F410780

General Info

Members Datasets Scaffolds Average Seq Length
332 233 664 96

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10093263|Ga0065712_100932632
Length 107
Sequence VETCNLSILNALGLHARAAAKFVHTAGRFAAHIRVARGDREVDGKSIMGLLLLAAAQGSSIRISADGPDEADAISALCSLVERGFDEGPSDPAPGRPSGKAQGGPCD

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 1.81
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10093263 3300005290 Bacteria 2299
2 Ga0065715_10068484 3300005293 Bacteria 720
3 Ga0065715_10751777 3300005293 Bacteria 630
4 Ga0065707_10104737 3300005295 Bacteria 2680
5 Ga0070683_100060918 3300005329 Bacteria 3508
6 Ga0070690_101408760 3300005330 Bacteria 561
7 Ga0070670_100081094 3300005331 Bacteria 2788
8 Ga0070670_100471539 3300005331 Bacteria 1114
9 Ga0070677_10213611 3300005333 Bacteria 938
10 Ga0070677_10475502 3300005333 Bacteria 673
11 Ga0070677_10739663 3300005333 Bacteria 557
12 Ga0068869_100028759 3300005334 Bacteria 3888
13 Ga0070666_10285831 3300005335 Unclassified 1173
14 Ga0070682_100332019 3300005337 Bacteria 1127
15 Ga0068868_100188540 3300005338 Bacteria 1714
16 Ga0070660_100272783 3300005339 Bacteria 1383
17 Ga0070660_101604143 3300005339 Bacteria 554
18 Ga0070689_100016344 3300005340 Bacteria 5431
19 Ga0070689_101548349 3300005340 Bacteria 601
20 Ga0070691_10305183 3300005341 Bacteria 871
21 Ga0070691_10787260 3300005341 Bacteria 578
22 Ga0070687_100224425 3300005343 Bacteria 1153
23 Ga0070687_101328699 3300005343 Bacteria 535
24 Ga0070661_100203675 3300005344 Bacteria 1513
25 Ga0070661_101010262 3300005344 Unclassified 690
26 Ga0070661_101387300 3300005344 Unclassified 591
27 Ga0070692_10101175 3300005345 Bacteria 1580
28 Ga0070669_100128481 3300005353 Bacteria 1941
29 Ga0070669_101363949 3300005353 Bacteria 615
30 Ga0070675_100100102 3300005354 Bacteria 2441
31 Ga0070675_100143736 3300005354 Bacteria 2041
32 Ga0070671_100209917 3300005355 Bacteria 1651
33 Ga0070674_101669714 3300005356 Bacteria 576
34 Ga0070673_100029469 3300005364 Bacteria 4093
35 Ga0070688_100201207 3300005365 Bacteria 1393
36 Ga0070659_100760346 3300005366 Bacteria 841
37 Ga0070659_101449182 3300005366 Unclassified 611
38 Ga0070667_100080279 3300005367 Bacteria 2790
39 Ga0070703_10448195 3300005406 Bacteria 571
40 Ga0070713_100072818 3300005436 Bacteria 2907
41 Ga0070701_10114778 3300005438 Bacteria 1510
42 Ga0070705_100527510 3300005440 Bacteria 901
43 Ga0070705_100551723 3300005440 Bacteria 884
44 Ga0070700_100011020 3300005441 Bacteria 4999
45 Ga0070694_100243796 3300005444 Bacteria 1356
46 Ga0070694_101195705 3300005444 Bacteria 637
47 Ga0070663_100407909 3300005455 Unclassified 1112
48 Ga0070663_100622484 3300005455 Bacteria 910
49 Ga0070678_100073003 3300005456 Bacteria 2574
50 Ga0070678_101090263 3300005456 Unclassified 737
51 Ga0070662_100602488 3300005457 Bacteria 924
52 Ga0068867_100015705 3300005459 Bacteria 5373
53 Ga0070706_100663377 3300005467 Bacteria 968
54 Ga0070707_100977658 3300005468 Bacteria 812
55 Ga0070699_100183354 3300005518 Bacteria 1858
56 Ga0070699_100224968 3300005518 Bacteria 1673
57 Ga0070679_100294494 3300005530 Bacteria 1574
58 Ga0070679_100688477 3300005530 Bacteria 965
