F410698

General Info

Members Datasets Scaffolds Average Seq Length
331 215 331 122

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0033697|Ga0501073_0033697_516_962
Length 148
Sequence LTPLSLYGLGDSGHFPKEERMITKLDFVGVPSTDADRSRSFYVDTLGLRPDPNGHYEFWAGDTCFGIWEPAKMGFEFVPQKNAHPALHVDDVAATRAELEAKGVQFLGDTLDTGVCHMALFTDPDGNDLMLHHRYAPVDATGTEKATP

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 8.46
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1067993 3300002070 Bacteria 578
2 JGI24748J21848_1006825 3300002074 Bacteria 1333
3 JGI24034J26672_10001357 3300002239 Bacteria 3235
4 JGI24742J22300_10024628 3300002244 Bacteria 1038
5 JGI24751J29686_10139108 3300002459 Bacteria 514
6 Ga0070658_10633341 3300005327 Bacteria 928
7 Ga0070683_100048655 3300005329 Bacteria 3920
8 Ga0070670_100500115 3300005331 Bacteria 1081
9 Ga0070666_10018746 3300005335 Bacteria 4455
10 Ga0070680_100003460 3300005336 Bacteria 11785
11 Ga0070680_100219776 3300005336 Bacteria 1604
12 Ga0070682_100987033 3300005337 Bacteria 698
13 Ga0068868_100691182 3300005338 Bacteria 912
14 Ga0070660_100032922 3300005339 Bacteria 3904
15 Ga0070691_10000013 3300005341 Bacteria 50559
16 Ga0070661_100031091 3300005344 Bacteria 3860
17 Ga0070668_100101771 3300005347 Bacteria 2277
18 Ga0070669_101172198 3300005353 Bacteria 663
19 Ga0070675_101328966 3300005354 Bacteria 662
20 Ga0070659_100003502 3300005366 Bacteria 11178
21 Ga0070667_100000597 3300005367 Bacteria 35219
22 Ga0070667_100042153 3300005367 Bacteria 3829
23 Ga0070701_10148844 3300005438 Bacteria 1346
24 Ga0070694_100672606 3300005444 Bacteria 840
25 Ga0070694_101666773 3300005444 Unclassified 542
26 Ga0070663_100017822 3300005455 Bacteria 4643
27 Ga0070663_100958907 3300005455 Bacteria 742
28 Ga0070678_100059802 3300005456 Bacteria 2802
29 Ga0070681_10079537 3300005458 Bacteria 3235
30 Ga0070681_10626115 3300005458 Bacteria 991
31 Ga0068867_100001373 3300005459 Bacteria 16810
32 Ga0070679_100014082 3300005530 Bacteria 7670
33 Ga0070679_100024938 3300005530 Bacteria 5863
34 Ga0070684_100012100 3300005535 Bacteria 6901
35 Ga0070684_100596585 3300005535 Bacteria 1027
36 Ga0070684_101400108 3300005535 Bacteria 658
37 Ga0068853_100153753 3300005539 Bacteria 2072
38 Ga0070695_100030577 3300005545 Bacteria 3354
39 Ga0070665_100010698 3300005548 Bacteria 9288
40 Ga0070665_100038262 3300005548 Bacteria 4822
41 Ga0070665_100066179 3300005548 Bacteria 3625
42 Ga0070704_101116053 3300005549 Bacteria 717
43 Ga0068855_100916259 3300005563 Bacteria 925
44 Ga0070664_100283263 3300005564 Bacteria 1495
45 Ga0070664_101288506 3300005564 Bacteria 690
46 Ga0068857_100160146 3300005577 Bacteria 2042
47 Ga0068857_100361937 3300005577 Bacteria 1345
48 Ga0068854_100069710 3300005578 Bacteria 2568
49 Ga0068854_100100253 3300005578 Bacteria 2170
50 Ga0068856_100012354 3300005614 Bacteria 8271
51 Ga0068856_100020021 3300005614 Bacteria 6495
52 Ga0068856_100795016 3300005614 Bacteria 966
53 Ga0068852_100000037 3300005616 Bacteria 97602
54 Ga0068852_100002642 3300005616 Bacteria 12377
55 Ga0068866_10000002 3300005718 Bacteria 394090
56 Ga0068863_100063203 3300005841 Bacteria 3501
57 Ga0068863_100658860 3300005841 Bacteria 1038
58 Ga0068858_100046292 3300005842 Bacteria 4033
59 Ga0068860_100089860 3300005843 Bacteria 2925
60 Ga0068860_100162838 3300005843 Bacteria 2151
61 Ga0068862_100000366 3300005844 Bacteria 49032
62 Ga0081455_10194620 3300005937 Bacteria 1524
63 Ga0081540_1051787 3300005983 Bacteria 2027
64 Ga0081539_10246677 3300005985 Bacteria 796
65 Ga0075365_10070820 3300006038 Bacteria 2346
66 Ga0075365_10154575 3300006038 Bacteria 1596
67 Ga0075363_100322120 3300006048 Bacteria 899
68 Ga0075363_100557370 3300006048 Bacteria 684
69 Ga0075364_10080856 3300006051 Bacteria 2148
70 Ga0070715_10000015 3300006163 Bacteria 152816
71 Ga0068871_100435385 3300006358 Bacteria 1173
72 Ga0075428_100116996 3300006844 Bacteria 2903
73 Ga0075428_100929205 3300006844 Bacteria 922
74 Ga0075428_102273987 3300006844 Bacteria 558
75 Ga0075430_100085667 3300006846 Bacteria 2638
76 Ga0075430_100930252 3300006846 Unclassified 716
77 Ga0075431_100008958 3300006847 Bacteria 10032
78 Ga0075434_100789106 3300006871 Bacteria 966
79 Ga0075429_100001873 3300006880 Bacteria 17424
80 Ga0075429_100782598 3300006880 Bacteria 836
81 Ga0068865_100000081 3300006881 Bacteria 51047
82 Ga0075435_101224266 3300007076 Bacteria 657
83 Ga0105240_11022131 3300009093 Bacteria 883
84 Ga0111539_11034887 3300009094 Bacteria 954
85 Ga0105245_10000161 3300009098 Bacteria 63378
86 Ga0105245_10000303 3300009098 Bacteria 47259
87 Ga0105245_11039805 3300009098 Bacteria 864
88 Ga0105245_11159364 3300009098 Bacteria 820
89 Ga0105247_10000148 3300009101 Bacteria 68936
90 Ga0114129_10126264 3300009147 Bacteria 3517
91 Ga0114129_11647288 3300009147 Bacteria 784
