F410747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 247 | 662 | 280 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3006858327|3006859490 |
| Length | 318 |
| Sequence | AEKSFWKYCTILKGRVVLEWNGENSEVNKKQGDGEMKVLFNGRLMERSECAVDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDLSFSEAELKSQLKELVDINQMRDGGLYLQVTRGKAPRKHQYGAGLTPQVTAYTFPIQKPEKEQQNGVSAITADDMRWLRCDIKSLNLLYNVMIKQKAHEASSFEAILIRDGLVTEGTSSNVYVVKKNVIYTHPVTTLILNGITRMKVLQLCEQHGLNYEEKAVTKDELLNADEVFITSTTAEVIPVTSIDGQTIGSGAPGPLTKNVQTALQNSILSETAKPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 88 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 95 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 96 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 105 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 106 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 109 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 110 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 111 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 112 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 113 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 129 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 130 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 131 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 142 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 143 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 144 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 145 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 146 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 147 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 148 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 149 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 150 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 151 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 152 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 153 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 154 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 155 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 156 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 157 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 158 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 159 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 160 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 161 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 162 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 163 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 164 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 165 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 166 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 167 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 168 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 169 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 170 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 171 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 172 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 173 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 174 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 175 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 176 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 177 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 178 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 179 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 180 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 181 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 182 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 183 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 184 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 185 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 186 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 187 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 188 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 189 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 190 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 191 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 192 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 193 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 194 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 195 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 196 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 197 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 198 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 199 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 200 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 201 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 202 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 203 