59 Ga0070684_100031787 3300005535 Bacteria 4496
60 Ga0068853_100722495 3300005539 Bacteria 951
61 Ga0070672_100025584 3300005543 Bacteria 4381
62 Ga0070686_100456279 3300005544 Bacteria 984
63 Ga0070686_100695272 3300005544 Bacteria 810
64 Ga0070695_100456150 3300005545 Bacteria 980
65 Ga0070693_100091063 3300005547 Bacteria 1838
66 Ga0070704_100127556 3300005549 Bacteria 1966
67 Ga0068855_101408490 3300005563 Bacteria 718
68 Ga0070664_101224837 3300005564 Bacteria 708
69 Ga0068857_102043711 3300005577 Bacteria 562
70 Ga0068857_102117017 3300005577 Unclassified 552
71 Ga0070702_100105287 3300005615 Bacteria 1738
72 Ga0068852_101094263 3300005616 Unclassified 817
73 Ga0068852_101609919 3300005616 Unclassified 672
74 Ga0068859_100418883 3300005617 Bacteria 1435
75 Ga0068859_102393078 3300005617 Bacteria 582
76 Ga0068864_100053501 3300005618 Bacteria 3483
77 Ga0068864_102264321 3300005618 Bacteria 550
78 Ga0068866_10166960 3300005718 Bacteria 1289
79 Ga0068861_100224493 3300005719 Bacteria 1589
80 Ga0068851_10112927 3300005834 Bacteria 1452
81 Ga0068858_100238840 3300005842 Bacteria 1723
82 Ga0068860_100659500 3300005843 Bacteria 1054
83 Ga0075365_10000848 3300006038 Bacteria 12684
84 Ga0075365_10336793 3300006038 Bacteria 1063
85 Ga0075368_10114395 3300006042 Bacteria 1114
86 Ga0075364_10007595 3300006051 Bacteria 6446
87 Ga0075364_10029208 3300006051 Bacteria 3535
88 Ga0075364_10036090 3300006051 Bacteria 3196
89 Ga0075362_10040376 3300006177 Bacteria 2054
90 Ga0075367_10041831 3300006178 Bacteria 2680
91 Ga0075369_10348081 3300006186 Bacteria 695
92 Ga0075366_10005033 3300006195 Bacteria 7140
93 Ga0075366_10039086 3300006195 Bacteria 2803
94 Ga0097621_100727879 3300006237 Bacteria 915
95 Ga0075430_100004410 3300006846 Bacteria 11881
96 Ga0075430_100020167 3300006846 Bacteria 5672
97 Ga0075430_100088170 3300006846 Bacteria 2596
98 Ga0075430_100864697 3300006846 Bacteria 745
99 Ga0075430_100996749 3300006846 Bacteria 690
100 Ga0075431_100005306 3300006847 Bacteria 12703
101 Ga0075431_100068582 3300006847 Bacteria 3660
102 Ga0075431_100196155 3300006847 Bacteria 2067
103 Ga0075431_100537511 3300006847 Bacteria 1157
104 Ga0075433_10529714 3300006852 Bacteria 1036
105 Ga0075433_10554348 3300006852 Bacteria 1010
106 Ga0075433_11074705 3300006852 Bacteria 700
107 Ga0075433_11535762 3300006852 Bacteria 575
108 Ga0075434_100566179 3300006871 Bacteria 1156
109 Ga0075434_101206158 3300006871 Bacteria 769
110 Ga0075429_100063222 3300006880 Bacteria 3225
111 Ga0068865_100629739 3300006881 Bacteria 909
112 Ga0075436_100070855 3300006914 Bacteria 2410
113 Ga0097620_100418893 3300006931 Bacteria 1435
114 Ga0097620_102392865 3300006931 Bacteria 582
115 Ga0075435_100001145 3300007076 Bacteria 16933
116 Ga0105240_10207455 3300009093 Bacteria 2292
117 Ga0105240_10578810 3300009093 Bacteria 1239
118 Ga0111539_10239549 3300009094 Bacteria 2112
119 Ga0105245_10257498 3300009098 Bacteria 1697
120 Ga0114129_10005595 3300009147 Bacteria 17784
121 Ga0114129_10107265 3300009147 Bacteria 3858
122 Ga0105243_11101058 3300009148 Bacteria 803
123 Ga0105243_11879397 3300009148 Bacteria 631
124 Ga0105241_10110619 3300009174 Bacteria 2198
125 Ga0105242_10151603 3300009176 Bacteria 2021
