923
524 Ga0207671_10049622
525 Ga0207671_10343135
526 Ga0207693_10000221
527 Ga0207693_10005184
528 Ga0207693_10283403
529 Ga0207663_10003561
530 Ga0207663_10089463
531 Ga0207649_10012350
532 Ga0207649_10056411
533 Ga0207649_10374379
534 Ga0207646_10001550
535 Ga0207646_10005652
536 Ga0207694_10000429
537 Ga0207694_10000943
538 Ga0207694_10009849
539 Ga0207694_10267026
540 Ga0207694_10330961
541 Ga0207650_10005037
542 Ga0207659_10861667
543 Ga0207687_10002191
544 Ga0207687_10031055
545 Ga0207687_10077946
546 Ga0207700_10231225
547 Ga0207700_10272992
548 Ga0207664_10019920
549 Ga0207664_10026499
550 Ga0207664_10047832
551 Ga0207664_10056643
552 Ga0207644_10014827
553 Ga0207644_10093990
554 Ga0207686_10094652
555 Ga0207709_10110360
556 Ga0207665_10028268
557 Ga0207665_10143041
558 Ga0207665_10190763
559 Ga0207711_10015988
560 Ga0207711_10248139
561 Ga0207689_10001181
562 Ga0207661_10001470
563 Ga0207679_10430898
564 Ga0207667_10000253
565 Ga0207667_10006161
566 Ga0207658_10361532
567 Ga0207677_10001506
568 Ga0207677_10062966
569 Ga0207677_10947963
570 Ga0207703_10091123
571 Ga0207639_10000614
572 Ga0207639_10013701
573 Ga0207702_10002766
574 Ga0207702_10003964
575 Ga0207702_10198844
576 Ga0207641_10332759
577 Ga0207676_10177389
578 Ga0207674_10000488
579 Ga0207674_10012186
580 Ga0207698_10000403
581 Ga0207698_10015668
582 Ga0207698_10425687
583 Ga0209588_1106356
584 Ga0265356_1000340
585 Ga0268266_10000145
586 Ga0268264_10011143
587 Ga0268264_10053878
588 Ga0268264_10258185
589 Ga0265762_1003070
590 Ga0265760_10000089
591 Ga0307408_100900438
592 Ga0307508_10193946
593 Ga0307413_10284669
594 Ga0307414_10055865
595 Ga0307415_100728082
596 Ga0373926_0012899
597 Ga0373936_0124234
598 Ga0373945_0063814
599 Ga0373943_0009121
600 Ga0373955_0358903
601 Ga0373961_0035947
602 Ga0373935_0006531
603 Ga0373935_0100190
604 Ga0373927_0381044
605 Ga0373947_0003387
606 Ga0373937_0053313
607 Ga0373937_0211772
608 Ga0373925_0003314
609 Ga0373925_0008962
610 Ga0436364_0537250
611 Ga0436364_1260136
612 Ga0436365_0569856
613 Ga0436365_0910109
614 Ga0451577_0000001
615 Ga0451577_1185103
616 Ga0453684_1235925
617 Ga0495580_0050512
618 Ga0495582_0000937
619 Ga0495630_0000893
620 Ga0495630_0184633
621 Ga0495666_0034394
622 Ga0495665_0000475
623 Ga0495640_0056695
624 Ga0495586_0026716
625 Ga0495667_0107690
626 Ga0495669_0097534
627 Ga0495624_0015055
628 Ga0495581_0100074
629 Ga0495675_0400805
630 Ga0495684_0012417
631 Ga0496108_0743917
632 Ga0496109_0127031
633 Ga0496110_0075676
634 Ga0496116_0009344
635 Ga0496122_0101716
636 Ga0496126_0003087
637 Ga0495682_0029276
638 Ga0501046_0291323
639 Ga0501072_0033558
640 Ga0501075_0029757
641 Ga0501076_0090368
642 Ga0501257_001565
643 Ga0501080_0031022
644 Ga0501081_0000533
645 nmdc:mga05p37_11751_c1
646 nmdc:mga05p37_57011_c1
647 nmdc:mga09592_399840_c1
648 nmdc:mga06r32_44732_c1
649 nmdc:mga08y16_641533_c1
650 nmdc:mga0n895_1066270_c1
651 nmdc:mga0n895_477541_c1
652 nmdc:mga0rr50_3115_c1
653 nmdc:mga0rr50_409137_c1
654 nmdc:mga0rr50_60210_c1
655 nmdc:mga08x19_24143_c1
656 nmdc:mga08x19_39166_c1
657 nmdc:mga0a205_44586_c1
658 nmdc:mga0a205_764735_c1
659 Ga0500583_0163998
660 Ga0501082_0387530
661 2512734196
662 2888582370
663 2889055371
664 2929209463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13761

DUF4166

Domain of unknown function (DUF4166)

25

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u65-assembly1.cif.gz_G structure of e. coli dgtpase bound to t7 bacteriophage protein gp1.2 0.7512 166 201
4wmc-assembly4.cif.gz_G oxa-48 covalent complex with avibactam inhibitor 0.6384 162 201
6bsr-assembly1.cif.gz_A crystal structure of penicillin-binding protein 4 (pbp4) from enterococcus faecalis in the benzylpenicillin bound form. 0.6368 162 199
3wjd-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin f44w/m75l/h76l/q96c/m148l/h158l (nb5) from arabidopsis thaliana 0.6253 33 201
3wjg-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana 0.6251 33 201
ID Description Score Start End Superfamily
af_A0A0P0X025_51_179_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.755 166 203 3.30.420.10
af_Q8IBF8_742_856_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.7442 162 199 3.30.310.10
af_Q9VEV6_164_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7089 164 201 3.10.129.10
af_A0A0R0L0A6_36_134_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7018 168 199 3.30.420.10
af_A0A0R0KFV8_169_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6756 166 199 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7W7ZJN4-F1-model_v4 DUF4166 domain-containing protein 0.9858 63 225
AF-E0I654-F1-model_v4 DUF4166 domain-containing protein 0.9856 1 225
AF-A0A7V9B3Q9-F1-model_v4 DUF4166 domain-containing protein 0.9855 1 225
AF-A0A2A5LMY8-F1-model_v4 deleted 0.9844 1 225
AF-A0A5Q2RQG9-F1-model_v4 DUF4166 domain-containing protein 0.9842 1 224

Map