F410647

General Info

Members Datasets Scaffolds Average Seq Length
331 228 662 261

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0147157|Ga0495632_0147157_140_1015
Length 291
Sequence MTRRPAAKPGVFRFGIRLDRLVFAAEERPSWAMRRLPLPSLWLAVFLLLGLGSPLAPVHAATPVYGYTVVRTYPHDPNAFTEGLFLRDGFLYESTGLEGASSIRKIVLETGSVENERSISSQYFGEGIIDWGEKLIQLTWQNQIGFVYGVDDFETRGEFTYAGEGWALTRDDKRIIMSDGTSRLRFLDPETLKETGGITVTDEGRPVDQLNELEWVKGEIYANVWQTDRIVRIDPATGKVKGWIDLTGLLPETDRAQADVLNGIAYDAKTDRLIVTGKLWPRMYEIRLVKR

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
205 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
206 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
214 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
215 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
216 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
217 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
218 2643221583 Caulobacter sp. Root655 Isolate Unclassified
219 2643221584 Caulobacter sp. Root656 Isolate Unclassified
220 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
221 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
222 2818991435 Caulobacter henricii 536 Isolate Unclassified
223 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
224 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
225 2849560528 Caulobacter zeae 410 Isolate Unclassified
226 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
227 2851153111 Caulobacter radicis 736 Isolate Unclassified
228 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 0
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 0
Rhizoplane 2.11
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0147157 3300046519 Bacteria 1090
2 JGI25153J46596_10063460 3300003215 Bacteria 990
3 rootH2_10131718 3300003320 Bacteria 2572
4 rootL2_10019980 3300003322 Unclassified 3809
5 rootL2_10193206 3300003322 Bacteria 3436
6 Ga0055524_1004294 3300003775 Bacteria 6608
7 Ga0055528_1010630 3300003790 Bacteria 3726
8 Ga0055531_10005430 3300003794 Bacteria 7462
9 Ga0065165_1001315 3300005262 Bacteria 27750
10 Ga0065712_10076559 3300005290 Bacteria 3632
11 Ga0070683_100177609 3300005329 Unclassified 2021
12 Ga0070690_100000802 3300005330 Bacteria 15934
13 Ga0070670_100005126 3300005331 Bacteria 11025
14 Ga0070670_100054371 3300005331 Bacteria 3437
15 Ga0068869_100225273 3300005334 Bacteria 1488
16 Ga0070666_10001967 3300005335 Bacteria 12519
17 Ga0070666_10049471 3300005335 Bacteria 2825
18 Ga0070682_100310782 3300005337 Bacteria 1160
19 Ga0068868_100002550 3300005338 Bacteria 12662
20 Ga0068868_100034764 3300005338 Bacteria 3893
21 Ga0068868_100163855 3300005338 Bacteria 1838
22 Ga0070660_100186151 3300005339 Bacteria 1681
23 Ga0070691_10034387 3300005341 Bacteria 2386
24 Ga0070687_100086122 3300005343 Bacteria 1726
25 Ga0070661_100010584 3300005344 Bacteria 6415
26 Ga0070671_100048812 3300005355 Bacteria 3521
27 Ga0070671_100150536 3300005355 Bacteria 1965
28 Ga0070671_100283816 3300005355 Bacteria 1408