92 Ga0114129_11862678 3300009147 Bacteria 730
93 Ga0105242_10000052 3300009176 Bacteria 79244
94 Ga0105248_10000017 3300009177 Bacteria 298089
95 Ga0105248_10729692 3300009177 Bacteria 1118
96 Ga0105237_10168751 3300009545 Bacteria 2188
97 Ga0105238_10000023 3300009551 Bacteria 196844
98 Ga0105238_10888782 3300009551 Bacteria 909
99 Ga0105238_12381530 3300009551 Bacteria 565
100 Ga0105249_10000916 3300009553 Bacteria 26081
101 Ga0105249_11955117 3300009553 Bacteria 659
102 Ga0105249_12253186 3300009553 Bacteria 617
103 Ga0105239_11309942 3300010375 Bacteria 836
104 Ga0157327_1024071 3300012512 Bacteria 711
105 Ga0157370_10006508 3300013104 Bacteria 12864
106 Ga0157370_10096226 3300013104 Bacteria 2778
107 Ga0157369_10234888 3300013105 Bacteria 1916
108 Ga0163162_10365364 3300013306 Bacteria 1576
109 Ga0163162_12509971 3300013306 Bacteria 593
110 Ga0157372_10010020 3300013307 Bacteria 10077
111 Ga0157372_12777383 3300013307 Bacteria 561
112 Ga0157372_12808382 3300013307 Unclassified 558
113 Ga0157375_13818965 3300013308 Bacteria 500
114 Ga0163163_10437877 3300014325 Bacteria 1367
115 Ga0163163_10945748 3300014325 Bacteria 925
116 Ga0157377_10446459 3300014745 Bacteria 892
117 Ga0157379_12127433 3300014968 Bacteria 556
118 Ga0157376_11622028 3300014969 Unclassified 681
119 Ga0206356_11377355 3300020070 Bacteria 724
120 Ga0207642_10000001 3300025899 Bacteria 714030
121 Ga0207642_10000003 3300025899 Bacteria 650651
122 Ga0207710_10000336 3300025900 Bacteria 35206
123 Ga0207680_10007274 3300025903 Bacteria 5387
124 Ga0207647_10197367 3300025904 Bacteria 1165
125 Ga0207685_10000001 3300025905 Bacteria 604473
126 Ga0207705_11018319 3300025909 Bacteria 640
127 Ga0207684_11396625 3300025910 Bacteria 573
128 Ga0207707_10494255 3300025912 Bacteria 1044
129 Ga0207671_10435289 3300025914 Bacteria 1044
130 Ga0207660_10092421 3300025917 Bacteria 2246
131 Ga0207652_10009340 3300025921 Bacteria 7885
132 Ga0207681_11540974 3300025923 Bacteria 557
133 Ga0207694_10000004 3300025924 Bacteria 967075
134 Ga0207650_10423601 3300025925 Bacteria 1105
135 Ga0207687_10000026 3300025927 Bacteria 173968
136 Ga0207687_10000040 3300025927 Bacteria 113598
137 Ga0207686_10000119 3300025934 Bacteria 64297
138 Ga0207669_10000024 3300025937 Bacteria 96123
139 Ga0207704_10000018 3300025938 Bacteria 153994
140 Ga0207691_10655657 3300025940 Bacteria 887
141 Ga0207711_10000011 3300025941 Bacteria 518817
142 Ga0207661_10284834 3300025944 Bacteria 1478
143 Ga0207667_10442943 3300025949 Bacteria 1320
144 Ga0207640_10059344 3300025981 Bacteria 2525
145 Ga0207658_10013436 3300025986 Bacteria 5593
146 Ga0207658_10779880 3300025986 Bacteria 867
147 Ga0207677_10661320 3300026023 Bacteria 923
148 Ga0207639_10187014 3300026041 Bacteria 1766
149 Ga0207678_10011817 3300026067 Bacteria 7668
150 Ga0207678_10561386 3300026067 Bacteria 999
151 Ga0207702_10297390 3300026078 Bacteria 1531
152 Ga0207702_10584239 3300026078 Bacteria 1095
153 Ga0207702_10771542 3300026078 Bacteria 950
154 Ga0207702_11348872 3300026078 Bacteria 707
155 Ga0207702_11787988 3300026078 Bacteria 607
156 Ga0207641_10026685 3300026088 Bacteria 4769
157 Ga0207648_10000228 3300026089 Bacteria 60032
158 Ga0207676_10777605 3300026095 Bacteria 933
159 Ga0207674_10106947 3300026116 Bacteria 2774
160 Ga0207683_10058647 3300026121 Bacteria 3380
161 Ga0207698_10000015 3300026142 Bacteria 207368
162 Ga0207698_10134033 3300026142 Bacteria 2122
163 Ga0268266_10000485 3300028379 Bacteria 57051
164 Ga0268266_10007759 3300028379 Bacteria 9630
165 Ga0268264_10071867 3300028381 Bacteria 2933
166 Ga0316577_10077706 3300031733 Bacteria 1854
167 Ga0307413_10809768 3300031824 Bacteria 788
168 Ga0307413_10921152 3300031824 Bacteria 744
169 Ga0307410_10394810 3300031852 Bacteria 1116
170 Ga0307412_10298050 3300031911 Bacteria 1273
171 Ga0307409_100455276 3300031995 Bacteria 1236
172 Ga0307409_101541306 3300031995 Bacteria 692
173 Ga0307416_100385065 3300032002 Bacteria 1434
174 Ga0373962_0358471 3300035242 Unclassified 529
175 Ga0395898_0785509 3300037466 Bacteria 893
176 Ga0436364_1115179 3300037853 Bacteria 680
177 Ga0436363_0576610 3300039450 Bacteria 1925
178 Ga0436363_1002547 3300039450 Unclassified 1473
179 Ga0451804_0102170 3300041463 Bacteria 756
180 Ga0451807_1725604 3300041486 Bacteria 500
181 Ga0451853_3544831 3300041512 Bacteria 1020
182 Ga0466966_0045399 3300044684 Bacteria 2809
183 Ga0466963_0916002 3300044694 Bacteria 618
184 Ga0466964_0009882 3300044706 Bacteria 3596
185 Ga0466971_0306627 3300044719 Bacteria 763
186 Ga0466957_0176924 3300044842 Bacteria 1392
187 Ga0466960_0936501 3300044901 Bacteria 530
188 Ga0466959_0380410 3300045049 Bacteria 961
189 Ga0466958_0431723 3300045836 Bacteria 852
190 Ga0466958_0457795 3300045836 Bacteria 826