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 204 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 205 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 206 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 207 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 208 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 209 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 210 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 211 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 212 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 213 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 214 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 215 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 216 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 217 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 218 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 219 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 220 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 221 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 222 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 223 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 224 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 225 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 226 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 227 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 228 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 229 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 230 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 231 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 232 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 233 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 234 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 235 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 236 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 237 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 238 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 239 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 240 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 241 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 242 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 243 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 244 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 245 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 246 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 247 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.47 |
| Metatranscriptomes | 0.3 |
| Isolates | 33.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.69 |
| Nodule | 0 |
| Rhizoplane | 4.53 |
| Rhizosphere | 65.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1007941 | 3300002987 | Bacteria | 2975 |
| 2 | JGI25151J46595_10000009 | 3300003187 | Bacteria | 296412 |
| 3 | JGI25151J46595_10000521 | 3300003187 | Bacteria | 35852 |
| 4 | JGI25151J46595_10009101 | 3300003187 | Bacteria | 4730 |
| 5 | JGI25151J46595_10010832 | 3300003187 | Bacteria | 4219 |
| 6 | JGI25151J46595_10010899 | 3300003187 | Bacteria | 4203 |
| 7 | JGI25151J46595_10013393 | 3300003187 | Bacteria | 3690 |
| 8 | JGI25151J46595_10022297 | 3300003187 | Bacteria | 2632 |
| 9 | JGI25151J46595_10036982 | 3300003187 | Bacteria | 1835 |
| 10 | JGI25151J46595_10046794 | 3300003187 | Bacteria | 1512 |
| 11 | JGI25151J46595_10059045 | 3300003187 | Bacteria | 1237 |
| 12 | JGI25151J46595_10066245 | 3300003187 | Bacteria | 1119 |
| 13 | rootL2_10072818 | 3300003322 | Bacteria | 3078 |
| 14 | Ga0055538_1000327 | 3300003751 | Bacteria | 21906 |
| 15 | Ga0055532_1000078 | 3300003758 | Bacteria | 121493 |
| 16 | Ga0055536_1009440 | 3300003781 | Unclassified | 4034 |
| 17 | Ga0065704_10154542 | 3300005289 | Unclassified | 1402 |
| 18 | Ga0070676_10007013 | 3300005328 | Bacteria | 6033 |
| 19 | Ga0070683_100266066 | 3300005329 | Unclassified | 1631 |
| 20 | Ga0070690_100026379 | 3300005330 | Bacteria | 3584 |
| 21 | Ga0070670_100008454 | 3300005331 | Bacteria | 8781 |
| 22 | Ga0070666_10012188 | 3300005335 | Bacteria | 5417 |
| 23 | Ga0068868_100062282 | 3300005338 | Bacteria | 2956 |
| 24 | Ga0070687_100319822 | 3300005343 | Bacteria | 991 |
| 25 | Ga0070661_100065503 | 3300005344 | Bacteria | 2670 |
| 26 | Ga0070669_100093848 | 3300005353 | Bacteria | 2254 |
| 27 | Ga0070675_100000834 | 3300005354 | Bacteria | 21805 |
| 28 | Ga0070671_100030776 | 3300005355 | Bacteria | 4429 |
| 29 | Ga0070673_100000037 | 3300005364 | Bacteria | 55602 |
| 30 | Ga0070688_100048427 | 3300005365 | Unclassified | 2641 |
| 31 | Ga0070659_100075028 | 3300005366 | Bacteria | 2695 |
| 32 | Ga0070667_100005358 | 3300005367 | Bacteria | 10715 |
| 33 | Ga0070705_100096510 | 3300005440 | Bacteria | 1856 |