126 Ga0105248_10865296 3300009177 Bacteria 1020
127 Ga0105248_11870384 3300009177 Bacteria 681
128 Ga0105238_12605067 3300009551 Unclassified 542
129 Ga0105249_11961147 3300009553 Bacteria 658
130 Ga0105239_10924394 3300010375 Unclassified 1002
131 Ga0157378_10669028 3300013297 Bacteria 1055
132 Ga0157378_12816261 3300013297 Bacteria 539
133 Ga0157372_10795649 3300013307 Bacteria 1099
134 Ga0157375_10979796 3300013308 Bacteria 986
135 Ga0163163_10054834 3300014325 Bacteria 3939
136 Ga0163163_10208237 3300014325 Bacteria 2004
137 Ga0163163_10474825 3300014325 Bacteria 1311
138 Ga0157377_11169856 3300014745 Bacteria 593
139 Ga0157376_11144732 3300014969 Unclassified 805
140 Ga0206356_11796310 3300020070 Bacteria 982
141 Ga0207697_10081976 3300025315 Bacteria 1359
142 Ga0207682_10405424 3300025893 Bacteria 644
143 Ga0207682_10493817 3300025893 Bacteria 580
144 Ga0207688_10073117 3300025901 Bacteria 1948
145 Ga0207647_10074134 3300025904 Bacteria 2050
146 Ga0207645_10003667 3300025907 Bacteria 11592
147 Ga0207645_10697339 3300025907 Bacteria 690
148 Ga0207684_10444609 3300025910 Bacteria 1113
149 Ga0207654_10304163 3300025911 Bacteria 1085
150 Ga0207695_10144230 3300025913 Bacteria 2327
151 Ga0207662_10000564 3300025918 Bacteria 16458
152 Ga0207657_10179381 3300025919 Bacteria 1713
153 Ga0207657_10631482 3300025919 Bacteria 834
154 Ga0207649_11046806 3300025920 Unclassified 643
155 Ga0207652_10621129 3300025921 Bacteria 968
156 Ga0207652_10678913 3300025921 Unclassified 920
157 Ga0207694_10686344 3300025924 Bacteria 863
158 Ga0207650_10174245 3300025925 Bacteria 1711
159 Ga0207650_10231427 3300025925 Bacteria 1491
160 Ga0207659_10286014 3300025926 Bacteria 1349
161 Ga0207687_10464803 3300025927 Bacteria 1051
162 Ga0207700_10049893 3300025928 Bacteria 3115
163 Ga0207690_10782348 3300025932 Bacteria 788
164 Ga0207706_10028790 3300025933 Bacteria 4959
165 Ga0207706_11619700 3300025933 Bacteria 524
166 Ga0207709_11221663 3300025935 Bacteria 620
167 Ga0207670_10046760 3300025936 Bacteria 2877
168 Ga0207670_10507627 3300025936 Bacteria 980
169 Ga0207669_10487738 3300025937 Unclassified 984
170 Ga0207669_10915260 3300025937 Bacteria 733
171 Ga0207691_10110687 3300025940 Bacteria 2443
172 Ga0207711_10016632 3300025941 Bacteria 6108
173 Ga0207689_10060847 3300025942 Bacteria 3105
174 Ga0207689_10577165 3300025942 Bacteria 945
175 Ga0207661_10007300 3300025944 Bacteria 7863
176 Ga0207661_11286917 3300025944 Unclassified 672
177 Ga0207679_10320687 3300025945 Bacteria 1341
178 Ga0207679_10591542 3300025945 Bacteria 999
179 Ga0207679_12002088 3300025945 Bacteria 527
180 Ga0207667_10143020 3300025949 Bacteria 2463
181 Ga0207667_10416583 3300025949 Bacteria 1367
182 Ga0207651_10022717 3300025960 Bacteria 3842
183 Ga0207712_10094736 3300025961 Bacteria 2206
184 Ga0207712_11938699 3300025961 Bacteria 527
185 Ga0207640_10199796 3300025981 Bacteria 1514
186 Ga0207677_10217337 3300026023 Bacteria 1530
187 Ga0207703_10153303 3300026035 Bacteria 2011
188 Ga0207678_10217676 3300026067 Unclassified 1634
189 Ga0207678_10565222 3300026067 Bacteria 995
190 Ga0207708_10004265 3300026075 Bacteria 10529
191 Ga0207641_10305594 3300026088 Bacteria 1504