191 Ga0466967_0010749 3300045976 Bacteria 6882
192 Ga0466967_0107052 3300045976 Bacteria 2564
193 Ga0466967_0322372 3300045976 Bacteria 1490
194 Ga0495592_0124135 3300046454 Bacteria 1813
195 Ga0495629_0161353 3300046459 Bacteria 1557
196 Ga0495641_0021491 3300046461 Bacteria 3246
197 Ga0495662_0082702 3300046476 Bacteria 1562
198 Ga0495662_0444077 3300046476 Bacteria 636
199 Ga0495606_0000895 3300046507 Bacteria 44393
200 Ga0495618_0179478 3300046514 Bacteria 1346
201 Ga0495620_0000477 3300046515 Bacteria 26080
202 Ga0495628_0279810 3300046516 Bacteria 1239
203 Ga0495652_0014336 3300046529 Bacteria 7115
204 Ga0495586_0373352 3300046535 Bacteria 820
205 Ga0495587_0201668 3300046536 Bacteria 1125
206 Ga0495645_0027274 3300046543 Bacteria 4148
207 Ga0495634_0050411 3300046642 Bacteria 2796
208 Ga0495657_0023378 3300046675 Bacteria 4417
209 Ga0495669_0000335 3300046684 Bacteria 24890
210 Ga0495669_0028571 3300046684 Bacteria 2443
211 Ga0495604_0444373 3300047317 Bacteria 848
212 Ga0495676_0017892 3300047321 Bacteria 6255
213 Ga0495686_0171257 3300047472 Bacteria 1263
214 Ga0495593_0060472 3300047673 Bacteria 1984
215 Ga0495593_0142503 3300047673 Bacteria 1214
216 Ga0496100_0000001 3300048903 Bacteria 530179
217 Ga0496100_0000007 3300048903 Bacteria 261266
218 Ga0496100_0405222 3300048903 Bacteria 1039
219 Ga0496101_0000013 3300048904 Bacteria 261266
220 Ga0496101_0000028 3300048904 Bacteria 198664
221 Ga0496104_0000013 3300048907 Bacteria 397163
222 Ga0496105_0000006 3300048908 Bacteria 393578
223 Ga0496105_0106098 3300048908 Bacteria 2319
224 Ga0496106_0000006 3300048909 Bacteria 251855
225 Ga0496106_0003626 3300048909 Bacteria 11519
226 Ga0496106_0905637 3300048909 Bacteria 696
227 Ga0496107_0000007 3300048910 Bacteria 257113
228 Ga0496107_0002003 3300048910 Bacteria 12994
229 Ga0496107_0176834 3300048910 Bacteria 1585
230 Ga0496107_0383904 3300048910 Unclassified 1045
231 Ga0496108_0000005 3300048911 Bacteria 535059
232 Ga0496108_0000213 3300048911 Bacteria 52787
233 Ga0496108_0225275 3300048911 Bacteria 1630
234 Ga0496108_0587326 3300048911 Bacteria 971
235 Ga0496109_0000002 3300048912 Bacteria 443393
236 Ga0496109_0000021 3300048912 Bacteria 189945
237 Ga0496111_0773552 3300048914 Bacteria 696
238 Ga0496112_0152546 3300048915 Bacteria 2278
239 Ga0496115_0000022 3300048918 Bacteria 164224
240 Ga0496115_0000027 3300048918 Bacteria 145505
241 Ga0496115_0408094 3300048918 Bacteria 1102
242 Ga0496119_0025299 3300048922 Bacteria 4150
243 Ga0496121_0030228 3300048924 Bacteria 4979
244 Ga0496121_0158134 3300048924 Bacteria 1660
245 Ga0496121_0777551 3300048924 Bacteria 566
246 Ga0496124_0155249 3300048927 Bacteria 1791
247 Ga0496125_0151160 3300048928 Bacteria 1594
248 Ga0496126_0073986 3300048929 Bacteria 3026
249 Ga0501031_0003165 3300049568 Bacteria 10560
250 Ga0501031_0086572 3300049568 Bacteria 2043
251 Ga0501032_0001676 3300049569 Bacteria 17605
252 Ga0501032_0268629 3300049569 Bacteria 1105
253 Ga0501033_0002306 3300049570 Bacteria 16278
254 Ga0501034_0001420 3300049571 Bacteria 32044
255 Ga0501034_0062856 3300049571 Bacteria 3727
256 Ga0501036_0005435 3300049572 Bacteria 10326
257 Ga0501036_0416309 3300049572 Bacteria 1120
258 Ga0501037_0000388 3300049573 Bacteria 36535
259 Ga0501038_0007101 3300049574 Bacteria 10342
260 Ga0501038_0241516 3300049574 Bacteria 1434
261 Ga0501039_0020617 3300049575 Bacteria 5051
262 Ga0501039_0073549 3300049575 Bacteria 2655
263 Ga0501040_0129582 3300049576 Bacteria 1773
264 Ga0501040_0751798 3300049576 Bacteria 705
265 Ga0501042_0032122 3300049578 Bacteria 3716
266 Ga0501042_0087983 3300049578 Bacteria 2229
267 Ga0501043_0005413 3300049579 Bacteria 10316
268 Ga0501043_0377933 3300049579 Bacteria 1073
269 Ga0501043_0639140 3300049579 Bacteria 782
270 Ga0501046_0006363 3300049580 Bacteria 10471
271 Ga0501046_0254325 3300049580 Bacteria 1292
272 Ga0501046_0460758 3300049580 Bacteria 913
273 Ga0501047_0001061 3300049581 Bacteria 27415
274 Ga0501047_0115227 3300049581 Bacteria 2569
275 Ga0501047_0223355 3300049581 Bacteria 1739
276 Ga0501048_0004623 3300049582 Bacteria 10472
277 Ga0501048_0137563 3300049582 Bacteria 1726
278 Ga0501067_0268798 3300049583 Bacteria 949
279 Ga0501068_0190379 3300049584 Bacteria 1299
280 Ga0501069_0002834 3300049585 Bacteria 8874
281 Ga0501069_0166796 3300049585 Bacteria 1269
282 Ga0501070_0000875 3300049586 Bacteria 27416
283 Ga0501070_0018871 3300049586 Bacteria 5786
284 Ga0501070_0997199 3300049586 Bacteria 650
285 Ga0501071_0016454 3300049587 Bacteria 5086
286 Ga0501071_0349826 3300049587 Bacteria 1124
287 Ga0501072_0102187 3300049588 Bacteria 2278
288 Ga0501072_0212984 3300049588 Bacteria 1540
289 Ga0501072_0999755 3300049588 Bacteria 652
290 Ga0501073_0033697 3300049589 Bacteria 3645
291 Ga0501073_0885011 3300049589 Bacteria 615