| 34 | Ga0070694_100057620 | 3300005444 | Bacteria | 2642 |
| 35 | Ga0070678_100014161 | 3300005456 | Bacteria | 5022 |
| 36 | Ga0070681_10011887 | 3300005458 | Bacteria | 8633 |
| 37 | Ga0068867_100051275 | 3300005459 | Bacteria | 3043 |
| 38 | Ga0070698_100044735 | 3300005471 | Bacteria | 4531 |
| 39 | Ga0070697_100024464 | 3300005536 | Bacteria | 4807 |
| 40 | Ga0070697_100224869 | 3300005536 | Bacteria | 1600 |
| 41 | Ga0070672_100000560 | 3300005543 | Bacteria | 21771 |
| 42 | Ga0070695_100036094 | 3300005545 | Bacteria | 3109 |
| 43 | Ga0070693_100097705 | 3300005547 | Bacteria | 1783 |
| 44 | Ga0070665_100085179 | 3300005548 | Bacteria | 3166 |
| 45 | Ga0070704_100120677 | 3300005549 | Bacteria | 2013 |
| 46 | Ga0070664_100006991 | 3300005564 | Bacteria | 9099 |
| 47 | Ga0068854_100224705 | 3300005578 | Unclassified | 1487 |
| 48 | Ga0070702_100015667 | 3300005615 | Bacteria | 3875 |
| 49 | Ga0097621_100007961 | 3300006237 | Bacteria | 7606 |
| 50 | Ga0068871_100015626 | 3300006358 | Bacteria | 5689 |
| 51 | Ga0075428_100263289 | 3300006844 | Bacteria | 1856 |
| 52 | Ga0075428_100534361 | 3300006844 | Bacteria | 1254 |
| 53 | Ga0075431_100015693 | 3300006847 | Bacteria | 7681 |
| 54 | Ga0075433_10289981 | 3300006852 | Bacteria | 1449 |
| 55 | Ga0075434_100087548 | 3300006871 | Bacteria | 3115 |
| 56 | Ga0075429_100065901 | 3300006880 | Bacteria | 3153 |
| 57 | Ga0075429_100079033 | 3300006880 | Bacteria | 2867 |
| 58 | Ga0068865_100088006 | 3300006881 | Bacteria | 2246 |
| 59 | Ga0105251_10007414 | 3300009011 | Bacteria | 6762 |
| 60 | Ga0105251_10074273 | 3300009011 | Bacteria | 1579 |
| 61 | Ga0105244_10004536 | 3300009036 | Bacteria | 9522 |
| 62 | Ga0105244_10012915 | 3300009036 | Bacteria | 4913 |
| 63 | Ga0105244_10072264 | 3300009036 | Bacteria | 1719 |
| 64 | Ga0105244_10099712 | 3300009036 | Bacteria | 1422 |
| 65 | Ga0105250_10002312 | 3300009092 | Bacteria | 9667 |
| 66 | Ga0105250_10003163 | 3300009092 | Bacteria | 7883 |
| 67 | Ga0105250_10020115 | 3300009092 | Bacteria | 2699 |
| 68 | Ga0105250_10029847 | 3300009092 | Bacteria | 2193 |
| 69 | Ga0105250_10062787 | 3300009092 | Bacteria | 1495 |
| 70 | Ga0111539_10000141 | 3300009094 | Bacteria | 82439 |
| 71 | Ga0114129_10007129 | 3300009147 | Bacteria | 15909 |
| 72 | Ga0114129_10141019 | 3300009147 | Bacteria | 3304 |
| 73 | Ga0157371_10012008 | 3300013102 | Bacteria | 6640 |
| 74 | Ga0157371_10021113 | 3300013102 | Bacteria | 4786 |
| 75 | Ga0157374_10025808 | 3300013296 | Bacteria | 5282 |
| 76 | Ga0157378_10001562 | 3300013297 | Bacteria | 20688 |
| 77 | Ga0163162_10045165 | 3300013306 | Bacteria | 4413 |
| 78 | Ga0157372_10210825 | 3300013307 | Bacteria | 2251 |
| 79 | Ga0157375_10015669 | 3300013308 | Bacteria | 6790 |
| 80 | Ga0157375_10049086 | 3300013308 | Bacteria | 4134 |
| 81 | Ga0157380_10001375 | 3300014326 | Bacteria | 15853 |
| 82 | Ga0157376_10001133 | 3300014969 | Bacteria | 17484 |
| 83 | Ga0157376_10003672 | 3300014969 | Bacteria | 10593 |
| 84 | Ga0213872_10000332 | 3300021361 | Bacteria | 40022 |
| 85 | Ga0213872_10111386 | 3300021361 | Bacteria | 1215 |
| 86 | Ga0209784_100784 | 3300025224 | Bacteria | 7614 |
| 87 | Ga0209147_100114 | 3300025229 | Bacteria | 144205 |
| 88 | Ga0209147_101620 | 3300025229 | Bacteria | 7522 |
| 89 | Ga0209147_102547 | 3300025229 | Bacteria | 4390 |
| 90 | Ga0209130_1000775 | 3300025284 | Bacteria | 27594 |
| 91 | Ga0209130_1003412 | 3300025284 | Bacteria | 6791 |
| 92 | Ga0209130_1006642 | 3300025284 | Bacteria | 3716 |
| 93 | Ga0209130_1011033 | 3300025284 | Bacteria | 2442 |
| 94 | Ga0209676_1000439 | 3300025292 | Bacteria | 71078 |
| 95 | Ga0209676_1003386 | 3300025292 | Bacteria | 9899 |
| 96 | Ga0209676_1005432 | 3300025292 | Bacteria | 6662 |
| 97 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 98 | Ga0209025_1000488 | 3300025294 | Bacteria | 76500 |
| 99 | Ga0209025_1000517 | 3300025294 | Bacteria | 73456 |
| 100 | Ga0209025_1000874 | 3300025294 | Bacteria | 47348 |
| 101 | Ga0209025_1001197 | 3300025294 | Bacteria | 36596 |
| 102 | Ga0209025_1005061 | 3300025294 | Bacteria | 10976 |
| 103 | Ga0209025_1007269 | 3300025294 | Bacteria | 8320 |
| 104 | Ga0209025_1010014 | 3300025294 | Bacteria | 6495 |
| 105 | Ga0209025_1011883 | 3300025294 | Bacteria | 5666 |
| 106 | Ga0209025_1013504 | 3300025294 | Bacteria | 5125 |
| 107 | Ga0209025_1019240 | 3300025294 | Bacteria | 3808 |
| 108 | Ga0209025_1027494 | 3300025294 | Bacteria | 2819 |
| 109 | Ga0209025_1037225 | 3300025294 | Bacteria | 2162 |
| 110 | Ga0209025_1038602 | 3300025294 | Bacteria | 2097 |
| 111 | Ga0209025_1067723 | 3300025294 | Bacteria | 1288 |
| 112 | Ga0209025_1070817 | 3300025294 | Bacteria | 1239 |
| 113 | Ga0207696_1001557 | 3300025711 | Bacteria | 12230 |
| 114 | Ga0207696_1001889 | 3300025711 | Bacteria | 10703 |
| 115 | Ga0207696_1012306 | 3300025711 | Bacteria | 3030 |