192 Ga0207641_11091747 3300026088 Bacteria 796
193 Ga0207641_11807091 3300026088 Bacteria 613
194 Ga0207648_10035239 3300026089 Bacteria 4409
195 Ga0207675_100025775 3300026118 Bacteria 5472
196 Ga0207675_102422153 3300026118 Bacteria 537
197 Ga0207683_10100500 3300026121 Bacteria 2582
198 Ga0209813_10073804 3300027866 Bacteria 1114
199 Ga0207428_10310303 3300027907 Bacteria 1166
200 Ga0268266_10805122 3300028379 Bacteria 908
201 Ga0268265_10724143 3300028380 Bacteria 963
202 Ga0316576_11124856 3300031727 Unclassified 556
203 Ga0307405_10156287 3300031731 Bacteria 1610
204 Ga0316577_10342865 3300031733 Unclassified 848
205 Ga0307413_12105580 3300031824 Unclassified 510
206 Ga0307410_11008322 3300031852 Bacteria 718
207 Ga0307412_11927407 3300031911 Bacteria 546
208 Ga0307416_100577395 3300032002 Unclassified 1201
209 Ga0307416_101021564 3300032002 Bacteria 930
210 Ga0307416_101387186 3300032002 Bacteria 808
211 Ga0307416_103603487 3300032002 Bacteria 518
212 Ga0307411_10527155 3300032005 Bacteria 1004
213 Ga0373930_0189811 3300034816 Bacteria 531
214 Ga0373958_0193871 3300034819 Bacteria 529
215 Ga0373940_0241634 3300035088 Bacteria 606
216 Ga0373952_0225705 3300035092 Bacteria 558
217 Ga0373923_0479122 3300035111 Bacteria 605
218 Ga0373932_0089766 3300035112 Bacteria 984
219 Ga0373936_0054588 3300035113 Bacteria 1621
220 Ga0373954_0132957 3300035118 Bacteria 1212
221 Ga0373956_0547775 3300035119 Bacteria 552
222 Ga0373957_0072856 3300035120 Bacteria 1346
223 Ga0373957_0413480 3300035120 Bacteria 581
224 Ga0373943_0229618 3300035170 Bacteria 1036
225 Ga0373946_0651707 3300035171 Bacteria 548
226 Ga0373942_0350443 3300035207 Bacteria 522
227 Ga0373961_0125309 3300035241 Bacteria 855
228 Ga0373924_0296238 3300035410 Bacteria 718
229 Ga0373931_0236629 3300035691 Bacteria 1105
230 Ga0373935_0514272 3300035692 Bacteria 870
231 Ga0373933_0980996 3300035724 Bacteria 556
232 Ga0373947_0161059 3300035725 Bacteria 1451
233 Ga0373947_0282972 3300035725 Bacteria 1103
234 Ga0373937_0011799 3300036401 Bacteria 7669
235 Ga0373925_0013384 3300037068 Bacteria 5937
236 Ga0373925_0611128 3300037068 Bacteria 898
237 Ga0451807_0406995 3300041486 Bacteria 621
238 Ga0451853_0953190 3300041512 Bacteria 709
239 Ga0439456_086661 3300042013 Bacteria 702
240 Ga0439456_138408 3300042013 Unclassified 564
241 Ga0439462_0155534 3300042015 Bacteria 644
242 Ga0450894_018582 3300042131 Unclassified 930
243 Ga0439446_0102483 3300042156 Unclassified 906
244 Ga0439435_0004602 3300042436 Bacteria 2983
245 Ga0439460_0072488 3300042461 Bacteria 1069
246 Ga0495629_0376762 3300046459 Bacteria 966
247 Ga0495653_0485044 3300046463 Bacteria 773
248 Ga0495639_0548975 3300046475 Unclassified 592
249 Ga0495635_0319744 3300046663 Bacteria 1039
250 Ga0495674_1230777 3300047319 Bacteria 564
251 Ga0495680_0420186 3300047322 Unclassified 920
252 Ga0495684_0666332 3300047471 Bacteria 694
253 Ga0496107_0264100 3300048910 Bacteria 1281
254 Ga0496109_0319446 3300048912 Bacteria 1465
255 Ga0496109_0532003 3300048912 Bacteria 1109
256 Ga0496112_0278580 3300048915 Bacteria 1620
257 Ga0496113_0129421 3300048916 Bacteria 1980
258 Ga0501031_0225268 3300049568 Bacteria 1220
