F410747

General Info

Members Datasets Scaffolds Average Seq Length
331 247 662 280

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006858327|3006859490
Length 318
Sequence AEKSFWKYCTILKGRVVLEWNGENSEVNKKQGDGEMKVLFNGRLMERSECAVDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDLSFSEAELKSQLKELVDINQMRDGGLYLQVTRGKAPRKHQYGAGLTPQVTAYTFPIQKPEKEQQNGVSAITADDMRWLRCDIKSLNLLYNVMIKQKAHEASSFEAILIRDGLVTEGTSSNVYVVKKNVIYTHPVTTLILNGITRMKVLQLCEQHGLNYEEKAVTKDELLNADEVFITSTTAEVIPVTSIDGQTIGSGAPGPLTKNVQTALQNSILSETAKPV

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
142 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
143 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
144 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
145 2554235283 Bacillus safensis VK Isolate Rhizosphere
146 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
147 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
148 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
149 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
150 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
151 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
152 2643221729 Bacillus sp. Root11 Isolate Unclassified
153 2643221730 Bacillus sp. Root131 Isolate Unclassified
154 2643221735 Bacillus sp. Root920 Isolate Unclassified
155 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
156 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
157 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
158 2684622632 Bacillus cereus 905 Isolate Unclassified
159 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
160 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
161 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
162 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
163 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
164 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
165 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
166 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
167 2738541295 Bacillus sp. OK085 Isolate Unclassified
168 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
169 2738541358 Bacillus sp. OV752 Isolate Unclassified
170 2738543006 Bacillus sp. OK077 Isolate Unclassified
171 2738543010 Bacillus sp. YR335 Isolate Unclassified
172 2738543017 Bacillus sp. OV186 Isolate Unclassified
173 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
174 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
175 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
176 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
177 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
178 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
179 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
180 2811994870 Bacillus sp. JB4 Isolate Unclassified
181 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
182 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
183 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
184 2818991441 Niallia circulans 3243 Isolate Rhizosphere
185 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
186 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
187 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
188 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
189 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
190 2842682962 Bacillus sp. R-72492 Isolate Unclassified
191 2849139964 Bacillus sp. R-71875 Isolate Unclassified
192 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
193 2857581216 Bacillus sp. R-71922 Isolate Unclassified
194 2857586860 Bacillus sp. R-71935 Isolate Unclassified
195 2860837431 Bacillus sp. WR11 Isolate Unclassified
196 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
197 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