292 Ga0501074_0001974 3300049590 Bacteria 14102
293 Ga0501074_0010449 3300049590 Bacteria 6737
294 Ga0501074_0191319 3300049590 Bacteria 1459
295 Ga0501074_0430495 3300049590 Bacteria 936
296 Ga0501075_0147784 3300049591 Bacteria 1791
297 Ga0501076_0114662 3300049592 Bacteria 2180
298 Ga0501076_0122433 3300049592 Bacteria 2106
299 Ga0501077_0549175 3300049593 Bacteria 741
300 Ga0501079_0010362 3300049741 Bacteria 7084
301 Ga0501079_0028678 3300049741 Bacteria 4272
302 Ga0501079_0079198 3300049741 Bacteria 2541
303 Ga0501079_1120673 3300049741 Bacteria 620
304 Ga0501080_0023419 3300049742 Bacteria 5722
305 Ga0501080_0031994 3300049742 Bacteria 4904
306 Ga0501083_0006318 3300049744 Bacteria 8401
307 Ga0501083_0149303 3300049744 Bacteria 1530
308 Ga0501035_0001270 3300049822 Bacteria 26133
309 Ga0501035_0097428 3300049822 Bacteria 2583
310 Ga0501035_0149719 3300049822 Bacteria 2026
311 Ga0501044_0002144 3300049823 Bacteria 22621
312 Ga0501044_0142635 3300049823 Bacteria 2383
313 Ga0501045_0114497 3300049824 Bacteria 2000
314 Ga0501045_0138560 3300049824 Bacteria 1809
315 nmdc:mga03n38_316434_c1 3300050490 Bacteria 842
316 nmdc:mga03n38_849247_c1 3300050490 Bacteria 534
317 nmdc:mga00v17_51867_c1 3300050491 Bacteria 1951
318 nmdc:mga0yw44_412636_c1 3300050492 Bacteria 914
319 nmdc:mga05p37_1301360_c1 3300050507 Bacteria 741
320 nmdc:mga05p37_1459142_c1 3300050507 Bacteria 684
321 nmdc:mga05p37_26277_c1 3300050507 Bacteria 7080
322 nmdc:mga09592_103560_c1 3300050508 Bacteria 2439
323 nmdc:mga09592_648971_c1 3300050508 Bacteria 901
324 nmdc:mga0qj67_12118_c1 3300050509 Bacteria 6486
325 nmdc:mga06r32_155929_c1 3300050510 Bacteria 2265
326 nmdc:mga0n895_550906_c1 3300050512 Bacteria 1159
327 Ga0495612_0221405 3300053078 Bacteria 838
328 Ga0501082_0006125 3300060353 Bacteria 10442
329 Ga0501082_0104493 3300060353 Bacteria 2450
330 Ga0530510_0393332 3300061734 Bacteria 1044
331 Ga0530510_1340457 3300061734 Bacteria 549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100596585 Ga0070684_1005965852 116
2 3300005937 Ga0081455_10194620 Ga0081455_101946202 116
3 3300006844 Ga0075428_100116996 Ga0075428_1001169962 116
4 3300006844 Ga0075428_100929205 Ga0075428_1009292052 116
5 3300006846 Ga0075430_100085667 Ga0075430_1000856673 116
6 3300006847 Ga0075431_100008958 Ga0075431_1000089584 116
7 3300006880 Ga0075429_100001873 Ga0075429_10000187314 116
8 3300009147 Ga0114129_10126264 Ga0114129_101262642 116
9 3300013307 Ga0157372_12808382 Ga0157372_128083821 116
10 3300049588 Ga0501072_0999755 Ga0501072_0999755_128_499 116
11 3300050507 nmdc:mga05p37_26277_c1 nmdc:mga05p37_26277_c1_160_516 116
12 3300050508 nmdc:mga09592_103560_c1 nmdc:mga09592_103560_c1_1333_1689 116
13 3300050509 nmdc:mga0qj67_12118_c1 nmdc:mga0qj67_12118_c1_4926_5282 116
14 3300050510 nmdc:mga06r32_155929_c1 nmdc:mga06r32_155929_c1_1343_1699 116
15 3300002074 JGI24748J21848_1006825 JGI24748J21848_10068252 117
16 3300002239 JGI24034J26672_10001357 JGI24034J26672_100013574 117
17 3300002244 JGI24742J22300_10024628 JGI24742J22300_100246282 117
18 3300005327 Ga0070658_10633341 Ga0070658_106333411 117
19 3300005329 Ga0070683_100048655 Ga0070683_1000486554 117
20 3300005331 Ga0070670_100500115 Ga0070670_1005001151 117
21 3300005335 Ga0070666_10018746 Ga0070666_100187462 117
22 3300005336 Ga0070680_100003460 Ga0070680_1000034605 117
23 3300005336 Ga0070680_100219776 Ga0070680_1002197763 117
24 3300005337 Ga0070682_100987033 Ga0070682_1009870331 117
25 3300005338 Ga0068868_100691182 Ga0068868_1006911822 117
26 3300005339 Ga0070660_100032922 Ga0070660_1000329225 117
27 3300005341 Ga0070691_10000013 Ga0070691_1000001315 117
28 3300005344 Ga0070661_100031091 Ga0070661_1000310914 117
29 3300005354 Ga0070675_101328966 Ga0070675_1013289662 117
30 3300005366 Ga0070659_100003502 Ga0070659_1000035025 117
31 3300005367 Ga0070667_100042153 Ga0070667_1000421532 117
32 3300005438 Ga0070701_10148844 Ga0070701_101488442 117
33 3300005444 Ga0070694_100672606 Ga0070694_1006726062 117
34 3300005444 Ga0070694_101666773 Ga0070694_1016667731 117
35 3300005455 Ga0070663_100017822 Ga0070663_1000178221 117
36 3300005456 Ga0070678_100059802 Ga0070678_1000598022 117
37 3300005458 Ga0070681_10079537 Ga0070681_100795375 117
38 3300005458 Ga0070681_10626115 Ga0070681_106261152 117
39 3300005459 Ga0068867_100001373 Ga0068867_10000137310 117
40 3300005530 Ga0070679_100014082 Ga0070679_1000140821 117
41 3300005530 Ga0070679_100024938 Ga0070679_1000249383 117
42 3300005535 Ga0070684_100012100 Ga0070684_1000121005 117
43 3300005539 Ga0068853_100153753 Ga0068853_1001537532 117
44 3300005545 Ga0070695_100030577 Ga0070695_1000305775 117
45 3300005548 Ga0070665_100010698 Ga0070665_1000106982 117
46 3300005548 Ga0070665_100038262 Ga0070665_1000382622 117