259 Ga0501033_0157824 3300049570 Bacteria 1634
260 Ga0501034_0483459 3300049571 Bacteria 1153
261 Ga0501036_0018743 3300049572 Bacteria 5805
262 Ga0501036_0519922 3300049572 Bacteria 990
263 Ga0501038_0144418 3300049574 Bacteria 1944
264 Ga0501039_0026174 3300049575 Bacteria 4483
265 Ga0501040_0012710 3300049576 Bacteria 5523
266 Ga0501040_0960744 3300049576 Unclassified 619
267 Ga0501041_0133365 3300049577 Bacteria 1547
268 Ga0501042_0016139 3300049578 Bacteria 5124
269 Ga0501047_0793840 3300049581 Bacteria 762
270 Ga0501048_0011914 3300049582 Bacteria 6484
271 Ga0501067_0187336 3300049583 Bacteria 1152
272 Ga0501068_0449182 3300049584 Bacteria 834
273 Ga0501069_0479270 3300049585 Bacteria 741
274 Ga0501070_1026131 3300049586 Bacteria 639
275 Ga0501071_0324409 3300049587 Bacteria 1169
276 Ga0501072_0055692 3300049588 Bacteria 3116
277 Ga0501073_0515136 3300049589 Bacteria 827
278 Ga0501074_0075260 3300049590 Bacteria 2424
279 Ga0501074_0348514 3300049590 Bacteria 1051
280 Ga0501075_0005883 3300049591 Bacteria 8387
281 Ga0501075_0248150 3300049591 Bacteria 1357
282 Ga0501076_0181173 3300049592 Bacteria 1717
283 Ga0501077_0067904 3300049593 Bacteria 2260
284 Ga0501077_0314645 3300049593 Bacteria 998
285 Ga0501079_0094577 3300049741 Bacteria 2315
286 Ga0501079_0153783 3300049741 Bacteria 1793
287 Ga0501079_0565027 3300049741 Bacteria 895
288 Ga0501080_0135270 3300049742 Bacteria 2281
289 Ga0501081_0634964 3300049743 Unclassified 800
290 Ga0501035_0542877 3300049822 Bacteria 953
291 Ga0501045_0171345 3300049824 Bacteria 1616
292 nmdc:mga03683_2722_c1 3300050489 Bacteria 5547
293 nmdc:mga00v17_108263_c1 3300050491 Bacteria 1761
294 nmdc:mga00v17_1201_c1 3300050491 Bacteria 13572
295 nmdc:mga0yw44_352389_c1 3300050492 Bacteria 991
296 nmdc:mga0yw44_71147_c1 3300050492 Bacteria 2159
297 nmdc:mga0k408_16286_c1 3300050493 Bacteria 4122
298 nmdc:mga0k408_67887_c1 3300050493 Bacteria 2079
299 nmdc:mga06z11_24546_c1 3300050494 Bacteria 2845
300 nmdc:mga06z11_902674_c1 3300050494 Bacteria 538
301 nmdc:mga04h51_20791_c1 3300050495 Bacteria 1965
302 nmdc:mga05p37_10066_c1 3300050507 Bacteria 11222
303 nmdc:mga05p37_33390_c1 3300050507 Bacteria 6303
304 nmdc:mga05p37_7973_c1 3300050507 Bacteria 12501
305 nmdc:mga09592_1400120_c1 3300050508 Archaea 572
306 nmdc:mga09592_157592_c1 3300050508 Bacteria 1960
307 nmdc:mga0qj67_10087_c1 3300050509 Bacteria 7048
308 nmdc:mga0qj67_195826_c1 3300050509 Bacteria 1642
309 nmdc:mga0qj67_248073_c1 3300050509 Bacteria 1445
310 nmdc:mga0qj67_821953_c1 3300050509 Bacteria 735
311 nmdc:mga06r32_1072445_c1 3300050510 Bacteria 756
312 nmdc:mga06r32_131866_c1 3300050510 Bacteria 2472
313 nmdc:mga06r32_25356_c1 3300050510 Bacteria 5516
314 nmdc:mga06r32_327962_c1 3300050510 Bacteria 1516
315 nmdc:mga08y16_274176_c1 3300050511 Bacteria 1741
316 nmdc:mga08y16_339211_c1 3300050511 Bacteria 1545
317 nmdc:mga0n895_147166_c1 3300050512 Bacteria 2385
318 nmdc:mga0n895_70568_c1 3300050512 Bacteria 3462
319 nmdc:mga0rr50_1326679_c1 3300050513 Bacteria 610
320 nmdc:mga0rr50_19361_c1 3300050513 Bacteria 4593
321 nmdc:mga08x19_102063_c1 3300050514 Bacteria 1904
322 nmdc:mga08x19_996423_c1 3300050514 Bacteria 595