| 116 | Ga0207696_1030707 | 3300025711 | Bacteria | 1630 |
| 117 | Ga0207696_1043260 | 3300025711 | Bacteria | 1310 |
| 118 | Ga0207655_1028658 | 3300025728 | Bacteria | 2623 |
| 119 | Ga0207655_1039355 | 3300025728 | Bacteria | 2054 |
| 120 | Ga0207713_1011452 | 3300025735 | Bacteria | 4821 |
| 121 | Ga0207645_10014214 | 3300025907 | Bacteria | 5331 |
| 122 | Ga0207707_10087878 | 3300025912 | Bacteria | 2715 |
| 123 | Ga0207657_10275323 | 3300025919 | Unclassified | 1337 |
| 124 | Ga0207652_10208456 | 3300025921 | Bacteria | 1759 |
| 125 | Ga0207659_10148314 | 3300025926 | Bacteria | 1829 |
| 126 | Ga0207644_10019406 | 3300025931 | Bacteria | 4612 |
| 127 | Ga0207706_10216392 | 3300025933 | Bacteria | 1678 |
| 128 | Ga0207669_10010686 | 3300025937 | Bacteria | 4429 |
| 129 | Ga0207704_10104462 | 3300025938 | Unclassified | 1898 |
| 130 | Ga0207665_10015320 | 3300025939 | Bacteria | 5033 |
| 131 | Ga0207691_10000455 | 3300025940 | Bacteria | 40474 |
| 132 | Ga0207651_10000274 | 3300025960 | Bacteria | 22041 |
| 133 | Ga0207651_10353126 | 3300025960 | Bacteria | 1239 |
| 134 | Ga0207668_10138132 | 3300025972 | Unclassified | 1870 |
| 135 | Ga0207677_10244078 | 3300026023 | Bacteria | 1455 |
| 136 | Ga0207683_10000343 | 3300026121 | Bacteria | 42250 |
| 137 | Ga0209371_1005778 | 3300027312 | Bacteria | 4795 |
| 138 | Ga0207428_10004267 | 3300027907 | Bacteria | 13687 |
| 139 | Ga0268266_10195559 | 3300028379 | Bacteria | 1848 |
| 140 | Ga0268265_10254867 | 3300028380 | Bacteria | 1557 |
| 141 | Ga0237817_10002 | 3300030083 | Bacteria | 100594 |
| 142 | Ga0237817_10133 | 3300030083 | Bacteria | 22824 |
| 143 | Ga0268256_1004300 | 3300030500 | Bacteria | 5962 |
| 144 | Ga0307408_100003171 | 3300031548 | Bacteria | 11331 |
| 145 | Ga0307408_100068838 | 3300031548 | Bacteria | 2608 |
| 146 | Ga0307412_10113099 | 3300031911 | Bacteria | 1942 |
| 147 | Ga0307409_100005029 | 3300031995 | Bacteria | 7530 |
| 148 | Ga0307409_100645240 | 3300031995 | Bacteria | 1052 |
| 149 | Ga0395900_0003283 | 3300037418 | Bacteria | 17506 |
| 150 | Ga0395898_0163516 | 3300037466 | Bacteria | 2129 |
| 151 | Ga0237819_00105 | 3300038705 | Bacteria | 31053 |
| 152 | Ga0237819_00707 | 3300038705 | Bacteria | 10828 |
| 153 | Ga0436361_0101215 | 3300039447 | Bacteria | 5243 |
| 154 | Ga0436361_0952645 | 3300039447 | Bacteria | 42568 |
| 155 | Ga0453683_0018305 | 3300044673 | Bacteria | 4498 |
| 156 | Ga0466967_0000075 | 3300045976 | Bacteria | 36585 |
| 157 | Ga0495594_0055193 | 3300046499 | Bacteria | 2190 |
| 158 | Ga0495661_0168488 | 3300046665 | Bacteria | 1170 |
| 159 | Ga0496100_0336551 | 3300048903 | Unclassified | 1137 |
| 160 | Ga0496101_0244927 | 3300048904 | Unclassified | 1396 |
| 161 | Ga0496102_0221115 | 3300048905 | Bacteria | 1785 |
| 162 | Ga0496104_0030503 | 3300048907 | Bacteria | 5011 |
| 163 | Ga0496104_0413891 | 3300048907 | Bacteria | 1260 |
| 164 | Ga0496106_0358887 | 3300048909 | Bacteria | 1171 |
| 165 | Ga0496107_0085295 | 3300048910 | Bacteria | 2305 |
| 166 | Ga0496108_0014280 | 3300048911 | Bacteria | 6480 |
| 167 | Ga0496109_0005824 | 3300048912 | Bacteria | 10326 |
| 168 | Ga0496110_0000580 | 3300048913 | Bacteria | 25124 |
| 169 | Ga0496111_0001304 | 3300048914 | Bacteria | 14002 |
| 170 | Ga0496114_0010026 | 3300048917 | Bacteria | 7532 |
| 171 | Ga0496122_0084760 | 3300048925 | Bacteria | 2190 |
| 172 | Ga0496125_0001007 | 3300048928 | Bacteria | 43857 |
| 173 | Ga0496125_0003784 | 3300048928 | Bacteria | 17992 |
| 174 | Ga0501305_011032 | 3300049161 | Bacteria | 1215 |
| 175 | Ga0501031_0001103 | 3300049568 | Bacteria | 16472 |
| 176 | Ga0501031_0001602 | 3300049568 | Bacteria | 14144 |
| 177 | Ga0501031_0013128 | 3300049568 | Bacteria | 5404 |
| 178 | Ga0501031_0289482 | 3300049568 | Bacteria | 1062 |
| 179 | Ga0501032_0011406 | 3300049569 | Bacteria | 6385 |
| 180 | Ga0501032_0028600 | 3300049569 | Bacteria | 3829 |
| 181 | Ga0501034_0242984 | 3300049571 | Bacteria | 1746 |
| 182 | Ga0501034_0294876 | 3300049571 | Bacteria | 1559 |
| 183 | Ga0501036_0014275 | 3300049572 | Bacteria | 6609 |
| 184 | Ga0501036_0088657 | 3300049572 | Bacteria | 2614 |
| 185 | Ga0501037_0017169 | 3300049573 | Bacteria | 5327 |
| 186 | Ga0501037_0022157 | 3300049573 | Bacteria | 4701 |
| 187 | Ga0501038_0007065 | 3300049574 | Bacteria | 10368 |
| 188 | Ga0501038_0418228 | 3300049574 | Bacteria | 1035 |
| 189 | Ga0501039_0000166 | 3300049575 | Bacteria | 45779 |
| 190 | Ga0501039_0036307 | 3300049575 | Bacteria | 3802 |
| 191 | Ga0501039_0075431 | 3300049575 | Bacteria | 2621 |
| 192 | Ga0501040_0079424 | 3300049576 | Bacteria | 2271 |
| 193 | Ga0501041_0008350 | 3300049577 | Bacteria | 6091 |
| 194 | Ga0501041_0038111 | 3300049577 | Bacteria | 2914 |
| 195 | Ga0501042_0000800 | 3300049578 | Bacteria | 17296 |
| 196 | Ga0501042_0001352 | 3300049578 | Bacteria | 14352 |
| 197 | Ga0501042_0007316 | 3300049578 | Bacteria | 7226 |