47 3300005549 Ga0070704_101116053 Ga0070704_1011160531 117
48 3300005563 Ga0068855_100916259 Ga0068855_1009162592 117
49 3300005564 Ga0070664_100283263 Ga0070664_1002832633 117
50 3300005577 Ga0068857_100160146 Ga0068857_1001601465 117
51 3300005578 Ga0068854_100069710 Ga0068854_1000697103 117
52 3300005578 Ga0068854_100100253 Ga0068854_1001002535 117
53 3300005614 Ga0068856_100012354 Ga0068856_1000123544 117
54 3300005614 Ga0068856_100020021 Ga0068856_1000200212 117
55 3300005616 Ga0068852_100000037 Ga0068852_10000003763 117
56 3300005616 Ga0068852_100002642 Ga0068852_10000264210 117
57 3300005718 Ga0068866_10000002 Ga0068866_1000000295 117
58 3300005841 Ga0068863_100063203 Ga0068863_1000632033 117
59 3300005841 Ga0068863_100658860 Ga0068863_1006588601 117
60 3300005843 Ga0068860_100089860 Ga0068860_1000898603 117
61 3300005983 Ga0081540_1051787 Ga0081540_10517872 117
62 3300006048 Ga0075363_100557370 Ga0075363_1005573701 117
63 3300006163 Ga0070715_10000015 Ga0070715_1000001574 117
64 3300006358 Ga0068871_100435385 Ga0068871_1004353852 117
65 3300006844 Ga0075428_102273987 Ga0075428_1022739872 117
66 3300006846 Ga0075430_100930252 Ga0075430_1009302522 117
67 3300006871 Ga0075434_100789106 Ga0075434_1007891062 117
68 3300006880 Ga0075429_100782598 Ga0075429_1007825982 117
69 3300006881 Ga0068865_100000081 Ga0068865_10000008147 117
70 3300009093 Ga0105240_11022131 Ga0105240_110221312 117
71 3300009094 Ga0111539_11034887 Ga0111539_110348872 117
72 3300009098 Ga0105245_10000161 Ga0105245_1000016142 117
73 3300009098 Ga0105245_10000303 Ga0105245_100003038 117
74 3300009098 Ga0105245_11039805 Ga0105245_110398052 117
75 3300009098 Ga0105245_11159364 Ga0105245_111593642 117
76 3300009101 Ga0105247_10000148 Ga0105247_1000014848 117
77 3300009147 Ga0114129_11647288 Ga0114129_116472882 117
78 3300009147 Ga0114129_11862678 Ga0114129_118626781 117
79 3300009176 Ga0105242_10000052 Ga0105242_1000005238 117
80 3300009177 Ga0105248_10000017 Ga0105248_10000017241 117
81 3300009177 Ga0105248_10729692 Ga0105248_107296922 117
82 3300009545 Ga0105237_10168751 Ga0105237_101687512 117
83 3300009551 Ga0105238_10000023 Ga0105238_10000023111 117
84 3300009551 Ga0105238_10888782 Ga0105238_108887821 117
85 3300009551 Ga0105238_12381530 Ga0105238_123815301 117
86 3300009553 Ga0105249_11955117 Ga0105249_119551172 117
87 3300009553 Ga0105249_12253186 Ga0105249_122531861 117
88 3300010375 Ga0105239_11309942 Ga0105239_113099422 117
89 3300013104 Ga0157370_10006508 Ga0157370_100065082 117
90 3300013104 Ga0157370_10096226 Ga0157370_100962262 117
91 3300013105 Ga0157369_10234888 Ga0157369_102348882 117
92 3300013307 Ga0157372_10010020 Ga0157372_100100204 117
93 3300013308 Ga0157375_13818965 Ga0157375_138189651 117
94 3300014325 Ga0163163_10945748 Ga0163163_109457481 117
95 3300014745 Ga0157377_10446459 Ga0157377_104464592 117
96 3300014968 Ga0157379_12127433 Ga0157379_121274331 117
97 3300014969 Ga0157376_11622028 Ga0157376_116220282 117
98 3300020070 Ga0206356_11377355 Ga0206356_113773552 117
99 3300025899 Ga0207642_10000001 Ga0207642_10000001513 117
100 3300025899 Ga0207642_10000003 Ga0207642_10000003513 117
101 3300025900 Ga0207710_10000336 Ga0207710_1000033620 117
102 3300025903 Ga0207680_10007274 Ga0207680_100072743 117
103 3300025904 Ga0207647_10197367 Ga0207647_101973671 117
104 3300025905 Ga0207685_10000001 Ga0207685_10000001352 117
105 3300025909 Ga0207705_11018319 Ga0207705_110183191 117
106 3300025910 Ga0207684_11396625 Ga0207684_113966251 117
107 3300025912 Ga0207707_10494255 Ga0207707_104942552 117
108 3300025914 Ga0207671_10435289 Ga0207671_104352891 117
109 3300025917 Ga0207660_10092421 Ga0207660_100924211 117
110 3300025921 Ga0207652_10009340 Ga0207652_100093408 117
111 3300025924 Ga0207694_10000004 Ga0207694_10000004799 117
112 3300025925 Ga0207650_10423601 Ga0207650_104236012 117
113 3300025927 Ga0207687_10000026 Ga0207687_1000002677 117
114 3300025927 Ga0207687_10000040 Ga0207687_1000004081 117
115 3300025934 Ga0207686_10000119 Ga0207686_1000011924 117
116 3300025937 Ga0207669_10000024 Ga0207669_1000002493 117
117 3300025938 Ga0207704_10000018 Ga0207704_1000001891 117
118 3300025940 Ga0207691_10655657 Ga0207691_106556572 117
119 3300025941 Ga0207711_10000011 Ga0207711_10000011288 117
120 3300025949 Ga0207667_10442943 Ga0207667_104429432 117
121 3300025981 Ga0207640_10059344 Ga0207640_100593443 117
122 3300025986 Ga0207658_10013436 Ga0207658_100134363 117
123 3300025986 Ga0207658_10779880 Ga0207658_107798801 117
124 3300026023 Ga0207677_10661320 Ga0207677_106613202 117
125 3300026041 Ga0207639_10187014 Ga0207639_101870142 117
126 3300026067 Ga0207678_10011817 Ga0207678_100118178 117
127 3300026078 Ga0207702_10297390 Ga0207702_102973902 117
128 3300026078 Ga0207702_10584239 Ga0207702_105842391 117