198 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
199 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
200 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
201 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
202 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
203 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
204 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
205 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
206 2919726948 Bacillus pumilus 4489 Isolate Unclassified
207 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
208 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
209 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
210 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
211 2938917290 Bacillus sp. CR71 Isolate Unclassified
212 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
213 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
214 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
215 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
216 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
217 2965761152 Bacillus sp. COPE52 Isolate Unclassified
218 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
219 2969141011 Bacillus velezensis MH25 Isolate Unclassified
220 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
221 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
222 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
223 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
224 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
225 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
226 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
227 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
228 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
229 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
230 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
231 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
232 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
233 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
234 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
235 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
236 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
237 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
238 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
239 8022653035 Bacillus sp. Rc4 Isolate Unclassified
240 8022792930 Bacillus sp. Xin Isolate Rhizosphere
241 8023438354 Bacillus sp. BH2 Isolate Unclassified
242 8023444577 Bacillus sp. BH32 Isolate Unclassified
243 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
244 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
245 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
246 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
247 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.47
Metatranscriptomes 0.3
Isolates 33.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 4.53
Rhizosphere 65.56
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007941 3300002987 Bacteria 2975
2 JGI25151J46595_10000009 3300003187 Bacteria 296412
3 JGI25151J46595_10000521 3300003187 Bacteria 35852
4 JGI25151J46595_10009101 3300003187 Bacteria 4730
5 JGI25151J46595_10010832 3300003187 Bacteria 4219
6 JGI25151J46595_10010899 3300003187 Bacteria 4203
7 JGI25151J46595_10013393 3300003187 Bacteria 3690
8 JGI25151J46595_10022297 3300003187 Bacteria 2632
9 JGI25151J46595_10036982 3300003187 Bacteria 1835
10 JGI25151J46595_10046794 3300003187 Bacteria 1512
11 JGI25151J46595_10059045 3300003187 Bacteria 1237
12 JGI25151J46595_10066245 3300003187 Bacteria 1119
13 rootL2_10072818 3300003322 Bacteria 3078
14 Ga0055538_1000327 3300003751 Bacteria 21906
15 Ga0055532_1000078 3300003758 Bacteria 121493
16 Ga0055536_1009440 3300003781 Unclassified 4034