29 Ga0070671_100504077 3300005355 Bacteria 1041
30 Ga0070674_100010503 3300005356 Bacteria 5601
31 Ga0070674_100174002 3300005356 Bacteria 1644
32 Ga0070673_100022944 3300005364 Bacteria 4554
33 Ga0070673_100024178 3300005364 Bacteria 4450
34 Ga0070667_100032287 3300005367 Bacteria 4367
35 Ga0070667_100082597 3300005367 Bacteria 2751
36 Ga0070667_100192369 3300005367 Bacteria 1808
37 Ga0070701_10052885 3300005438 Bacteria 2111
38 Ga0070705_100041007 3300005440 Bacteria 2636
39 Ga0070700_100019316 3300005441 Bacteria 3930
40 Ga0070678_100210031 3300005456 Bacteria 1612
41 Ga0070678_100292328 3300005456 Unclassified 1382
42 Ga0070662_100135581 3300005457 Bacteria 1903
43 Ga0068867_100010080 3300005459 Bacteria 6658
44 Ga0070685_10206118 3300005466 Bacteria 1281
45 Ga0070685_10399163 3300005466 Unclassified 952
46 Ga0070684_100186180 3300005535 Bacteria 1888
47 Ga0068853_100283044 3300005539 Bacteria 1529
48 Ga0070672_100004880 3300005543 Bacteria 8821
49 Ga0070672_100112450 3300005543 Bacteria 2221
50 Ga0070686_100027062 3300005544 Bacteria 3468
51 Ga0070686_100110555 3300005544 Bacteria 1871
52 Ga0070696_100296062 3300005546 Bacteria 1238
53 Ga0070704_100096563 3300005549 Bacteria 2216
54 Ga0070664_100000804 3300005564 Bacteria 24111
55 Ga0070664_100089403 3300005564 Bacteria 2664
56 Ga0070664_100582628 3300005564 Bacteria 1037
57 Ga0068854_100179850 3300005578 Bacteria 1651
58 Ga0068856_100072221 3300005614 Bacteria 3416
59 Ga0068859_100218494 3300005617 Bacteria 1993
60 Ga0068859_100318423 3300005617 Bacteria 1649
61 Ga0068859_100414023 3300005617 Unclassified 1444
62 Ga0068864_100001034 3300005618 Bacteria 23316
63 Ga0068864_100150245 3300005618 Bacteria 2109
64 Ga0068864_100381036 3300005618 Bacteria 1336
65 Ga0068863_100015113 3300005841 Bacteria 7416
66 Ga0068863_100051656 3300005841 Bacteria 3895
67 Ga0068863_100176497 3300005841 Unclassified 2050
68 Ga0068858_100011493 3300005842 Bacteria 8355
69 Ga0068858_100035125 3300005842 Bacteria 4649
70 Ga0068858_100293962 3300005842 Bacteria 1549
71 Ga0068860_100003650 3300005843 Bacteria 15838
72 Ga0068860_100144446 3300005843 Bacteria 2289
73 Ga0068862_100645162 3300005844 Bacteria 1021
74 Ga0075369_10005238 3300006186 Bacteria 4834
75 Ga0097621_100009239 3300006237 Bacteria 7152
76 Ga0097621_100036971 3300006237 Bacteria 3909
77 Ga0097621_100265146 3300006237 Bacteria 1508
78 Ga0075370_10152707 3300006353 Bacteria 1353
79 Ga0068871_100029560 3300006358 Bacteria 4305
80 Ga0075428_100024607 3300006844 Bacteria 6664
81 Ga0075429_100245923 3300006880 Bacteria 1566
82 Ga0068865_100146848 3300006881 Bacteria 1784
83 Ga0097620_100218515 3300006931 Bacteria 1993
84 Ga0097620_100318431 3300006931 Bacteria 1649
85 Ga0097620_100414000 3300006931 Unclassified 1444
86 Ga0075435_100001593 3300007076 Bacteria 14635
87 Ga0105240_10034139 3300009093 Bacteria 6565
88 Ga0105240_10556067 3300009093 Bacteria 1269
89 Ga0111539_10685916 3300009094 Unclassified 1192