129 3300026078 Ga0207702_11348872 Ga0207702_113488722 117
130 3300026088 Ga0207641_10026685 Ga0207641_100266855 117
131 3300026089 Ga0207648_10000228 Ga0207648_1000022857 117
132 3300026121 Ga0207683_10058647 Ga0207683_100586473 117
133 3300026142 Ga0207698_10000015 Ga0207698_10000015185 117
134 3300026142 Ga0207698_10134033 Ga0207698_101340332 117
135 3300028379 Ga0268266_10000485 Ga0268266_1000048531 117
136 3300028379 Ga0268266_10007759 Ga0268266_100077592 117
137 3300028381 Ga0268264_10071867 Ga0268264_100718673 117
138 3300031824 Ga0307413_10809768 Ga0307413_108097682 117
139 3300031824 Ga0307413_10921152 Ga0307413_109211521 117
140 3300031852 Ga0307410_10394810 Ga0307410_103948102 117
141 3300031911 Ga0307412_10298050 Ga0307412_102980503 117
142 3300031995 Ga0307409_100455276 Ga0307409_1004552761 117
143 3300031995 Ga0307409_101541306 Ga0307409_1015413062 117
144 3300032002 Ga0307416_100385065 Ga0307416_1003850652 117
145 3300037466 Ga0395898_0785509 Ga0395898_0785509_250_609 117
146 3300039450 Ga0436363_0576610 Ga0436363_0576610_1491_1850 117
147 3300039450 Ga0436363_1002547 Ga0436363_1002547_968_1333 117
148 3300041463 Ga0451804_0102170 Ga0451804_0102170_244_606 117
149 3300041486 Ga0451807_1725604 Ga0451807_1725604_29_388 117
150 3300041512 Ga0451853_3544831 Ga0451853_3544831_583_945 117
151 3300044684 Ga0466966_0045399 Ga0466966_0045399_285_653 117
152 3300044694 Ga0466963_0916002 Ga0466963_0916002_159_545 117
153 3300045049 Ga0466959_0380410 Ga0466959_0380410_307_675 117
154 3300045836 Ga0466958_0457795 Ga0466958_0457795_250_618 117
155 3300046454 Ga0495592_0124135 Ga0495592_0124135_730_1089 117
156 3300046461 Ga0495641_0021491 Ga0495641_0021491_1140_1499 117
157 3300046476 Ga0495662_0082702 Ga0495662_0082702_653_1015 117
158 3300046476 Ga0495662_0444077 Ga0495662_0444077_72_434 117
159 3300046507 Ga0495606_0000895 Ga0495606_0000895_15930_16292 117
160 3300046514 Ga0495618_0179478 Ga0495618_0179478_42_401 117
161 3300046515 Ga0495620_0000477 Ga0495620_0000477_14317_14682 117
162 3300046516 Ga0495628_0279810 Ga0495628_0279810_60_419 117
163 3300046529 Ga0495652_0014336 Ga0495652_0014336_4605_4964 117
164 3300046535 Ga0495586_0373352 Ga0495586_0373352_357_716 117
165 3300046536 Ga0495587_0201668 Ga0495587_0201668_469_828 117
166 3300046543 Ga0495645_0027274 Ga0495645_0027274_3177_3536 117
167 3300046642 Ga0495634_0050411 Ga0495634_0050411_1847_2209 117
168 3300046675 Ga0495657_0023378 Ga0495657_0023378_1779_2138 117
169 3300046684 Ga0495669_0000335 Ga0495669_0000335_253_621 117
170 3300046684 Ga0495669_0028571 Ga0495669_0028571_1598_1960 117
171 3300047317 Ga0495604_0444373 Ga0495604_0444373_457_816 117
172 3300047321 Ga0495676_0017892 Ga0495676_0017892_2054_2413 117
173 3300047472 Ga0495686_0171257 Ga0495686_0171257_197_589 117
174 3300047673 Ga0495593_0060472 Ga0495593_0060472_657_1016 117
175 3300047673 Ga0495593_0142503 Ga0495593_0142503_444_806 117
176 3300048903 Ga0496100_0000001 Ga0496100_0000001_6406_6765 117
177 3300048903 Ga0496100_0000007 Ga0496100_0000007_43086_43454 117
178 3300048903 Ga0496100_0405222 Ga0496100_0405222_545_931 117
179 3300048904 Ga0496101_0000013 Ga0496101_0000013_43086_43454 117
180 3300048904 Ga0496101_0000028 Ga0496101_0000028_6395_6754 117
181 3300048907 Ga0496104_0000013 Ga0496104_0000013_245430_245798 117
182 3300048908 Ga0496105_0000006 Ga0496105_0000006_151366_151734 117
183 3300048908 Ga0496105_0106098 Ga0496105_0106098_170_556 117
184 3300048909 Ga0496106_0000006 Ga0496106_0000006_37225_37593 117
185 3300048909 Ga0496106_0003626 Ga0496106_0003626_4758_5117 117
186 3300048909 Ga0496106_0905637 Ga0496106_0905637_49_411 117
187 3300048910 Ga0496107_0000007 Ga0496107_0000007_37227_37595 117
188 3300048910 Ga0496107_0002003 Ga0496107_0002003_4765_5124 117
189 3300048910 Ga0496107_0176834 Ga0496107_0176834_1188_1574 117
190 3300048910 Ga0496107_0383904 Ga0496107_0383904_250_612 117
191 3300048911 Ga0496108_0000005 Ga0496108_0000005_517007_517369 117
192 3300048911 Ga0496108_0000213 Ga0496108_0000213_26228_26587 117
193 3300048911 Ga0496108_0225275 Ga0496108_0225275_1046_1405 117
194 3300048911 Ga0496108_0587326 Ga0496108_0587326_262_648 117
195 3300048912 Ga0496109_0000002 Ga0496109_0000002_17723_18085 117
196 3300048912 Ga0496109_0000021 Ga0496109_0000021_41763_42122 117
197 3300048914 Ga0496111_0773552 Ga0496111_0773552_311_670 117
198 3300048915 Ga0496112_0152546 Ga0496112_0152546_1368_1727 117
199 3300048918 Ga0496115_0000022 Ga0496115_0000022_109424_109783 117
200 3300048918 Ga0496115_0408094 Ga0496115_0408094_192_578 117
201 3300048922 Ga0496119_0025299 Ga0496119_0025299_1402_1788 117
202 3300048924 Ga0496121_0030228 Ga0496121_0030228_1443_1829 117
203 3300048924 Ga0496121_0158134 Ga0496121_0158134_873_1259 117