323 nmdc:mga0a205_335108_c1 3300050515 Bacteria 1382
324 nmdc:mga0a205_592985_c1 3300050515 Bacteria 961
325 nmdc:mga0sz30_238151_c1 3300050516 Bacteria 810
326 Ga0495619_0246112 3300053085 Unclassified 1239
327 Ga0495619_0666808 3300053085 Bacteria 708
328 Ga0500628_151132 3300053129 Bacteria 649
329 Ga0501084_0474680 3300054114 Bacteria 1057
330 Ga0587111_0243085 3300060346 Unclassified 529
331 Ga0501082_0028112 3300060353 Bacteria 4846
332 Ga0530510_0027416 3300061734 Bacteria 4081
333 Ga0065712_10093263
334 Ga0065715_10068484
335 Ga0065715_10751777
336 Ga0065707_10104737
337 Ga0070683_100060918
338 Ga0070690_101408760
339 Ga0070670_100081094
340 Ga0070670_100471539
341 Ga0070677_10213611
342 Ga0070677_10475502
343 Ga0070677_10739663
344 Ga0068869_100028759
345 Ga0070666_10285831
346 Ga0070682_100332019
347 Ga0068868_100188540
348 Ga0070660_100272783
349 Ga0070660_101604143
350 Ga0070689_100016344
351 Ga0070689_101548349
352 Ga0070691_10305183
353 Ga0070691_10787260
354 Ga0070687_100224425
355 Ga0070687_101328699
356 Ga0070661_100203675
357 Ga0070661_101010262
358 Ga0070661_101387300
359 Ga0070692_10101175
360 Ga0070669_100128481
361 Ga0070669_101363949
362 Ga0070675_100100102
363 Ga0070675_100143736
364 Ga0070671_100209917
365 Ga0070674_101669714
366 Ga0070673_100029469
367 Ga0070688_100201207
368 Ga0070659_100760346
369 Ga0070659_101449182
370 Ga0070667_100080279
371 Ga0070703_10448195
372 Ga0070713_100072818
373 Ga0070701_10114778
374 Ga0070705_100527510
375 Ga0070705_100551723
376 Ga0070700_100011020
377 Ga0070694_100243796
378 Ga0070694_101195705
379 Ga0070663_100407909
380 Ga0070663_100622484
381 Ga0070678_100073003
382 Ga0070678_101090263
383 Ga0070662_100602488
384 Ga0068867_100015705
385 Ga0070706_100663377
386 Ga0070707_100977658
387 Ga0070699_100183354
388 Ga0070699_100224968
389 Ga0070679_100294494
390 Ga0070679_100688477
391 Ga0070684_100031787
392 Ga0068853_100722495
393 Ga0070672_100025584
394 Ga0070686_100456279
395 Ga0070686_100695272
396 Ga0070695_100456150
397 Ga0070693_100091063
398 Ga0070704_100127556
399 Ga0068855_101408490
400 Ga0070664_101224837
401 Ga0068857_102043711
402 Ga0068857_102117017
403 Ga0070702_100105287
404 Ga0068852_101094263
405 Ga0068852_101609919
406 Ga0068859_100418883
407 Ga0068859_102393078
408 Ga0068864_100053501
409 Ga0068864_102264321
410 Ga0068866_10166960
411 Ga0068861_100224493
412 Ga0068851_10112927
413 Ga0068858_100238840
414 Ga0068860_100659500
415 Ga0075365_10000848
416 Ga0075365_10336793
417 Ga0075368_10114395
418 Ga0075364_10007595
419 Ga0075364_10029208
420 Ga0075364_10036090
421 Ga0075362_10040376
422 Ga0075367_10041831
423 Ga0075369_10348081
424 Ga0075366_10005033
425 Ga0075366_10039086
426 Ga0097621_100727879
427 Ga0075430_100004410
428 Ga0075430_100020167
429 Ga0075430_100088170
430 Ga0075430_100864697
431 Ga0075430_100996749
432 Ga0075431_100005306
433 Ga0075431_100068582
434 Ga0075431_100196155
435 Ga0075431_100537511
436 Ga0075433_10529714
437 Ga0075433_10554348
438 Ga0075433_11074705
439 Ga0075433_11535762
440 Ga0075434_100566179
441 Ga0075434_101206158
442 Ga0075429_100063222
443 Ga0068865_100629739
444 Ga0075436_100070855
445 Ga0097620_100418893
446 Ga0097620_102392865