17 Ga0065704_10154542 3300005289 Unclassified 1402
18 Ga0070676_10007013 3300005328 Bacteria 6033
19 Ga0070683_100266066 3300005329 Unclassified 1631
20 Ga0070690_100026379 3300005330 Bacteria 3584
21 Ga0070670_100008454 3300005331 Bacteria 8781
22 Ga0070666_10012188 3300005335 Bacteria 5417
23 Ga0068868_100062282 3300005338 Bacteria 2956
24 Ga0070687_100319822 3300005343 Bacteria 991
25 Ga0070661_100065503 3300005344 Bacteria 2670
26 Ga0070669_100093848 3300005353 Bacteria 2254
27 Ga0070675_100000834 3300005354 Bacteria 21805
28 Ga0070671_100030776 3300005355 Bacteria 4429
29 Ga0070673_100000037 3300005364 Bacteria 55602
30 Ga0070688_100048427 3300005365 Unclassified 2641
31 Ga0070659_100075028 3300005366 Bacteria 2695
32 Ga0070667_100005358 3300005367 Bacteria 10715
33 Ga0070705_100096510 3300005440 Bacteria 1856
34 Ga0070694_100057620 3300005444 Bacteria 2642
35 Ga0070678_100014161 3300005456 Bacteria 5022
36 Ga0070681_10011887 3300005458 Bacteria 8633
37 Ga0068867_100051275 3300005459 Bacteria 3043
38 Ga0070698_100044735 3300005471 Bacteria 4531
39 Ga0070697_100024464 3300005536 Bacteria 4807
40 Ga0070697_100224869 3300005536 Bacteria 1600
41 Ga0070672_100000560 3300005543 Bacteria 21771
42 Ga0070695_100036094 3300005545 Bacteria 3109
43 Ga0070693_100097705 3300005547 Bacteria 1783
44 Ga0070665_100085179 3300005548 Bacteria 3166
45 Ga0070704_100120677 3300005549 Bacteria 2013
46 Ga0070664_100006991 3300005564 Bacteria 9099
47 Ga0068854_100224705 3300005578 Unclassified 1487
48 Ga0070702_100015667 3300005615 Bacteria 3875
49 Ga0097621_100007961 3300006237 Bacteria 7606
50 Ga0068871_100015626 3300006358 Bacteria 5689
51 Ga0075428_100263289 3300006844 Bacteria 1856
52 Ga0075428_100534361 3300006844 Bacteria 1254
53 Ga0075431_100015693 3300006847 Bacteria 7681
54 Ga0075433_10289981 3300006852 Bacteria 1449
55 Ga0075434_100087548 3300006871 Bacteria 3115
56 Ga0075429_100065901 3300006880 Bacteria 3153
57 Ga0075429_100079033 3300006880 Bacteria 2867
58 Ga0068865_100088006 3300006881 Bacteria 2246
59 Ga0105251_10007414 3300009011 Bacteria 6762
60 Ga0105251_10074273 3300009011 Bacteria 1579
61 Ga0105244_10004536 3300009036 Bacteria 9522
62 Ga0105244_10012915 3300009036 Bacteria 4913
63 Ga0105244_10072264 3300009036 Bacteria 1719
64 Ga0105244_10099712 3300009036 Bacteria 1422
65 Ga0105250_10002312 3300009092 Bacteria 9667
66 Ga0105250_10003163 3300009092 Bacteria 7883
67 Ga0105250_10020115 3300009092 Bacteria 2699
68 Ga0105250_10029847 3300009092 Bacteria 2193
69 Ga0105250_10062787 3300009092 Bacteria 1495
70 Ga0111539_10000141 3300009094 Bacteria 82439
71 Ga0114129_10007129 3300009147 Bacteria 15909
72 Ga0114129_10141019 3300009147 Bacteria 3304
73 Ga0157371_10012008 3300013102 Bacteria 6640
74 Ga0157371_10021113 3300013102 Bacteria 4786
75 Ga0157374_10025808 3300013296 Bacteria 5282
76 Ga0157378_10001562 3300013297 Bacteria 20688
77 Ga0163162_10045165 3300013306 Bacteria 4413
78 Ga0157372_10210825 3300013307 Bacteria 2251
79 Ga0157375_10015669 3300013308 Bacteria 6790
80 Ga0157375_10049086 3300013308 Bacteria 4134
81 Ga0157380_10001375 3300014326 Bacteria 15853
82 Ga0157376_10001133 3300014969 Bacteria 17484
83 Ga0157376_10003672 3300014969 Bacteria 10593
84 Ga0213872_10000332 3300021361 Bacteria 40022
85 Ga0213872_10111386 3300021361 Bacteria 1215
86 Ga0209784_100784 3300025224 Bacteria 7614
87 Ga0209147_100114 3300025229 Bacteria 144205
88 Ga0209147_101620 3300025229 Bacteria 7522
89 Ga0209147_102547 3300025229 Bacteria 4390
90 Ga0209130_1000775 3300025284 Bacteria 27594
91 Ga0209130_1003412 3300025284 Bacteria 6791
92 Ga0209130_1006642 3300025284 Bacteria 3716
93 Ga0209130_1011033 3300025284 Bacteria 2442
94 Ga0209676_1000439 3300025292 Bacteria 71078
95 Ga0209676_1003386 3300025292 Bacteria 9899
96 Ga0209676_1005432 3300025292 Bacteria 6662