204 3300048924 Ga0496121_0777551 Ga0496121_0777551_71_457 117
205 3300048927 Ga0496124_0155249 Ga0496124_0155249_1367_1753 117
206 3300048928 Ga0496125_0151160 Ga0496125_0151160_1014_1400 117
207 3300048929 Ga0496126_0073986 Ga0496126_0073986_844_1233 117
208 3300049568 Ga0501031_0003165 Ga0501031_0003165_3026_3412 117
209 3300049568 Ga0501031_0086572 Ga0501031_0086572_1069_1434 117
210 3300049569 Ga0501032_0001676 Ga0501032_0001676_7948_8334 117
211 3300049569 Ga0501032_0268629 Ga0501032_0268629_642_1007 117
212 3300049570 Ga0501033_0002306 Ga0501033_0002306_8902_9288 117
213 3300049571 Ga0501034_0001420 Ga0501034_0001420_6229_6615 117
214 3300049571 Ga0501034_0062856 Ga0501034_0062856_933_1319 117
215 3300049572 Ga0501036_0005435 Ga0501036_0005435_6905_7291 117
216 3300049572 Ga0501036_0416309 Ga0501036_0416309_21_386 117
217 3300049573 Ga0501037_0000388 Ga0501037_0000388_6912_7298 117
218 3300049574 Ga0501038_0007101 Ga0501038_0007101_6910_7296 117
219 3300049574 Ga0501038_0241516 Ga0501038_0241516_230_595 117
220 3300049575 Ga0501039_0020617 Ga0501039_0020617_4035_4421 117
221 3300049575 Ga0501039_0073549 Ga0501039_0073549_1318_1683 117
222 3300049576 Ga0501040_0129582 Ga0501040_0129582_406_771 117
223 3300049576 Ga0501040_0751798 Ga0501040_0751798_271_630 117
224 3300049578 Ga0501042_0032122 Ga0501042_0032122_554_940 117
225 3300049578 Ga0501042_0087983 Ga0501042_0087983_1118_1483 117
226 3300049579 Ga0501043_0005413 Ga0501043_0005413_6912_7298 117
227 3300049579 Ga0501043_0377933 Ga0501043_0377933_698_1063 117
228 3300049579 Ga0501043_0639140 Ga0501043_0639140_323_712 117
229 3300049580 Ga0501046_0006363 Ga0501046_0006363_6945_7331 117
230 3300049580 Ga0501046_0254325 Ga0501046_0254325_525_890 117
231 3300049580 Ga0501046_0460758 Ga0501046_0460758_182_547 117
232 3300049581 Ga0501047_0001061 Ga0501047_0001061_15723_16109 117
233 3300049581 Ga0501047_0115227 Ga0501047_0115227_1964_2329 117
234 3300049581 Ga0501047_0223355 Ga0501047_0223355_881_1267 117
235 3300049582 Ga0501048_0004623 Ga0501048_0004623_6947_7333 117
236 3300049582 Ga0501048_0137563 Ga0501048_0137563_1067_1432 117
237 3300049583 Ga0501067_0268798 Ga0501067_0268798_344_730 117
238 3300049584 Ga0501068_0190379 Ga0501068_0190379_720_1079 117
239 3300049585 Ga0501069_0002834 Ga0501069_0002834_2974_3339 117
240 3300049585 Ga0501069_0166796 Ga0501069_0166796_562_948 117
241 3300049586 Ga0501070_0000875 Ga0501070_0000875_11307_11693 117
242 3300049586 Ga0501070_0018871 Ga0501070_0018871_4960_5322 117
243 3300049586 Ga0501070_0997199 Ga0501070_0997199_252_611 117
244 3300049587 Ga0501071_0016454 Ga0501071_0016454_2478_2843 117
245 3300049587 Ga0501071_0349826 Ga0501071_0349826_715_1080 117
246 3300049588 Ga0501072_0102187 Ga0501072_0102187_382_747 117
247 3300049588 Ga0501072_0212984 Ga0501072_0212984_632_1018 117
248 3300049589 Ga0501073_0885011 Ga0501073_0885011_42_428 117
249 3300049590 Ga0501074_0001974 Ga0501074_0001974_1067_1432 117
250 3300049590 Ga0501074_0010449 Ga0501074_0010449_1602_1988 117
251 3300049590 Ga0501074_0191319 Ga0501074_0191319_240_626 117
252 3300049590 Ga0501074_0430495 Ga0501074_0430495_242_607 117
253 3300049591 Ga0501075_0147784 Ga0501075_0147784_1100_1465 117
254 3300049592 Ga0501076_0122433 Ga0501076_0122433_206_571 117
255 3300049593 Ga0501077_0549175 Ga0501077_0549175_319_684 117
256 3300049741 Ga0501079_0010362 Ga0501079_0010362_2423_2809 117
257 3300049741 Ga0501079_0028678 Ga0501079_0028678_92_457 117
258 3300049741 Ga0501079_0079198 Ga0501079_0079198_1396_1761 117
259 3300049742 Ga0501080_0023419 Ga0501080_0023419_3694_4080 117
260 3300049742 Ga0501080_0031994 Ga0501080_0031994_1363_1728 117
261 3300049744 Ga0501083_0149303 Ga0501083_0149303_833_1198 117
262 3300049822 Ga0501035_0001270 Ga0501035_0001270_15710_16096 117
263 3300049822 Ga0501035_0097428 Ga0501035_0097428_639_1025 117
264 3300049822 Ga0501035_0149719 Ga0501035_0149719_1276_1641 117
265 3300049823 Ga0501044_0002144 Ga0501044_0002144_2803_3189 117
266 3300049823 Ga0501044_0142635 Ga0501044_0142635_1385_1750 117
267 3300049824 Ga0501045_0114497 Ga0501045_0114497_74_439 117
268 3300049824 Ga0501045_0138560 Ga0501045_0138560_917_1303 117
269 3300050490 nmdc:mga03n38_849247_c1 nmdc:mga03n38_849247_c1_98_460 117
270 3300050491 nmdc:mga00v17_51867_c1 nmdc:mga00v17_51867_c1_767_1126 117
271 3300050507 nmdc:mga05p37_1301360_c1 nmdc:mga05p37_1301360_c1_213_572 117
272 3300050507 nmdc:mga05p37_1459142_c1 nmdc:mga05p37_1459142_c1_251_613 117
273 3300050508 nmdc:mga09592_648971_c1 nmdc:mga09592_648971_c1_116_478 117
274 3300050512 nmdc:mga0n895_550906_c1 nmdc:mga0n895_550906_c1_383_742 117
275 3300053078 Ga0495612_0221405 Ga0495612_0221405_160_519 117
276 3300060353 Ga0501082_0006125 Ga0501082_0006125_3126_3512 117
277 3300060353 Ga0501082_0104493 Ga0501082_0104493_1104_1469 117