| 198 | Ga0501046_0001791 | 3300049580 | Bacteria | 20486 |
| 199 | Ga0501046_0007735 | 3300049580 | Bacteria | 9424 |
| 200 | Ga0501048_0008568 | 3300049582 | Bacteria | 7722 |
| 201 | Ga0501048_0022196 | 3300049582 | Bacteria | 4644 |
| 202 | Ga0501071_0024439 | 3300049587 | Bacteria | 4228 |
| 203 | Ga0501075_0125299 | 3300049591 | Bacteria | 1956 |
| 204 | Ga0501198_043169 | 3300049649 | Bacteria | 786 |
| 205 | Ga0501217_048912 | 3300049661 | Bacteria | 1100 |
| 206 | Ga0501217_059356 | 3300049661 | Bacteria | 1018 |
| 207 | Ga0501249_026005 | 3300049679 | Bacteria | 1292 |
| 208 | Ga0501080_0201970 | 3300049742 | Unclassified | 1825 |
| 209 | Ga0501083_0294135 | 3300049744 | Bacteria | 1056 |
| 210 | Ga0501035_0007247 | 3300049822 | Bacteria | 10378 |
| 211 | Ga0501035_0045041 | 3300049822 | Bacteria | 3970 |
| 212 | Ga0501035_0047138 | 3300049822 | Bacteria | 3871 |
| 213 | Ga0501045_0026704 | 3300049824 | Bacteria | 4156 |
| 214 | Ga0501045_0473862 | 3300049824 | Unclassified | 930 |
| 215 | nmdc:mga05p37_21459_c1 | 3300050507 | Bacteria | 7822 |
| 216 | nmdc:mga09592_44035_c2 | 3300050508 | Bacteria | 2658 |
| 217 | nmdc:mga09592_58148_c1 | 3300050508 | Bacteria | 3269 |
| 218 | nmdc:mga06r32_588974_c1 | 3300050510 | Bacteria | 1084 |
| 219 | nmdc:mga08y16_2070_c1 | 3300050511 | Bacteria | 20566 |
| 220 | nmdc:mga0a205_10545_c1 | 3300050515 | Bacteria | 8491 |
| 221 | Ga0501082_0172759 | 3300060353 | Unclassified | 1879 |
| 222 | 3006859490 | 3006858327 | Bacteria | 4317835 |
| 223 | 2511698894 | 2511231119 | Bacteria | 4019861 |
| 224 | 2540606103 | 2540341094 | Bacteria | 4061186 |
| 225 | 2545558108 | 2545555800 | Bacteria | 4222588 |
| 226 | 2555471077 | 2554235283 | Bacteria | 3683090 |
| 227 | 2556064298 | 2554235469 | Bacteria | 3590176 |
| 228 | 2556065157 | 2554235469 | Bacteria | 3590176 |
| 229 | 2578932526 | 2576861599 | Bacteria | 4217202 |
| 230 | 2595089954 | 2593339131 | Bacteria | 5116855 |
| 231 | 2600200107 | 2599185353 | Bacteria | 2219443 |
| 232 | 2600402148 | 2600254943 | Bacteria | 2613887 |
| 233 | 2631984825 | 2630968484 | Bacteria | 3876276 |
| 234 | 2644707209 | 2643221729 | Bacteria | 6621700 |
| 235 | 2644714166 | 2643221730 | Bacteria | 6523787 |
| 236 | 2644739303 | 2643221735 | Bacteria | 3676263 |
| 237 | 2651530190 | 2648501850 | Bacteria | 3975476 |
| 238 | 2672337422 | 2671180330 | Bacteria | 5521719 |
| 239 | 2674420200 | 2671180844 | Bacteria | 4164150 |
| 240 | 2685153181 | 2684622632 | Bacteria | 5380049 |
| 241 | 2686996187 | 2684623153 | Bacteria | 3878815 |
| 242 | 2687497435 | 2687453109 | Bacteria | 3860091 |
| 243 | 2695626816 | 2695420354 | Bacteria | 3922431 |
| 244 | 2698320004 | 2695420987 | Bacteria | 6152737 |
| 245 | 2705997104 | 2703719227 | Bacteria | 5631989 |
| 246 | 2712199286 | 2711768088 | Bacteria | 3195027 |
| 247 | 2712199439 | 2711768088 | Bacteria | 3195027 |
| 248 | 2717917367 | 2716884898 | Bacteria | 3928789 |
| 249 | 2721508346 | 2718218445 | Bacteria | 5113413 |
| 250 | 2738815563 | 2738541295 | Bacteria | 5730091 |
| 251 | 2738840560 | 2738541299 | Bacteria | 4020721 |
| 252 | 2739157049 | 2738541358 | Bacteria | 5932299 |
| 253 | 2739209201 | 2738543006 | Bacteria | 5904091 |
| 254 | 2739232498 | 2738543010 | Bacteria | 5583595 |
| 255 | 2739270767 | 2738543017 | Bacteria | 4271950 |
| 256 | 2745168118 | 2744054657 | Bacteria | 5016802 |
| 257 | 2757568154 | 2757320391 | Bacteria | 4746095 |
| 258 | 2777764349 | 2775507177 | Bacteria | 4384303 |
| 259 | 2777835671 | 2775507192 | Bacteria | 4622234 |
| 260 | 2791214869 | 2788500588 | Bacteria | 4584915 |
| 261 | 2808869814 | 2808606364 | Bacteria | 4465927 |
| 262 | 2809054307 | 2808606399 | Bacteria | 4021018 |
| 263 | 2812315308 | 2811994870 | Bacteria | 3776934 |
| 264 | 2816862153 | 2816332186 | Bacteria | 5331395 |
| 265 | 2817479162 | 2816332295 | Bacteria | 4352468 |
| 266 | 2817617981 | 2816332336 | Bacteria | 5207640 |
| 267 | 2819570931 | 2818991441 | Bacteria | 5062707 |
| 268 | 2819582332 | 2818991443 | Bacteria | 6598732 |
| 269 | 2819628885 | 2818991451 | Bacteria | 4697364 |
| 270 | 2819725262 | 2818991468 | Bacteria | 3723169 |
| 271 | 2823527287 | 2823526263 | Bacteria | 3765752 |
| 272 | 2831905625 | 2831905167 | Bacteria | 3319172 |
| 273 | 2842684935 | 2842682962 | Bacteria | 5589973 |
| 274 | 2849141490 | 2849139964 | Bacteria | 5613304 |
| 275 | 2852676014 | 2852673933 | Bacteria | 3347676 |
| 276 | 2857584085 | 2857581216 | Bacteria | 5522813 |
| 277 | 2857590779 | 2857586860 | Bacteria | 4354574 |
| 278 | 2860838481 | 2860837431 | Bacteria | 4202080 |
| 279 | 2877769635 | 2877768649 | Bacteria | 3957164 |
| 280 | 2880170632 | 2880169592 | Bacteria | 3900066 |
| 281 | 2881646263 | 2881644220 | Bacteria | 5302661 |
| 282 | 2881648312 | 2881644220 | Bacteria | 5302661 |
| 283 | 2897110617 | 2897109615 | Bacteria | 4009619 |