90 Ga0105247_10014549 3300009101 Bacteria 4719
91 Ga0114129_10005298 3300009147 Bacteria 18197
92 Ga0114129_10011563 3300009147 Bacteria 12569
93 Ga0114129_10021331 3300009147 Bacteria 9197
94 Ga0105243_10093117 3300009148 Bacteria 2486
95 Ga0105243_10119948 3300009148 Bacteria 2215
96 Ga0105241_10043878 3300009174 Bacteria 3387
97 Ga0105242_10212447 3300009176 Bacteria 1725
98 Ga0105242_10845144 3300009176 Bacteria 910
99 Ga0105248_10017755 3300009177 Bacteria 7848
100 Ga0105248_10471639 3300009177 Bacteria 1415
101 Ga0105248_10660369 3300009177 Bacteria 1180
102 Ga0105237_10184418 3300009545 Bacteria 2087
103 Ga0105238_10117600 3300009551 Bacteria 2638
104 Ga0105238_10272509 3300009551 Bacteria 1673
105 Ga0105249_10137203 3300009553 Bacteria 2342
106 Ga0105249_10231070 3300009553 Unclassified 1824
107 Ga0105249_10262151 3300009553 Bacteria 1718
108 Ga0105239_10232202 3300010375 Bacteria 2070
109 Ga0105239_10626502 3300010375 Bacteria 1228
110 Ga0157374_10188499 3300013296 Bacteria 2017
111 Ga0157378_10275325 3300013297 Bacteria 1620
112 Ga0163162_10004512 3300013306 Bacteria 13407
113 Ga0163162_10322129 3300013306 Bacteria 1678
114 Ga0157372_10171272 3300013307 Bacteria 2512
115 Ga0157375_10043872 3300013308 Unclassified 4339
116 Ga0163163_10044768 3300014325 Bacteria 4342
117 Ga0163163_10064945 3300014325 Bacteria 3622
118 Ga0157379_10048093 3300014968 Unclassified 3808
119 Ga0157379_10160845 3300014968 Bacteria 2027
120 Ga0157379_10359548 3300014968 Bacteria 1334
121 Ga0157376_10103874 3300014969 Bacteria 2489
122 Ga0157376_10275574 3300014969 Bacteria 1582
123 Ga0157376_10448091 3300014969 Unclassified 1258
124 Ga0209565_1001360 3300025263 Bacteria 11032
125 Ga0209673_1001526 3300025273 Bacteria 21165
126 Ga0209675_1010493 3300025291 Bacteria 3158
127 Ga0209564_1001610 3300025295 Bacteria 21907
128 Ga0209758_1001228 3300025297 Bacteria 32082
129 Ga0209758_1005595 3300025297 Bacteria 9559
130 Ga0209256_1006116 3300025299 Bacteria 6532
131 Ga0209256_1011344 3300025299 Bacteria 3576
132 Ga0209257_1000187 3300025304 Bacteria 154077
133 Ga0207697_10001144 3300025315 Bacteria 14593
134 Ga0207682_10116979 3300025893 Bacteria 1179
135 Ga0207710_10007687 3300025900 Bacteria 4558
136 Ga0207688_10003724 3300025901 Bacteria 8317
137 Ga0207680_10001329 3300025903 Bacteria 11670
138 Ga0207680_10130963 3300025903 Bacteria 1653
139 Ga0207645_10012900 3300025907 Bacteria 5656
140 Ga0207654_10153768 3300025911 Bacteria 1479
141 Ga0207695_10029865 3300025913 Bacteria 6014
142 Ga0207671_10092781 3300025914 Bacteria 2277
143 Ga0207662_10099155 3300025918 Bacteria 1803
144 Ga0207649_10006363 3300025920 Bacteria 6416
145 Ga0207649_10228174 3300025920 Bacteria 1330
146 Ga0207694_10088560 3300025924 Bacteria 2440
147 Ga0207650_10011660 3300025925 Bacteria 6056
148 Ga0207650_10048101 3300025925 Bacteria 3144
149 Ga0207659_10277915 3300025926 Bacteria 1368
150 Ga0207644_10167959 3300025931 Bacteria 1710