278 3300061734 Ga0530510_0393332 Ga0530510_0393332_249_614 117
279 3300061734 Ga0530510_1340457 Ga0530510_1340457_26_388 117
280 3300002070 JGI24750J21931_1067993 JGI24750J21931_10679932 118
281 3300002459 JGI24751J29686_10139108 JGI24751J29686_101391081 118
282 3300005347 Ga0070668_100101771 Ga0070668_1001017713 118
283 3300005353 Ga0070669_101172198 Ga0070669_1011721982 118
284 3300005367 Ga0070667_100000597 Ga0070667_10000059736 118
285 3300005455 Ga0070663_100958907 Ga0070663_1009589071 118
286 3300005535 Ga0070684_101400108 Ga0070684_1014001081 118
287 3300005548 Ga0070665_100066179 Ga0070665_1000661794 118
288 3300005564 Ga0070664_101288506 Ga0070664_1012885061 118
289 3300005577 Ga0068857_100361937 Ga0068857_1003619372 118
290 3300005614 Ga0068856_100795016 Ga0068856_1007950162 118
291 3300005842 Ga0068858_100046292 Ga0068858_1000462925 118
292 3300005843 Ga0068860_100162838 Ga0068860_1001628382 118
293 3300005844 Ga0068862_100000366 Ga0068862_10000036625 118
294 3300005985 Ga0081539_10246677 Ga0081539_102466772 118
295 3300006038 Ga0075365_10070820 Ga0075365_100708202 118
296 3300006038 Ga0075365_10154575 Ga0075365_101545752 118
297 3300006048 Ga0075363_100322120 Ga0075363_1003221202 118
298 3300006051 Ga0075364_10080856 Ga0075364_100808562 118
299 3300007076 Ga0075435_101224266 Ga0075435_1012242661 118
300 3300009553 Ga0105249_10000916 Ga0105249_1000091611 118
301 3300012512 Ga0157327_1024071 Ga0157327_10240712 118
302 3300013306 Ga0163162_10365364 Ga0163162_103653642 118
303 3300013306 Ga0163162_12509971 Ga0163162_125099712 118
304 3300013307 Ga0157372_12777383 Ga0157372_127773831 118
305 3300014325 Ga0163163_10437877 Ga0163163_104378771 118
306 3300025923 Ga0207681_11540974 Ga0207681_115409741 118
307 3300025944 Ga0207661_10284834 Ga0207661_102848342 118
308 3300026067 Ga0207678_10561386 Ga0207678_105613862 118
309 3300026078 Ga0207702_10771542 Ga0207702_107715422 118
310 3300026078 Ga0207702_11787988 Ga0207702_117879882 118
311 3300026095 Ga0207676_10777605 Ga0207676_107776052 118
312 3300026116 Ga0207674_10106947 Ga0207674_101069472 118
313 3300031733 Ga0316577_10077706 Ga0316577_100777063 118
314 3300035242 Ga0373962_0358471 Ga0373962_0358471_35_403 118
315 3300037853 Ga0436364_1115179 Ga0436364_1115179_217_582 118
316 3300044706 Ga0466964_0009882 Ga0466964_0009882_288_653 118
317 3300044719 Ga0466971_0306627 Ga0466971_0306627_36_401 118
318 3300044842 Ga0466957_0176924 Ga0466957_0176924_420_785 118
319 3300044901 Ga0466960_0936501 Ga0466960_0936501_140_505 118
320 3300045836 Ga0466958_0431723 Ga0466958_0431723_210_575 118
321 3300045976 Ga0466967_0010749 Ga0466967_0010749_4642_5007 118
322 3300045976 Ga0466967_0107052 Ga0466967_0107052_2103_2468 118
323 3300045976 Ga0466967_0322372 Ga0466967_0322372_153_518 118
324 3300046459 Ga0495629_0161353 Ga0495629_0161353_170_565 118
325 3300048918 Ga0496115_0000027 Ga0496115_0000027_140157_140552 118
326 3300049589 Ga0501073_0033697 Ga0501073_0033697_516_962 118
327 3300049592 Ga0501076_0114662 Ga0501076_0114662_885_1250 118
328 3300049741 Ga0501079_1120673 Ga0501079_1120673_26_385 118
329 3300049744 Ga0501083_0006318 Ga0501083_0006318_5152_5598 118
330 3300050490 nmdc:mga03n38_316434_c1 nmdc:mga03n38_316434_c1_283_648 118
331 3300050492 nmdc:mga0yw44_412636_c1 nmdc:mga0yw44_412636_c1_384_749 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

131

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

27

132

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8337 3 113
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.833 1 115
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8166 4 113
7n7g-assembly1.cif.gz_A crystal structure of fosb from enterococcus faecium with fosfomycin 0.8121 2 113
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8114 8 113
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8605 63 112 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8325 59 115 3.30.720.110
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8212 2 113 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8165 63 112 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8079 59 115 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A538EE05-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9929 25 118 GO:0051213
AF-H0E9P6-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9903 1 118 GO:0004493
GO:0046491
GO:0051213
AF-A0A838PQ57-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9881 2 118 GO:0051213
AF-H0E9P6-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.982 1 118 GO:0004493
GO:0046491
GO:0051213
AF-A0A7W0TDV2-F1-model_v4 VOC domain-containing protein 0.9756 57 116

Feature Viewer

pLDDT pTM Quality
96.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map