| 284 | 2904563017 | 2904560550 | Bacteria | 4029838 |
| 285 | 2904609655 | 2904606771 | Bacteria | 4684500 |
| 286 | 2908666496 | 2908665501 | Bacteria | 3678115 |
| 287 | 2916974791 | 2916971899 | Bacteria | 4250608 |
| 288 | 2919093390 | 2919093281 | Bacteria | 3660974 |
| 289 | 2919419648 | 2919414237 | Bacteria | 5429133 |
| 290 | 2919729698 | 2919726948 | Bacteria | 3696050 |
| 291 | 2928514473 | 2928510474 | Bacteria | 4815308 |
| 292 | 2929238896 | 2929233124 | Bacteria | 5948380 |
| 293 | 2936340691 | 2936340661 | Bacteria | 5139038 |
| 294 | 2936362164 | 2936361878 | Bacteria | 5632809 |
| 295 | 2938923116 | 2938917290 | Bacteria | 5914775 |
| 296 | 2939596466 | 2939593269 | Bacteria | 4798695 |
| 297 | 2947431980 | 2947426588 | Bacteria | 5357194 |
| 298 | 2954775206 | 2954773129 | Bacteria | 3741715 |
| 299 | 2956902655 | 2956897341 | Bacteria | 5447711 |
| 300 | 2962291841 | 2962290636 | Bacteria | 4072939 |
| 301 | 2965766509 | 2965761152 | Bacteria | 5806513 |
| 302 | 2969137888 | 2969136845 | Bacteria | 3923176 |
| 303 | 2969142084 | 2969141011 | Bacteria | 4118468 |
| 304 | 2969768328 | 2969765954 | Bacteria | 4216713 |
| 305 | 2969771672 | 2969770375 | Bacteria | 4271280 |
| 306 | 2971894383 | 2971893375 | Bacteria | 3929648 |
| 307 | 2977256240 | 2977254563 | Bacteria | 4828420 |
| 308 | 2979088883 | 2979083700 | Bacteria | 5894929 |
| 309 | 2980493663 | 2980492589 | Bacteria | 4072961 |
| 310 | 2990277126 | 2990275345 | Bacteria | 4887158 |
| 311 | 3001268814 | 3001267043 | Bacteria | 4823521 |
| 312 | 3001274281 | 3001272096 | Bacteria | 4729684 |
| 313 | 3001897438 | 3001892409 | Bacteria | 6328293 |
| 314 | 3006827476 | 3006826541 | Bacteria | 4678913 |
| 315 | 3006880130 | 3006879489 | Bacteria | 4064221 |
| 316 | 3006971732 | 3006969106 | Bacteria | 4739423 |
| 317 | 3006976277 | 3006973921 | Bacteria | 4423788 |
| 318 | 3006982252 | 3006978542 | Bacteria | 5328100 |
| 319 | 3006984167 | 3006984091 | Bacteria | 4207523 |
| 320 | 3006988549 | 3006988479 | Bacteria | 4767936 |
| 321 | 8022626686 | 8022621104 | Bacteria | 5241040 |
| 322 | 8022633843 | 8022630665 | Bacteria | 3886130 |
| 323 | 8022655053 | 8022653035 | Bacteria | 4035078 |
| 324 | 8022796241 | 8022792930 | Bacteria | 5693794 |
| 325 | 8023441374 | 8023438354 | Bacteria | 5779374 |
| 326 | 8023448887 | 8023444577 | Bacteria | 5661597 |
| 327 | 8051953544 | 8051952484 | Bacteria | 3926774 |
| 328 | 8052177033 | 8052174270 | Bacteria | 3881265 |
| 329 | 8055535963 | 8055531788 | Bacteria | 5249694 |
| 330 | 8057587619 | 8057582654 | Bacteria | 5218944 |
| 331 | 8057635856 | 8057632132 | Bacteria | 4726859 |
| 332 | JGI25159J45721_1007941 | |||
| 333 | JGI25151J46595_10000009 | |||
| 334 | JGI25151J46595_10000521 | |||
| 335 | JGI25151J46595_10009101 | |||
| 336 | JGI25151J46595_10010832 | |||
| 337 | JGI25151J46595_10010899 | |||
| 338 | JGI25151J46595_10013393 | |||
| 339 | JGI25151J46595_10022297 | |||
| 340 | JGI25151J46595_10036982 | |||
| 341 | JGI25151J46595_10046794 | |||
| 342 | JGI25151J46595_10059045 | |||
| 343 | JGI25151J46595_10066245 | |||
| 344 | rootL2_10072818 | |||
| 345 | Ga0055538_1000327 | |||
| 346 | Ga0055532_1000078 | |||
| 347 | Ga0055536_1009440 | |||
| 348 | Ga0065704_10154542 | |||
| 349 | Ga0070676_10007013 | |||
| 350 | Ga0070683_100266066 | |||
| 351 | Ga0070690_100026379 | |||
| 352 | Ga0070670_100008454 | |||
| 353 | Ga0070666_10012188 | |||
| 354 | Ga0068868_100062282 | |||
| 355 | Ga0070687_100319822 | |||
| 356 | Ga0070661_100065503 | |||
| 357 | Ga0070669_100093848 | |||
| 358 | Ga0070675_100000834 | |||
| 359 | Ga0070671_100030776 | |||
| 360 | Ga0070673_100000037 | |||
| 361 | Ga0070688_100048427 | |||
| 362 | Ga0070659_100075028 | |||
| 363 | Ga0070667_100005358 | |||
| 364 | Ga0070705_100096510 | |||
| 365 | Ga0070694_100057620 | |||
| 366 | Ga0070678_100014161 | |||
| 367 | Ga0070681_10011887 | |||
| 368 | Ga0068867_100051275 | |||
| 369 | Ga0070698_100044735 | |||
| 370 | Ga0070697_100024464 | |||
| 371 | Ga0070697_100224869 | |||
| 372 | Ga0070672_100000560 | |||
| 373 | Ga0070695_100036094 | |||
| 374 | Ga0070693_100097705 | |||
| 375 | Ga0070665_100085179 | |||
| 376 | Ga0070704_100120677 | |||
| 377 | Ga0070664_100006991 | |||
| 378 | Ga0068854_100224705 | |||
| 379 | Ga0070702_100015667 | |||
| 380 | Ga0097621_100007961 | |||
| 381 | Ga0068871_100015626 | |||
| 382 | Ga0075428_100263289 | |||
| 383 | Ga0075428_100534361 | |||
| 384 | Ga0075431_100015693 | |||
| 385 | Ga0075433_10289981 | |||
| 386 | Ga0075434_100087548 | |||
| 387 | Ga0075429_100065901 | |||
| 388 | Ga0075429_100079033 | |||
| 389 | Ga0068865_100088006 | |||
| 390 | Ga0105251_10007414 | |||
| 391 | Ga0105251_10074273 | |||
| 392 | Ga0105244_10004536 | |||
| 393 | Ga0105244_10012915 | |||
| 394 | Ga0105244_10072264 | |||
| 395 | Ga0105244_10099712 | |||