151 Ga0207644_10170901 3300025931 Unclassified 1697
152 Ga0207644_10267294 3300025931 Unclassified 1369
153 Ga0207706_10132581 3300025933 Bacteria 2192
154 Ga0207706_10306158 3300025933 Bacteria 1384
155 Ga0207709_10169316 3300025935 Bacteria 1531
156 Ga0207669_10005566 3300025937 Bacteria 5668
157 Ga0207704_10340398 3300025938 Bacteria 1164
158 Ga0207691_10003569 3300025940 Bacteria 15136
159 Ga0207691_10034193 3300025940 Bacteria 4728
160 Ga0207691_10124241 3300025940 Bacteria 2284
161 Ga0207691_10142298 3300025940 Bacteria 2113
162 Ga0207711_10003599 3300025941 Bacteria 13401
163 Ga0207711_10061661 3300025941 Bacteria 3234
164 Ga0207711_10144764 3300025941 Bacteria 2140
165 Ga0207661_10149019 3300025944 Unclassified 2021
166 Ga0207679_10051113 3300025945 Unclassified 3024
167 Ga0207679_10510831 3300025945 Bacteria 1073
168 Ga0207667_10439643 3300025949 Bacteria 1326
169 Ga0207651_10039789 3300025960 Bacteria 3103
170 Ga0207651_10126782 3300025960 Bacteria 1946
171 Ga0207712_10127863 3300025961 Bacteria 1932
172 Ga0207712_10156602 3300025961 Bacteria 1765
173 Ga0207712_10246739 3300025961 Bacteria 1441
174 Ga0207668_10101935 3300025972 Bacteria 2135
175 Ga0207640_10286985 3300025981 Bacteria 1296
176 Ga0207658_10012232 3300025986 Bacteria 5858
177 Ga0207658_10041832 3300025986 Bacteria 3320
178 Ga0207677_10016528 3300026023 Unclassified 4374
179 Ga0207677_10071255 3300026023 Bacteria 2452
180 Ga0207703_10000512 3300026035 Bacteria 40214
181 Ga0207703_10101524 3300026035 Bacteria 2439
182 Ga0207703_10217834 3300026035 Bacteria 1705
183 Ga0207678_10059746 3300026067 Bacteria 3280
184 Ga0207708_10029594 3300026075 Bacteria 4151
185 Ga0207641_10000218 3300026088 Bacteria 74549
186 Ga0207641_10025508 3300026088 Bacteria 4875
187 Ga0207648_10078054 3300026089 Bacteria 2888
188 Ga0207648_10193500 3300026089 Bacteria 1803
189 Ga0207676_10004360 3300026095 Bacteria 10007
190 Ga0207676_10362858 3300026095 Bacteria 1343
191 Ga0207675_100015996 3300026118 Bacteria 7003
192 Ga0207675_100139808 3300026118 Bacteria 2300
193 Ga0207683_10074504 3300026121 Bacteria 3003
194 Ga0207683_10127881 3300026121 Bacteria 2284
195 Ga0207683_10223796 3300026121 Unclassified 1715
196 Ga0207683_10461750 3300026121 Unclassified 1171
197 Ga0207698_10016118 3300026142 Bacteria 5028
198 Ga0268264_10001535 3300028381 Bacteria 21497
199 Ga0307515_10202338 3300028794 Bacteria 1857
200 Ga0307509_10000167 3300031507 Bacteria 103177
201 Ga0307516_10001307 3300031730 Bacteria 34603
202 Ga0307413_10014955 3300031824 Bacteria 3962
203 Ga0307410_10187180 3300031852 Bacteria 1572
204 Ga0307410_10299796 3300031852 Unclassified 1268
205 Ga0307407_10059266 3300031903 Bacteria 2229
206 Ga0307412_10176118 3300031911 Unclassified 1604
207 Ga0307414_10654190 3300032004 Bacteria 947
208 Ga0307411_10037033 3300032005 Bacteria 3063
209 Ga0307411_10140678 3300032005 Bacteria 1779
210 Ga0373935_0040034 3300035692 Unclassified 2940
211 Ga0373937_0075923 3300036401 Bacteria 3103