97 Ga0209025_1000001 3300025294 Bacteria 1888151
98 Ga0209025_1000488 3300025294 Bacteria 76500
99 Ga0209025_1000517 3300025294 Bacteria 73456
100 Ga0209025_1000874 3300025294 Bacteria 47348
101 Ga0209025_1001197 3300025294 Bacteria 36596
102 Ga0209025_1005061 3300025294 Bacteria 10976
103 Ga0209025_1007269 3300025294 Bacteria 8320
104 Ga0209025_1010014 3300025294 Bacteria 6495
105 Ga0209025_1011883 3300025294 Bacteria 5666
106 Ga0209025_1013504 3300025294 Bacteria 5125
107 Ga0209025_1019240 3300025294 Bacteria 3808
108 Ga0209025_1027494 3300025294 Bacteria 2819
109 Ga0209025_1037225 3300025294 Bacteria 2162
110 Ga0209025_1038602 3300025294 Bacteria 2097
111 Ga0209025_1067723 3300025294 Bacteria 1288
112 Ga0209025_1070817 3300025294 Bacteria 1239
113 Ga0207696_1001557 3300025711 Bacteria 12230
114 Ga0207696_1001889 3300025711 Bacteria 10703
115 Ga0207696_1012306 3300025711 Bacteria 3030
116 Ga0207696_1030707 3300025711 Bacteria 1630
117 Ga0207696_1043260 3300025711 Bacteria 1310
118 Ga0207655_1028658 3300025728 Bacteria 2623
119 Ga0207655_1039355 3300025728 Bacteria 2054
120 Ga0207713_1011452 3300025735 Bacteria 4821
121 Ga0207645_10014214 3300025907 Bacteria 5331
122 Ga0207707_10087878 3300025912 Bacteria 2715
123 Ga0207657_10275323 3300025919 Unclassified 1337
124 Ga0207652_10208456 3300025921 Bacteria 1759
125 Ga0207659_10148314 3300025926 Bacteria 1829
126 Ga0207644_10019406 3300025931 Bacteria 4612
127 Ga0207706_10216392 3300025933 Bacteria 1678
128 Ga0207669_10010686 3300025937 Bacteria 4429
129 Ga0207704_10104462 3300025938 Unclassified 1898
130 Ga0207665_10015320 3300025939 Bacteria 5033
131 Ga0207691_10000455 3300025940 Bacteria 40474
132 Ga0207651_10000274 3300025960 Bacteria 22041
133 Ga0207651_10353126 3300025960 Bacteria 1239
134 Ga0207668_10138132 3300025972 Unclassified 1870
135 Ga0207677_10244078 3300026023 Bacteria 1455
136 Ga0207683_10000343 3300026121 Bacteria 42250
137 Ga0209371_1005778 3300027312 Bacteria 4795
138 Ga0207428_10004267 3300027907 Bacteria 13687
139 Ga0268266_10195559 3300028379 Bacteria 1848
140 Ga0268265_10254867 3300028380 Bacteria 1557
141 Ga0237817_10002 3300030083 Bacteria 100594
142 Ga0237817_10133 3300030083 Bacteria 22824
143 Ga0268256_1004300 3300030500 Bacteria 5962
144 Ga0307408_100003171 3300031548 Bacteria 11331
145 Ga0307408_100068838 3300031548 Bacteria 2608
146 Ga0307412_10113099 3300031911 Bacteria 1942
147 Ga0307409_100005029 3300031995 Bacteria 7530
148 Ga0307409_100645240 3300031995 Bacteria 1052
149 Ga0395900_0003283 3300037418 Bacteria 17506
150 Ga0395898_0163516 3300037466 Bacteria 2129
151 Ga0237819_00105 3300038705 Bacteria 31053
152 Ga0237819_00707 3300038705 Bacteria 10828
153 Ga0436361_0101215 3300039447 Bacteria 5243
154 Ga0436361_0952645 3300039447 Bacteria 42568
155 Ga0453683_0018305 3300044673 Bacteria 4498
156 Ga0466967_0000075 3300045976 Bacteria 36585
157 Ga0495594_0055193 3300046499 Bacteria 2190
158 Ga0495661_0168488 3300046665 Bacteria 1170
159 Ga0496100_0336551 3300048903 Unclassified 1137
160 Ga0496101_0244927 3300048904 Unclassified 1396
161 Ga0496102_0221115 3300048905 Bacteria 1785
162 Ga0496104_0030503 3300048907 Bacteria 5011
163 Ga0496104_0413891 3300048907 Bacteria 1260
164 Ga0496106_0358887 3300048909 Bacteria 1171
165 Ga0496107_0085295 3300048910 Bacteria 2305
166 Ga0496108_0014280 3300048911 Bacteria 6480
167 Ga0496109_0005824 3300048912 Bacteria 10326
168 Ga0496110_0000580 3300048913 Bacteria 25124
169 Ga0496111_0001304 3300048914 Bacteria 14002
170 Ga0496114_0010026 3300048917 Bacteria 7532
171 Ga0496122_0084760 3300048925 Bacteria 2190
172 Ga0496125_0001007 3300048928 Bacteria 43857
173 Ga0496125_0003784 3300048928 Bacteria 17992
174 Ga0501305_011032 3300049161 Bacteria 1215
175 Ga0501031_0001103 3300049568 Bacteria 16472