| 396 | Ga0105250_10002312 | |||
| 397 | Ga0105250_10003163 | |||
| 398 | Ga0105250_10020115 | |||
| 399 | Ga0105250_10029847 | |||
| 400 | Ga0105250_10062787 | |||
| 401 | Ga0111539_10000141 | |||
| 402 | Ga0114129_10007129 | |||
| 403 | Ga0114129_10141019 | |||
| 404 | Ga0157371_10012008 | |||
| 405 | Ga0157371_10021113 | |||
| 406 | Ga0157374_10025808 | |||
| 407 | Ga0157378_10001562 | |||
| 408 | Ga0163162_10045165 | |||
| 409 | Ga0157372_10210825 | |||
| 410 | Ga0157375_10015669 | |||
| 411 | Ga0157375_10049086 | |||
| 412 | Ga0157380_10001375 | |||
| 413 | Ga0157376_10001133 | |||
| 414 | Ga0157376_10003672 | |||
| 415 | Ga0213872_10000332 | |||
| 416 | Ga0213872_10111386 | |||
| 417 | Ga0209784_100784 | |||
| 418 | Ga0209147_100114 | |||
| 419 | Ga0209147_101620 | |||
| 420 | Ga0209147_102547 | |||
| 421 | Ga0209130_1000775 | |||
| 422 | Ga0209130_1003412 | |||
| 423 | Ga0209130_1006642 | |||
| 424 | Ga0209130_1011033 | |||
| 425 | Ga0209676_1000439 | |||
| 426 | Ga0209676_1003386 | |||
| 427 | Ga0209676_1005432 | |||
| 428 | Ga0209025_1000001 | |||
| 429 | Ga0209025_1000488 | |||
| 430 | Ga0209025_1000517 | |||
| 431 | Ga0209025_1000874 | |||
| 432 | Ga0209025_1001197 | |||
| 433 | Ga0209025_1005061 | |||
| 434 | Ga0209025_1007269 | |||
| 435 | Ga0209025_1010014 | |||
| 436 | Ga0209025_1011883 | |||
| 437 | Ga0209025_1013504 | |||
| 438 | Ga0209025_1019240 | |||
| 439 | Ga0209025_1027494 | |||
| 440 | Ga0209025_1037225 | |||
| 441 | Ga0209025_1038602 | |||
| 442 | Ga0209025_1067723 | |||
| 443 | Ga0209025_1070817 | |||
| 444 | Ga0207696_1001557 | |||
| 445 | Ga0207696_1001889 | |||
| 446 | Ga0207696_1012306 | |||
| 447 | Ga0207696_1030707 | |||
| 448 | Ga0207696_1043260 | |||
| 449 | Ga0207655_1028658 | |||
| 450 | Ga0207655_1039355 | |||
| 451 | Ga0207713_1011452 | |||
| 452 | Ga0207645_10014214 | |||
| 453 | Ga0207707_10087878 | |||
| 454 | Ga0207657_10275323 | |||
| 455 | Ga0207652_10208456 | |||
| 456 | Ga0207659_10148314 | |||
| 457 | Ga0207644_10019406 | |||
| 458 | Ga0207706_10216392 | |||
| 459 | Ga0207669_10010686 | |||
| 460 | Ga0207704_10104462 | |||
| 461 | Ga0207665_10015320 | |||
| 462 | Ga0207691_10000455 | |||
| 463 | Ga0207651_10000274 | |||
| 464 | Ga0207651_10353126 | |||
| 465 | Ga0207668_10138132 | |||
| 466 | Ga0207677_10244078 | |||
| 467 | Ga0207683_10000343 | |||
| 468 | Ga0209371_1005778 | |||
| 469 | Ga0207428_10004267 | |||
| 470 | Ga0268266_10195559 | |||
| 471 | Ga0268265_10254867 | |||
| 472 | Ga0237817_10002 | |||
| 473 | Ga0237817_10133 | |||
| 474 | Ga0268256_1004300 | |||
| 475 | Ga0307408_100003171 | |||
| 476 | Ga0307408_100068838 | |||
| 477 | Ga0307412_10113099 | |||
| 478 | Ga0307409_100005029 | |||
| 479 | Ga0307409_100645240 | |||
| 480 | Ga0395900_0003283 | |||
| 481 | Ga0395898_0163516 | |||
| 482 | Ga0237819_00105 | |||
| 483 | Ga0237819_00707 | |||
| 484 | Ga0436361_0101215 | |||
| 485 | Ga0436361_0952645 | |||
| 486 | Ga0453683_0018305 | |||
| 487 | Ga0466967_0000075 | |||
| 488 | Ga0495594_0055193 | |||
| 489 | Ga0495661_0168488 | |||
| 490 | Ga0496100_0336551 | |||
| 491 | Ga0496101_0244927 | |||
| 492 | Ga0496102_0221115 | |||
| 493 | Ga0496104_0030503 | |||
| 494 | Ga0496104_0413891 | |||
| 495 | Ga0496106_0358887 | |||
| 496 | Ga0496107_0085295 | |||
| 497 | Ga0496108_0014280 | |||
| 498 | Ga0496109_0005824 | |||
| 499 | Ga0496110_0000580 | |||
| 500 | Ga0496111_0001304 | |||
| 501 | Ga0496114_0010026 | |||
| 502 | Ga0496122_0084760 | |||
| 503 | Ga0496125_0001007 | |||
| 504 | Ga0496125_0003784 | |||
| 505 | Ga0501305_011032 | |||
| 506 | Ga0501031_0001103 | |||
| 507 | Ga0501031_0001602 | |||
| 508 | Ga0501031_0013128 | |||
| 509 | Ga0501031_0289482 | |||
| 510 | Ga0501032_0011406 | |||
| 511 | Ga0501032_0028600 | |||
| 512 | Ga0501034_0242984 | |||
| 513 | Ga0501034_0294876 | |||
| 514 | Ga0501036_0014275 | |||
| 515 | Ga0501036_0088657 | |||
| 516 | Ga0501037_0017169 | |||
| 517 | Ga0501037_0022157 | |||
| 518 | Ga0501038_0007065 | |||
| 519 | Ga0501038_0418228 | |||
| 520 | Ga0501039_0000166 | |||
| 521 | Ga0501039_0036307 | |||
| 522 | Ga0501039_0075431 | |||
| 523 | Ga0501040_0079424 | |||
| 524 | Ga0501041_0008350 | |||
| 525 | Ga0501041_0038111 | |||
| 526 | Ga0501042_0000800 | |||
| 527 | Ga0501042_0001352 | |||
| 528 | Ga0501042_0007316 | |||
| 529 | Ga0501046_0001791 | |||
| 530 | Ga0501046_0007735 | |||
| 531 | Ga0501048_0008568 | |||
| 532 | Ga0501048_0022196 | |||
| 533 | Ga0501071_0024439 | |||
| 534 | Ga0501075_0125299 | |||
| 535 | Ga0501198_043169 | |||
| 536 | Ga0501217_048912 | |||
| 537 | Ga0501217_059356 | |||
| 538 | Ga0501249_026005 | |||
| 539 | Ga0501080_0201970 | |||
| 540 | Ga0501083_0294135 | |||
| 541 | Ga0501035_0007247 | |||
| 542 | Ga0501035_0045041 | |||
| 543 | Ga0501035_0047138 | |||
| 544 | Ga0501045_0026704 | |||
| 545 | Ga0501045_0473862 | |||