212 Ga0395898_0037704 3300037466 Bacteria 4793
213 Ga0395898_0408106 3300037466 Bacteria 1295
214 Ga0395898_0730356 3300037466 Bacteria 932
215 Ga0395901_0017856 3300038443 Bacteria 7241
216 Ga0395901_0053822 3300038443 Bacteria 4182
217 Ga0436360_0046396 3300039438 Bacteria 954
218 Ga0439439_0024446 3300041406 Unclassified 1517
219 Ga0439457_016377 3300042014 Bacteria 1653
220 Ga0439446_0045091 3300042156 Bacteria 1306
221 Ga0439459_0002290 3300042438 Bacteria 2936
222 Ga0453684_0076759 3300044712 Bacteria 4193
223 Ga0495627_003877 3300046453 Bacteria 6412
224 Ga0495592_0099742 3300046454 Unclassified 2071
225 Ga0495590_0003910 3300046457 Bacteria 6056
226 Ga0495638_0000845 3300046460 Bacteria 32033
227 Ga0495638_0002069 3300046460 Bacteria 17041
228 Ga0495638_0004706 3300046460 Bacteria 10308
229 Ga0495638_0105178 3300046460 Bacteria 1682
230 Ga0495650_0000030 3300046471 Bacteria 436318
231 Ga0495664_0068284 3300046477 Bacteria 2121
232 Ga0495583_0000002 3300046506 Bacteria 782521
233 Ga0495606_0022759 3300046507 Bacteria 4554
234 Ga0495610_0000091 3300046512 Bacteria 105916
235 Ga0495610_0032966 3300046512 Bacteria 2683
236 Ga0495616_0000094 3300046513 Bacteria 75611
237 Ga0495616_0061567 3300046513 Bacteria 1840
238 Ga0495618_0253608 3300046514 Bacteria 1103
239 Ga0495620_0007802 3300046515 Bacteria 5782
240 Ga0495631_0016561 3300046518 Bacteria 3510
241 Ga0495632_0004585 3300046519 Bacteria 9360
242 Ga0495637_0043940 3300046520 Bacteria 1905
243 Ga0495637_0052740 3300046520 Bacteria 1696
244 Ga0495663_0034779 3300046525 Bacteria 1511
245 Ga0495654_0000048 3300046530 Bacteria 147348
246 Ga0495586_0022147 3300046535 Bacteria 3391
247 Ga0495667_0018585 3300046559 Bacteria 4693
248 Ga0495668_0004125 3300046616 Bacteria 10515
249 Ga0495625_0000058 3300046660 Bacteria 180863
250 Ga0495625_0012736 3300046660 Bacteria 6801
251 Ga0495625_0018521 3300046660 Bacteria 5433
252 Ga0495625_0052215 3300046660 Bacteria 2927
253 Ga0495625_0092269 3300046660 Bacteria 2092
254 Ga0495657_0002170 3300046675 Bacteria 16643
255 Ga0495613_0077547 3300046689 Bacteria 2417
256 Ga0495613_0240529 3300046689 Bacteria 1266
257 Ga0495649_0070811 3300046694 Bacteria 1869
258 Ga0495589_0006511 3300046794 Bacteria 6160
259 Ga0495660_0007868 3300046810 Bacteria 6259
260 Ga0495581_0055716 3300047315 Bacteria 2282
261 Ga0495674_0008141 3300047319 Bacteria 10003
262 Ga0495674_0042244 3300047319 Bacteria 4068
263 Ga0495672_0000520 3300047320 Bacteria 44042
264 Ga0495679_009691 3300047446 Bacteria 3836
265 Ga0495673_0000209 3300047469 Bacteria 88818
266 Ga0495673_0001399 3300047469 Bacteria 19397
267 Ga0495681_0117984 3300047470 Bacteria 1142
268 Ga0495684_0157192 3300047471 Unclassified 1698
269 Ga0495686_0001341 3300047472 Bacteria 27547
270 Ga0495686_0032511 3300047472 Bacteria 3376
271 Ga0495686_0251307 3300047472 Bacteria 993
272 Ga0496100_0108001 3300048903 Bacteria 1929
273 Ga0496101_0088458 3300048904 Bacteria 2301