447 Ga0075435_100001145
448 Ga0105240_10207455
449 Ga0105240_10578810
450 Ga0111539_10239549
451 Ga0105245_10257498
452 Ga0114129_10005595
453 Ga0114129_10107265
454 Ga0105243_11101058
455 Ga0105243_11879397
456 Ga0105241_10110619
457 Ga0105242_10151603
458 Ga0105248_10865296
459 Ga0105248_11870384
460 Ga0105238_12605067
461 Ga0105249_11961147
462 Ga0105239_10924394
463 Ga0157378_10669028
464 Ga0157378_12816261
465 Ga0157372_10795649
466 Ga0157375_10979796
467 Ga0163163_10054834
468 Ga0163163_10208237
469 Ga0163163_10474825
470 Ga0157377_11169856
471 Ga0157376_11144732
472 Ga0206356_11796310
473 Ga0207697_10081976
474 Ga0207682_10405424
475 Ga0207682_10493817
476 Ga0207688_10073117
477 Ga0207647_10074134
478 Ga0207645_10003667
479 Ga0207645_10697339
480 Ga0207684_10444609
481 Ga0207654_10304163
482 Ga0207695_10144230
483 Ga0207662_10000564
484 Ga0207657_10179381
485 Ga0207657_10631482
486 Ga0207649_11046806
487 Ga0207652_10621129
488 Ga0207652_10678913
489 Ga0207694_10686344
490 Ga0207650_10174245
491 Ga0207650_10231427
492 Ga0207659_10286014
493 Ga0207687_10464803
494 Ga0207700_10049893
495 Ga0207690_10782348
496 Ga0207706_10028790
497 Ga0207706_11619700
498 Ga0207709_11221663
499 Ga0207670_10046760
500 Ga0207670_10507627
501 Ga0207669_10487738
502 Ga0207669_10915260
503 Ga0207691_10110687
504 Ga0207711_10016632
505 Ga0207689_10060847
506 Ga0207689_10577165
507 Ga0207661_10007300
508 Ga0207661_11286917
509 Ga0207679_10320687
510 Ga0207679_10591542
511 Ga0207679_12002088
512 Ga0207667_10143020
513 Ga0207667_10416583
514 Ga0207651_10022717
515 Ga0207712_10094736
516 Ga0207712_11938699
517 Ga0207640_10199796
518 Ga0207677_10217337
519 Ga0207703_10153303
520 Ga0207678_10217676
521 Ga0207678_10565222
522 Ga0207708_10004265
523 Ga0207641_10305594
524 Ga0207641_11091747
525 Ga0207641_11807091
526 Ga0207648_10035239
527 Ga0207675_100025775
528 Ga0207675_102422153
529 Ga0207683_10100500
530 Ga0209813_10073804
531 Ga0207428_10310303
532 Ga0268266_10805122
533 Ga0268265_10724143
534 Ga0316576_11124856
535 Ga0307405_10156287
536 Ga0316577_10342865
537 Ga0307413_12105580
538 Ga0307410_11008322
539 Ga0307412_11927407
540 Ga0307416_100577395
541 Ga0307416_101021564
542 Ga0307416_101387186
543 Ga0307416_103603487
544 Ga0307411_10527155
545 Ga0373930_0189811
546 Ga0373958_0193871
547 Ga0373940_0241634
548 Ga0373952_0225705
549 Ga0373923_0479122
550 Ga0373932_0089766
551 Ga0373936_0054588
552 Ga0373954_0132957
553 Ga0373956_0547775
554 Ga0373957_0072856
555 Ga0373957_0413480
556 Ga0373943_0229618
557 Ga0373946_0651707
558 Ga0373942_0350443
559 Ga0373961_0125309
560 Ga0373924_0296238
561 Ga0373931_0236629
562 Ga0373935_0514272
563 Ga0373933_0980996
564 Ga0373947_0161059
565 Ga0373947_0282972
566 Ga0373937_0011799
567 Ga0373925_0013384
568 Ga0373925_0611128
569 Ga0451807_0406995
570 Ga0451853_0953190
571 Ga0439456_086661
572 Ga0439456_138408
573 Ga0439462_0155534
574 Ga0450894_018582
575 Ga0439446_0102483
576 Ga0439435_0004602
577 Ga0439460_0072488
578 Ga0495629_0376762
579 Ga0495653_0485044
580 Ga0495639_0548975
581 Ga0495635_0319744
582 Ga0495674_1230777
583 Ga0495680_0420186
584 Ga0495684_0666332
585 Ga0496107_0264100
586 Ga0496109_0319446