176 Ga0501031_0001602 3300049568 Bacteria 14144
177 Ga0501031_0013128 3300049568 Bacteria 5404
178 Ga0501031_0289482 3300049568 Bacteria 1062
179 Ga0501032_0011406 3300049569 Bacteria 6385
180 Ga0501032_0028600 3300049569 Bacteria 3829
181 Ga0501034_0242984 3300049571 Bacteria 1746
182 Ga0501034_0294876 3300049571 Bacteria 1559
183 Ga0501036_0014275 3300049572 Bacteria 6609
184 Ga0501036_0088657 3300049572 Bacteria 2614
185 Ga0501037_0017169 3300049573 Bacteria 5327
186 Ga0501037_0022157 3300049573 Bacteria 4701
187 Ga0501038_0007065 3300049574 Bacteria 10368
188 Ga0501038_0418228 3300049574 Bacteria 1035
189 Ga0501039_0000166 3300049575 Bacteria 45779
190 Ga0501039_0036307 3300049575 Bacteria 3802
191 Ga0501039_0075431 3300049575 Bacteria 2621
192 Ga0501040_0079424 3300049576 Bacteria 2271
193 Ga0501041_0008350 3300049577 Bacteria 6091
194 Ga0501041_0038111 3300049577 Bacteria 2914
195 Ga0501042_0000800 3300049578 Bacteria 17296
196 Ga0501042_0001352 3300049578 Bacteria 14352
197 Ga0501042_0007316 3300049578 Bacteria 7226
198 Ga0501046_0001791 3300049580 Bacteria 20486
199 Ga0501046_0007735 3300049580 Bacteria 9424
200 Ga0501048_0008568 3300049582 Bacteria 7722
201 Ga0501048_0022196 3300049582 Bacteria 4644
202 Ga0501071_0024439 3300049587 Bacteria 4228
203 Ga0501075_0125299 3300049591 Bacteria 1956
204 Ga0501198_043169 3300049649 Bacteria 786
205 Ga0501217_048912 3300049661 Bacteria 1100
206 Ga0501217_059356 3300049661 Bacteria 1018
207 Ga0501249_026005 3300049679 Bacteria 1292
208 Ga0501080_0201970 3300049742 Unclassified 1825
209 Ga0501083_0294135 3300049744 Bacteria 1056
210 Ga0501035_0007247 3300049822 Bacteria 10378
211 Ga0501035_0045041 3300049822 Bacteria 3970
212 Ga0501035_0047138 3300049822 Bacteria 3871
213 Ga0501045_0026704 3300049824 Bacteria 4156
214 Ga0501045_0473862 3300049824 Unclassified 930
215 nmdc:mga05p37_21459_c1 3300050507 Bacteria 7822
216 nmdc:mga09592_44035_c2 3300050508 Bacteria 2658
217 nmdc:mga09592_58148_c1 3300050508 Bacteria 3269
218 nmdc:mga06r32_588974_c1 3300050510 Bacteria 1084
219 nmdc:mga08y16_2070_c1 3300050511 Bacteria 20566
220 nmdc:mga0a205_10545_c1 3300050515 Bacteria 8491
221 Ga0501082_0172759 3300060353 Unclassified 1879
222 3006859490 3006858327 Bacteria 4317835
223 2511698894 2511231119 Bacteria 4019861
224 2540606103 2540341094 Bacteria 4061186
225 2545558108 2545555800 Bacteria 4222588
226 2555471077 2554235283 Bacteria 3683090
227 2556064298 2554235469 Bacteria 3590176
228 2556065157 2554235469 Bacteria 3590176
229 2578932526 2576861599 Bacteria 4217202
230 2595089954 2593339131 Bacteria 5116855
231 2600200107 2599185353 Bacteria 2219443
232 2600402148 2600254943 Bacteria 2613887
233 2631984825 2630968484 Bacteria 3876276
234 2644707209 2643221729 Bacteria 6621700
235 2644714166 2643221730 Bacteria 6523787
236 2644739303 2643221735 Bacteria 3676263
237 2651530190 2648501850 Bacteria 3975476
238 2672337422 2671180330 Bacteria 5521719
239 2674420200 2671180844 Bacteria 4164150
240 2685153181 2684622632 Bacteria 5380049
241 2686996187 2684623153 Bacteria 3878815
242 2687497435 2687453109 Bacteria 3860091
243 2695626816 2695420354 Bacteria 3922431
244 2698320004 2695420987 Bacteria 6152737
245 2705997104 2703719227 Bacteria 5631989
246 2712199286 2711768088 Bacteria 3195027
247 2712199439 2711768088 Bacteria 3195027
248 2717917367 2716884898 Bacteria 3928789
249 2721508346 2718218445 Bacteria 5113413
250 2738815563 2738541295 Bacteria 5730091
251 2738840560 2738541299 Bacteria 4020721
252 2739157049 2738541358 Bacteria 5932299
253 2739209201 2738543006 Bacteria 5904091
254 2739232498 2738543010 Bacteria 5583595
255 2739270767 2738543017 Bacteria 4271950
256 2745168118 2744054657 Bacteria 5016802
257 2757568154 2757320391 Bacteria 4746095
258 2777764349 2775507177 Bacteria 4384303