274 Ga0496102_0157114 3300048905 Bacteria 2138
275 Ga0496103_0045704 3300048906 Bacteria 2702
276 Ga0496107_0000188 3300048910 Bacteria 32167
277 Ga0496109_0103009 3300048912 Bacteria 2649
278 Ga0496115_0003924 3300048918 Bacteria 10719
279 Ga0496118_0274690 3300048921 Unclassified 942
280 Ga0496121_0006716 3300048924 Bacteria 14131
281 Ga0496125_0005886 3300048928 Bacteria 13444
282 Ga0496125_0103051 3300048928 Bacteria 2095
283 Ga0496126_0019454 3300048929 Bacteria 6687
284 Ga0501034_0671751 3300049571 Bacteria 936
285 Ga0501070_0155019 3300049586 Bacteria 1889
286 nmdc:mga0k408_142478_c1 3300050493 Bacteria 1426
287 nmdc:mga05p37_107508_c1 3300050507 Bacteria 3432
288 nmdc:mga05p37_250085_c1 3300050507 Bacteria 2127
289 nmdc:mga05p37_285438_c1 3300050507 Bacteria 1967
290 nmdc:mga0qj67_34905_c1 3300050509 Bacteria 3931
291 nmdc:mga06r32_22825_c1 3300050510 Bacteria 5788
292 nmdc:mga0n895_57416_c1 3300050512 Bacteria 3836
293 nmdc:mga0rr50_101200_c1 3300050513 Bacteria 2265
294 Ga0495619_0102842 3300053085 Bacteria 1946
295 Ga0500578_0000059 3300053086 Bacteria 119108
296 Ga0500578_0095285 3300053086 Bacteria 1888
297 Ga0500644_0011507 3300053088 Bacteria 2419
298 Ga0500554_000965 3300053102 Bacteria 5595
299 Ga0500556_0014169 3300053104 Bacteria 2429
300 Ga0500562_039351 3300053108 Bacteria 1256
301 Ga0500614_016051 3300053123 Bacteria 1676
302 Ga0500618_000064 3300053125 Bacteria 91120
303 Ga0500658_0003729 3300053134 Bacteria 5739
304 Ga0500559_0017203 3300053136 Bacteria 3052
305 Ga0500559_0018259 3300053136 Bacteria 2964
306 Ga0500561_0001924 3300053137 Bacteria 3433
307 Ga0500564_000005 3300053138 Bacteria 99735
308 Ga0500577_0016281 3300053142 Bacteria 2341
309 Ga0500616_0009279 3300053153 Bacteria 5996
310 Ga0500622_0007091 3300053156 Bacteria 6408
311 Ga0500622_0031779 3300053156 Bacteria 2770
312 Ga0500633_0098811 3300053160 Bacteria 1073
313 Ga0500645_015426 3300053730 Bacteria 2420
314 Ga0500609_000637 3300053731 Bacteria 5345
315 Ga0500661_011102 3300055283 Bacteria 1633
316 2511124287 2510917020 Bacteria 5657507
317 2585151416 2582581280 Bacteria 5994497
318 2585196129 2582581293 Bacteria 5907401
319 2643749513 2643221545 Bacteria 5083237
320 2643782700 2643221552 Bacteria 5708754
321 2643926474 2643221583 Bacteria 5218014
322 2643928913 2643221584 Bacteria 5511711
323 2644508469 2643221691 Bacteria 5093099
324 2792458957 2791355048 Bacteria 5832535
325 2819536998 2818991435 Bacteria 5433759
326 2819645410 2818991454 Bacteria 5563326
327 2843749116 2843744320 Bacteria 5659202
328 2849564424 2849560528 Bacteria 5393480
329 2849575295 2849573788 Bacteria 5421256
330 2851155550 2851153111 Bacteria 5542585
331 2898330848 2898329390 Bacteria 5168154
332 Ga0495632_0147157
333 JGI25153J46596_10063460
334 rootH2_10131718
335 rootL2_10019980
336 rootL2_10193206
337 Ga0055524_1004294
338 Ga0055528_1010630
339 Ga0055531_10005430
340 Ga0065165_1001315
341 Ga0065712_10076559
342 Ga0070683_100177609
343 Ga0070690_100000802