587 Ga0496109_0532003
588 Ga0496112_0278580
589 Ga0496113_0129421
590 Ga0501031_0225268
591 Ga0501033_0157824
592 Ga0501034_0483459
593 Ga0501036_0018743
594 Ga0501036_0519922
595 Ga0501038_0144418
596 Ga0501039_0026174
597 Ga0501040_0012710
598 Ga0501040_0960744
599 Ga0501041_0133365
600 Ga0501042_0016139
601 Ga0501047_0793840
602 Ga0501048_0011914
603 Ga0501067_0187336
604 Ga0501068_0449182
605 Ga0501069_0479270
606 Ga0501070_1026131
607 Ga0501071_0324409
608 Ga0501072_0055692
609 Ga0501073_0515136
610 Ga0501074_0075260
611 Ga0501074_0348514
612 Ga0501075_0005883
613 Ga0501075_0248150
614 Ga0501076_0181173
615 Ga0501077_0067904
616 Ga0501077_0314645
617 Ga0501079_0094577
618 Ga0501079_0153783
619 Ga0501079_0565027
620 Ga0501080_0135270
621 Ga0501081_0634964
622 Ga0501035_0542877
623 Ga0501045_0171345
624 nmdc:mga03683_2722_c1
625 nmdc:mga00v17_108263_c1
626 nmdc:mga00v17_1201_c1
627 nmdc:mga0yw44_352389_c1
628 nmdc:mga0yw44_71147_c1
629 nmdc:mga0k408_16286_c1
630 nmdc:mga0k408_67887_c1
631 nmdc:mga06z11_24546_c1
632 nmdc:mga06z11_902674_c1
633 nmdc:mga04h51_20791_c1
634 nmdc:mga05p37_10066_c1
635 nmdc:mga05p37_33390_c1
636 nmdc:mga05p37_7973_c1
637 nmdc:mga09592_1400120_c1
638 nmdc:mga09592_157592_c1
639 nmdc:mga0qj67_10087_c1
640 nmdc:mga0qj67_195826_c1
641 nmdc:mga0qj67_248073_c1
642 nmdc:mga0qj67_821953_c1
643 nmdc:mga06r32_1072445_c1
644 nmdc:mga06r32_131866_c1
645 nmdc:mga06r32_25356_c1
646 nmdc:mga06r32_327962_c1
647 nmdc:mga08y16_274176_c1
648 nmdc:mga08y16_339211_c1
649 nmdc:mga0n895_147166_c1
650 nmdc:mga0n895_70568_c1
651 nmdc:mga0rr50_1326679_c1
652 nmdc:mga0rr50_19361_c1
653 nmdc:mga08x19_102063_c1
654 nmdc:mga08x19_996423_c1
655 nmdc:mga0a205_335108_c1
656 nmdc:mga0a205_592985_c1
657 nmdc:mga0sz30_238151_c1
658 Ga0495619_0246112
659 Ga0495619_0666808
660 Ga0500628_151132
661 Ga0501084_0474680
662 Ga0587111_0243085
663 Ga0501082_0028112
664 Ga0530510_0027416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

3

83

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.851 1 85
1cm3-assembly1.cif.gz_A his15asp hpr from e. coli 0.8465 1 81
4xwj-assembly1.cif.gz_B histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.8417 1 82
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.8384 1 81
1cm2-assembly1.cif.gz_A structure of his15asp hpr after hydrolysis of ringed species. 0.8381 1 81
ID Description Score Start End Superfamily
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8416 2 85 3.30.1340.10
3oqoD00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8333 2 84 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8267 1 83 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8144 4 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8138 1 79 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A352WI28-F1-model_v4 Phosphocarrier protein HPr 0.8599 1 83 GO:0005737
GO:0009401
AF-A0A1G5EIW2-F1-model_v4 deleted 0.8596 1 82
AF-A0A1T4LGU1-F1-model_v4 Phosphocarrier protein HPr 0.8552 1 85 GO:0005737
GO:0009401
AF-A0A239PII8-F1-model_v4 Phosphocarrier protein 0.8551 2 85 GO:0005737
GO:0009401
AF-A0A5Q4EN47-F1-model_v4 HPr family phosphocarrier protein 0.8543 2 85 GO:0005737
GO:0009401

Map