259 2777835671 2775507192 Bacteria 4622234
260 2791214869 2788500588 Bacteria 4584915
261 2808869814 2808606364 Bacteria 4465927
262 2809054307 2808606399 Bacteria 4021018
263 2812315308 2811994870 Bacteria 3776934
264 2816862153 2816332186 Bacteria 5331395
265 2817479162 2816332295 Bacteria 4352468
266 2817617981 2816332336 Bacteria 5207640
267 2819570931 2818991441 Bacteria 5062707
268 2819582332 2818991443 Bacteria 6598732
269 2819628885 2818991451 Bacteria 4697364
270 2819725262 2818991468 Bacteria 3723169
271 2823527287 2823526263 Bacteria 3765752
272 2831905625 2831905167 Bacteria 3319172
273 2842684935 2842682962 Bacteria 5589973
274 2849141490 2849139964 Bacteria 5613304
275 2852676014 2852673933 Bacteria 3347676
276 2857584085 2857581216 Bacteria 5522813
277 2857590779 2857586860 Bacteria 4354574
278 2860838481 2860837431 Bacteria 4202080
279 2877769635 2877768649 Bacteria 3957164
280 2880170632 2880169592 Bacteria 3900066
281 2881646263 2881644220 Bacteria 5302661
282 2881648312 2881644220 Bacteria 5302661
283 2897110617 2897109615 Bacteria 4009619
284 2904563017 2904560550 Bacteria 4029838
285 2904609655 2904606771 Bacteria 4684500
286 2908666496 2908665501 Bacteria 3678115
287 2916974791 2916971899 Bacteria 4250608
288 2919093390 2919093281 Bacteria 3660974
289 2919419648 2919414237 Bacteria 5429133
290 2919729698 2919726948 Bacteria 3696050
291 2928514473 2928510474 Bacteria 4815308
292 2929238896 2929233124 Bacteria 5948380
293 2936340691 2936340661 Bacteria 5139038
294 2936362164 2936361878 Bacteria 5632809
295 2938923116 2938917290 Bacteria 5914775
296 2939596466 2939593269 Bacteria 4798695
297 2947431980 2947426588 Bacteria 5357194
298 2954775206 2954773129 Bacteria 3741715
299 2956902655 2956897341 Bacteria 5447711
300 2962291841 2962290636 Bacteria 4072939
301 2965766509 2965761152 Bacteria 5806513
302 2969137888 2969136845 Bacteria 3923176
303 2969142084 2969141011 Bacteria 4118468
304 2969768328 2969765954 Bacteria 4216713
305 2969771672 2969770375 Bacteria 4271280
306 2971894383 2971893375 Bacteria 3929648
307 2977256240 2977254563 Bacteria 4828420
308 2979088883 2979083700 Bacteria 5894929
309 2980493663 2980492589 Bacteria 4072961
310 2990277126 2990275345 Bacteria 4887158
311 3001268814 3001267043 Bacteria 4823521
312 3001274281 3001272096 Bacteria 4729684
313 3001897438 3001892409 Bacteria 6328293
314 3006827476 3006826541 Bacteria 4678913
315 3006880130 3006879489 Bacteria 4064221
316 3006971732 3006969106 Bacteria 4739423
317 3006976277 3006973921 Bacteria 4423788
318 3006982252 3006978542 Bacteria 5328100
319 3006984167 3006984091 Bacteria 4207523
320 3006988549 3006988479 Bacteria 4767936
321 8022626686 8022621104 Bacteria 5241040
322 8022633843 8022630665 Bacteria 3886130
323 8022655053 8022653035 Bacteria 4035078
324 8022796241 8022792930 Bacteria 5693794
325 8023441374 8023438354 Bacteria 5779374
326 8023448887 8023444577 Bacteria 5661597
327 8051953544 8051952484 Bacteria 3926774
328 8052177033 8052174270 Bacteria 3881265
329 8055535963 8055531788 Bacteria 5249694
330 8057587619 8057582654 Bacteria 5218944
331 8057635856 8057632132 Bacteria 4726859
332 JGI25159J45721_1007941
333 JGI25151J46595_10000009
334 JGI25151J46595_10000521
335 JGI25151J46595_10009101
336 JGI25151J46595_10010832
337 JGI25151J46595_10010899
338 JGI25151J46595_10013393
339 JGI25151J46595_10022297
340 JGI25151J46595_10036982
341 JGI25151J46595_10046794
342 JGI25151J46595_10059045
343 JGI25151J46595_10066245
344 rootL2_10072818
345 Ga0055538_1000327
346 Ga0055532_1000078
347 Ga0055536_1009440
348 Ga0065704_10154542
349 Ga0070676_10007013
350 Ga0070683_100266066
351 Ga0070690_100026379
352 Ga0070670_100008454
353 Ga0070666_10012188
354 Ga0068868_100062282
355 Ga0070687_100319822
356 Ga0070661_100065503
357 Ga0070669_100093848
358 Ga0070675_100000834