| 546 | nmdc:mga05p37_21459_c1 | |||
| 547 | nmdc:mga09592_44035_c2 | |||
| 548 | nmdc:mga09592_58148_c1 | |||
| 549 | nmdc:mga06r32_588974_c1 | |||
| 550 | nmdc:mga08y16_2070_c1 | |||
| 551 | nmdc:mga0a205_10545_c1 | |||
| 552 | Ga0501082_0172759 | |||
| 553 | 3006859490 | |||
| 554 | 2511698894 | |||
| 555 | 2540606103 | |||
| 556 | 2545558108 | |||
| 557 | 2555471077 | |||
| 558 | 2556064298 | |||
| 559 | 2556065157 | |||
| 560 | 2578932526 | |||
| 561 | 2595089954 | |||
| 562 | 2600200107 | |||
| 563 | 2600402148 | |||
| 564 | 2631984825 | |||
| 565 | 2644707209 | |||
| 566 | 2644714166 | |||
| 567 | 2644739303 | |||
| 568 | 2651530190 | |||
| 569 | 2672337422 | |||
| 570 | 2674420200 | |||
| 571 | 2685153181 | |||
| 572 | 2686996187 | |||
| 573 | 2687497435 | |||
| 574 | 2695626816 | |||
| 575 | 2698320004 | |||
| 576 | 2705997104 | |||
| 577 | 2712199286 | |||
| 578 | 2712199439 | |||
| 579 | 2717917367 | |||
| 580 | 2721508346 | |||
| 581 | 2738815563 | |||
| 582 | 2738840560 | |||
| 583 | 2739157049 | |||
| 584 | 2739209201 | |||
| 585 | 2739232498 | |||
| 586 | 2739270767 | |||
| 587 | 2745168118 | |||
| 588 | 2757568154 | |||
| 589 | 2777764349 | |||
| 590 | 2777835671 | |||
| 591 | 2791214869 | |||
| 592 | 2808869814 | |||
| 593 | 2809054307 | |||
| 594 | 2812315308 | |||
| 595 | 2816862153 | |||
| 596 | 2817479162 | |||
| 597 | 2817617981 | |||
| 598 | 2819570931 | |||
| 599 | 2819582332 | |||
| 600 | 2819628885 | |||
| 601 | 2819725262 | |||
| 602 | 2823527287 | |||
| 603 | 2831905625 | |||
| 604 | 2842684935 | |||
| 605 | 2849141490 | |||
| 606 | 2852676014 | |||
| 607 | 2857584085 | |||
| 608 | 2857590779 | |||
| 609 | 2860838481 | |||
| 610 | 2877769635 | |||
| 611 | 2880170632 | |||
| 612 | 2881646263 | |||
| 613 | 2881648312 | |||
| 614 | 2897110617 | |||
| 615 | 2904563017 | |||
| 616 | 2904609655 | |||
| 617 | 2908666496 | |||
| 618 | 2916974791 | |||
| 619 | 2919093390 | |||
| 620 | 2919419648 | |||
| 621 | 2919729698 | |||
| 622 | 2928514473 | |||
| 623 | 2929238896 | |||
| 624 | 2936340691 | |||
| 625 | 2936362164 | |||
| 626 | 2938923116 | |||
| 627 | 2939596466 | |||
| 628 | 2947431980 | |||
| 629 | 2954775206 | |||
| 630 | 2956902655 | |||
| 631 | 2962291841 | |||
| 632 | 2965766509 | |||
| 633 | 2969137888 | |||
| 634 | 2969142084 | |||
| 635 | 2969768328 | |||
| 636 | 2969771672 | |||
| 637 | 2971894383 | |||
| 638 | 2977256240 | |||
| 639 | 2979088883 | |||
| 640 | 2980493663 | |||
| 641 | 2990277126 | |||
| 642 | 3001268814 | |||
| 643 | 3001274281 | |||
| 644 | 3001897438 | |||
| 645 | 3006827476 | |||
| 646 | 3006880130 | |||
| 647 | 3006971732 | |||
| 648 | 3006976277 | |||
| 649 | 3006982252 | |||
| 650 | 3006984167 | |||
| 651 | 3006988549 | |||
| 652 | 8022626686 | |||
| 653 | 8022633843 | |||
| 654 | 8022655053 | |||
| 655 | 8022796241 | |||
| 656 | 8023441374 | |||
| 657 | 8023448887 | |||
| 658 | 8051953544 | |||
| 659 | 8052177033 | |||
| 660 | 8055535963 | |||
| 661 | 8057587619 | |||
| 662 | 8057635856 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1g2w-assembly1.cif.gz_B | e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase | 0.9647 | 10 | 277 |
| 4daa-assembly1.cif.gz_A | crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form | 0.9644 | 10 | 277 |
| 2dab-assembly1.cif.gz_A | l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate | 0.9641 | 10 | 277 |
| 5daa-assembly1.cif.gz_B | e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate | 0.9639 | 10 | 277 |
| 4tm5-assembly1.cif.gz_A-2 | x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate | 0.9319 | 10 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lqsA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.978 | 129 | 277 | 3.20.10.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.964 | 10 | 128 | 3.30.470.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9481 | 10 | 128 | 3.30.470.10 |
| af_Q2FXI0_1_119_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9275 | 9 | 128 | 3.30.470.10 |
| 6h65B02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9254 | 134 | 275 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U3BG93-F1-model_v4 | deleted | 0.9822 | 9 | 133 |
|
| AF-A0A2B3U980-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) | 0.9721 | 9 | 285 |
GO:0005829
GO:0030170 GO:0046394 GO:0046416 GO:0047810 |
| AF-A0A4U3BMJ3-F1-model_v4 | deleted | 0.9657 | 9 | 178 |
|
| AF-A0A090KUM8-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) (D-amino acid aminotransferase) (D-amino acid transaminase) (D-aspartate aminotransferase) | 0.9609 | 9 | 277 |
GO:0005829
GO:0030170 GO:0046394 GO:0046416 GO:0047810 |
| AF-O07597-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) (D-amino acid aminotransferase) (D-amino acid transaminase) (DAAT) (D-aspartate aminotransferase) | 0.9608 | 10 | 286 |
GO:0005829
GO:0019478 GO:0019752 GO:0030170 GO:0046437 GO:0047810 |