344 Ga0070670_100005126
345 Ga0070670_100054371
346 Ga0068869_100225273
347 Ga0070666_10001967
348 Ga0070666_10049471
349 Ga0070682_100310782
350 Ga0068868_100002550
351 Ga0068868_100034764
352 Ga0068868_100163855
353 Ga0070660_100186151
354 Ga0070691_10034387
355 Ga0070687_100086122
356 Ga0070661_100010584
357 Ga0070671_100048812
358 Ga0070671_100150536
359 Ga0070671_100283816
360 Ga0070671_100504077
361 Ga0070674_100010503
362 Ga0070674_100174002
363 Ga0070673_100022944
364 Ga0070673_100024178
365 Ga0070667_100032287
366 Ga0070667_100082597
367 Ga0070667_100192369
368 Ga0070701_10052885
369 Ga0070705_100041007
370 Ga0070700_100019316
371 Ga0070678_100210031
372 Ga0070678_100292328
373 Ga0070662_100135581
374 Ga0068867_100010080
375 Ga0070685_10206118
376 Ga0070685_10399163
377 Ga0070684_100186180
378 Ga0068853_100283044
379 Ga0070672_100004880
380 Ga0070672_100112450
381 Ga0070686_100027062
382 Ga0070686_100110555
383 Ga0070696_100296062
384 Ga0070704_100096563
385 Ga0070664_100000804
386 Ga0070664_100089403
387 Ga0070664_100582628
388 Ga0068854_100179850
389 Ga0068856_100072221
390 Ga0068859_100218494
391 Ga0068859_100318423
392 Ga0068859_100414023
393 Ga0068864_100001034
394 Ga0068864_100150245
395 Ga0068864_100381036
396 Ga0068863_100015113
397 Ga0068863_100051656
398 Ga0068863_100176497
399 Ga0068858_100011493
400 Ga0068858_100035125
401 Ga0068858_100293962
402 Ga0068860_100003650
403 Ga0068860_100144446
404 Ga0068862_100645162
405 Ga0075369_10005238
406 Ga0097621_100009239
407 Ga0097621_100036971
408 Ga0097621_100265146
409 Ga0075370_10152707
410 Ga0068871_100029560
411 Ga0075428_100024607
412 Ga0075429_100245923
413 Ga0068865_100146848
414 Ga0097620_100218515
415 Ga0097620_100318431
416 Ga0097620_100414000
417 Ga0075435_100001593
418 Ga0105240_10034139
419 Ga0105240_10556067
420 Ga0111539_10685916
421 Ga0105247_10014549
422 Ga0114129_10005298
423 Ga0114129_10011563
424 Ga0114129_10021331
425 Ga0105243_10093117
426 Ga0105243_10119948
427 Ga0105241_10043878
428 Ga0105242_10212447
429 Ga0105242_10845144
430 Ga0105248_10017755
431 Ga0105248_10471639
432 Ga0105248_10660369
433 Ga0105237_10184418
434 Ga0105238_10117600
435 Ga0105238_10272509
436 Ga0105249_10137203
437 Ga0105249_10231070
438 Ga0105249_10262151
439 Ga0105239_10232202
440 Ga0105239_10626502
441 Ga0157374_10188499
442 Ga0157378_10275325
443 Ga0163162_10004512
444 Ga0163162_10322129
445 Ga0157372_10171272
446 Ga0157375_10043872
447 Ga0163163_10044768
448 Ga0163163_10064945
449 Ga0157379_10048093
450 Ga0157379_10160845
451 Ga0157379_10359548
452 Ga0157376_10103874
453 Ga0157376_10275574
454 Ga0157376_10448091
455 Ga0209565_1001360
456 Ga0209673_1001526
457 Ga0209675_1010493
458 Ga0209564_1001610
459 Ga0209758_1001228
460 Ga0209758_1005595
461 Ga0209256_1006116
462 Ga0209256_1011344
463 Ga0209257_1000187
464 Ga0207697_10001144
465 Ga0207682_10116979
466 Ga0207710_10007687
467 Ga0207688_10003724
468 Ga0207680_10001329
469 Ga0207680_10130963