359 Ga0070671_100030776
360 Ga0070673_100000037
361 Ga0070688_100048427
362 Ga0070659_100075028
363 Ga0070667_100005358
364 Ga0070705_100096510
365 Ga0070694_100057620
366 Ga0070678_100014161
367 Ga0070681_10011887
368 Ga0068867_100051275
369 Ga0070698_100044735
370 Ga0070697_100024464
371 Ga0070697_100224869
372 Ga0070672_100000560
373 Ga0070695_100036094
374 Ga0070693_100097705
375 Ga0070665_100085179
376 Ga0070704_100120677
377 Ga0070664_100006991
378 Ga0068854_100224705
379 Ga0070702_100015667
380 Ga0097621_100007961
381 Ga0068871_100015626
382 Ga0075428_100263289
383 Ga0075428_100534361
384 Ga0075431_100015693
385 Ga0075433_10289981
386 Ga0075434_100087548
387 Ga0075429_100065901
388 Ga0075429_100079033
389 Ga0068865_100088006
390 Ga0105251_10007414
391 Ga0105251_10074273
392 Ga0105244_10004536
393 Ga0105244_10012915
394 Ga0105244_10072264
395 Ga0105244_10099712
396 Ga0105250_10002312
397 Ga0105250_10003163
398 Ga0105250_10020115
399 Ga0105250_10029847
400 Ga0105250_10062787
401 Ga0111539_10000141
402 Ga0114129_10007129
403 Ga0114129_10141019
404 Ga0157371_10012008
405 Ga0157371_10021113
406 Ga0157374_10025808
407 Ga0157378_10001562
408 Ga0163162_10045165
409 Ga0157372_10210825
410 Ga0157375_10015669
411 Ga0157375_10049086
412 Ga0157380_10001375
413 Ga0157376_10001133
414 Ga0157376_10003672
415 Ga0213872_10000332
416 Ga0213872_10111386
417 Ga0209784_100784
418 Ga0209147_100114
419 Ga0209147_101620
420 Ga0209147_102547
421 Ga0209130_1000775
422 Ga0209130_1003412
423 Ga0209130_1006642
424 Ga0209130_1011033
425 Ga0209676_1000439
426 Ga0209676_1003386
427 Ga0209676_1005432
428 Ga0209025_1000001
429 Ga0209025_1000488
430 Ga0209025_1000517
431 Ga0209025_1000874
432 Ga0209025_1001197
433 Ga0209025_1005061
434 Ga0209025_1007269
435 Ga0209025_1010014
436 Ga0209025_1011883
437 Ga0209025_1013504
438 Ga0209025_1019240
439 Ga0209025_1027494
440 Ga0209025_1037225
441 Ga0209025_1038602
442 Ga0209025_1067723
443 Ga0209025_1070817
444 Ga0207696_1001557
445 Ga0207696_1001889
446 Ga0207696_1012306
447 Ga0207696_1030707
448 Ga0207696_1043260
449 Ga0207655_1028658
450 Ga0207655_1039355
451 Ga0207713_1011452
452 Ga0207645_10014214
453 Ga0207707_10087878
454 Ga0207657_10275323
455 Ga0207652_10208456
456 Ga0207659_10148314
457 Ga0207644_10019406
458 Ga0207706_10216392
459 Ga0207669_10010686
460 Ga0207704_10104462
461 Ga0207665_10015320
462 Ga0207691_10000455
463 Ga0207651_10000274
464 Ga0207651_10353126
465 Ga0207668_10138132
466 Ga0207677_10244078
467 Ga0207683_10000343
468 Ga0209371_1005778
469 Ga0207428_10004267
470 Ga0268266_10195559
471 Ga0268265_10254867
472 Ga0237817_10002
473 Ga0237817_10133
474 Ga0268256_1004300
475 Ga0307408_100003171
476 Ga0307408_100068838
477 Ga0307412_10113099
478 Ga0307409_100005029
479 Ga0307409_100645240
480 Ga0395900_0003283
481 Ga0395898_0163516
482 Ga0237819_00105
483 Ga0237819_00707
484 Ga0436361_0101215
485 Ga0436361_0952645
486 Ga0453683_0018305
487 Ga0466967_0000075
488 Ga0495594_0055193
489 Ga0495661_0168488
490 Ga0496100_0336551
491 Ga0496101_0244927
492 Ga0496102_0221115
493 Ga0496104_0030503
494 Ga0496104_0413891
495 Ga0496106_0358887
496 Ga0496107_0085295
497 Ga0496108_0014280
498 Ga0496109_0005824
499 Ga0496110_0000580
500 Ga0496111_0001304
501 Ga0496114_0010026
502 Ga0496122_0084760
503 Ga0496125_0001007
504 Ga0496125_0003784
505 Ga0501305_011032
506 Ga0501031_0001103
507 Ga0501031_0001602
508 Ga0501031_0013128
509 Ga0501031_0289482
510 Ga0501032_0011406
511 Ga0501032_0028600
512 Ga0501034_0242984
513 Ga0501034_0294876
514 Ga0501036_0014275
515 Ga0501036_0088657
516 Ga0501037_0017169
517 Ga0501037_0022157
518 Ga0501038_0007065
519 Ga0501038_0418228
520 Ga0501039_0000166
521 Ga0501039_0036307
522 Ga0501039_0075431
523 Ga0501040_0079424
524 Ga0501041_0008350
525 Ga0501041_0038111
526 Ga0501042_0000800
527 Ga0501042_0001352
528 Ga0501042_0007316
529 Ga0501046_0001791
530 Ga0501046_0007735
531 Ga0501048_0008568
532 Ga0501048_0022196
533 Ga0501071_0024439
534 Ga0501075_0125299
535 Ga0501198_043169
536 Ga0501217_048912
537 Ga0501217_059356
538 Ga0501249_026005
539 Ga0501080_0201970
540 Ga0501083_0294135
541 Ga0501035_0007247
542 Ga0501035_0045041
543 Ga0501035_0047138
544 Ga0501045_0026704
545 Ga0501045_0473862
546 nmdc:mga05p37_21459_c1
547 nmdc:mga09592_44035_c2
548 nmdc:mga09592_58148_c1
549 nmdc:mga06r32_588974_c1
550 nmdc:mga08y16_2070_c1
551 nmdc:mga0a205_10545_c1
552 Ga0501082_0172759
553 3006859490
554 2511698894
555 2540606103
556 2545558108
557 2555471077
558 2556064298
559 2556065157
560 2578932526
561 2595089954
562 2600200107
563 2600402148
564 2631984825
565 2644707209
566 2644714166
567 2644739303
568 2651530190
569 2672337422
570 2674420200
571 2685153181
572 2686996187
573 2687497435
574 2695626816
575 2698320004
576 2705997104
577 2712199286
578 2712199439
579 2717917367
580 2721508346
581 2738815563
582 2738840560
583 2739157049
584 2739209201
585 2739232498
586 2739270767
587 2745168118
588 2757568154
589 2777764349
590 2777835671
591 2791214869
592 2808869814
593 2809054307
594 2812315308
595 2816862153
596 2817479162
597 2817617981
598 2819570931
599 2819582332
600 2819628885
601 2819725262
602 2823527287
603 2831905625
604 2842684935
605 2849141490
606 2852676014
607 2857584085
608 2857590779
609 2860838481
610 2877769635
611 2880170632
612 2881646263
613 2881648312
614 2897110617
615 2904563017
616 2904609655
617 2908666496
618 2916974791
619 2919093390
620 2919419648
621 2919729698
622 2928514473
623 2929238896
624 2936340691
625 2936362164
626 2938923116
627 2939596466
628 2947431980
629 2954775206
630 2956902655
631 2962291841
632 2965766509
633 2969137888
634 2969142084
635 2969768328
636 2969771672
637 2971894383
638 2977256240
639 2979088883
640 2980493663
641 2990277126
642 3001268814
643 3001274281
644 3001897438
645 3006827476
646 3006880130
647 3006971732
648 3006976277
649 3006982252
650 3006984167
651 3006988549
652 8022626686
653 8022633843
654 8022655053
655 8022796241
656 8023441374
657 8023448887
658 8051953544
659 8052177033
660 8055535963
661 8057587619
662 8057635856

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

64

285

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9647 10 277
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9644 10 277
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9641 10 277
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.9639 10 277
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.9319 10 282
ID Description Score Start End Superfamily
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.978 129 277 3.20.10.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.964 10 128 3.30.470.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9481 10 128 3.30.470.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9275 9 128 3.30.470.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9254 134 275 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A4U3BG93-F1-model_v4 deleted 0.9822 9 133
AF-A0A2B3U980-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) 0.9721 9 285 GO:0005829
GO:0030170
GO:0046394
GO:0046416
GO:0047810
AF-A0A4U3BMJ3-F1-model_v4 deleted 0.9657 9 178
AF-A0A090KUM8-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) (D-amino acid aminotransferase) (D-amino acid transaminase) (D-aspartate aminotransferase) 0.9609 9 277 GO:0005829
GO:0030170
GO:0046394
GO:0046416
GO:0047810
AF-O07597-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) (D-amino acid aminotransferase) (D-amino acid transaminase) (DAAT) (D-aspartate aminotransferase) 0.9608 10 286 GO:0005829
GO:0019478
GO:0019752
GO:0030170
GO:0046437
GO:0047810

Map