470 Ga0207645_10012900
471 Ga0207654_10153768
472 Ga0207695_10029865
473 Ga0207671_10092781
474 Ga0207662_10099155
475 Ga0207649_10006363
476 Ga0207649_10228174
477 Ga0207694_10088560
478 Ga0207650_10011660
479 Ga0207650_10048101
480 Ga0207659_10277915
481 Ga0207644_10167959
482 Ga0207644_10170901
483 Ga0207644_10267294
484 Ga0207706_10132581
485 Ga0207706_10306158
486 Ga0207709_10169316
487 Ga0207669_10005566
488 Ga0207704_10340398
489 Ga0207691_10003569
490 Ga0207691_10034193
491 Ga0207691_10124241
492 Ga0207691_10142298
493 Ga0207711_10003599
494 Ga0207711_10061661
495 Ga0207711_10144764
496 Ga0207661_10149019
497 Ga0207679_10051113
498 Ga0207679_10510831
499 Ga0207667_10439643
500 Ga0207651_10039789
501 Ga0207651_10126782
502 Ga0207712_10127863
503 Ga0207712_10156602
504 Ga0207712_10246739
505 Ga0207668_10101935
506 Ga0207640_10286985
507 Ga0207658_10012232
508 Ga0207658_10041832
509 Ga0207677_10016528
510 Ga0207677_10071255
511 Ga0207703_10000512
512 Ga0207703_10101524
513 Ga0207703_10217834
514 Ga0207678_10059746
515 Ga0207708_10029594
516 Ga0207641_10000218
517 Ga0207641_10025508
518 Ga0207648_10078054
519 Ga0207648_10193500
520 Ga0207676_10004360
521 Ga0207676_10362858
522 Ga0207675_100015996
523 Ga0207675_100139808
524 Ga0207683_10074504
525 Ga0207683_10127881
526 Ga0207683_10223796
527 Ga0207683_10461750
528 Ga0207698_10016118
529 Ga0268264_10001535
530 Ga0307515_10202338
531 Ga0307509_10000167
532 Ga0307516_10001307
533 Ga0307413_10014955
534 Ga0307410_10187180
535 Ga0307410_10299796
536 Ga0307407_10059266
537 Ga0307412_10176118
538 Ga0307414_10654190
539 Ga0307411_10037033
540 Ga0307411_10140678
541 Ga0373935_0040034
542 Ga0373937_0075923
543 Ga0395898_0037704
544 Ga0395898_0408106
545 Ga0395898_0730356
546 Ga0395901_0017856
547 Ga0395901_0053822
548 Ga0436360_0046396
549 Ga0439439_0024446
550 Ga0439457_016377
551 Ga0439446_0045091
552 Ga0439459_0002290
553 Ga0453684_0076759
554 Ga0495627_003877
555 Ga0495592_0099742
556 Ga0495590_0003910
557 Ga0495638_0000845
558 Ga0495638_0002069
559 Ga0495638_0004706
560 Ga0495638_0105178
561 Ga0495650_0000030
562 Ga0495664_0068284
563 Ga0495583_0000002
564 Ga0495606_0022759
565 Ga0495610_0000091
566 Ga0495610_0032966
567 Ga0495616_0000094
568 Ga0495616_0061567
569 Ga0495618_0253608
570 Ga0495620_0007802
571 Ga0495631_0016561
572 Ga0495632_0004585
573 Ga0495637_0043940
574 Ga0495637_0052740
575 Ga0495663_0034779
576 Ga0495654_0000048
577 Ga0495586_0022147
578 Ga0495667_0018585
579 Ga0495668_0004125
580 Ga0495625_0000058
581 Ga0495625_0012736
582 Ga0495625_0018521
583 Ga0495625_0052215
584 Ga0495625_0092269
585 Ga0495657_0002170
586 Ga0495613_0077547
587 Ga0495613_0240529
588 Ga0495649_0070811
589 Ga0495589_0006511
590 Ga0495660_0007868
591 Ga0495581_0055716
592 Ga0495674_0008141
593 Ga0495674_0042244
594 Ga0495672_0000520
595 Ga0495679_009691
596 Ga0495673_0000209
597 Ga0495673_0001399
598 Ga0495681_0117984
599 Ga0495684_0157192
600 Ga0495686_0001341
601 Ga0495686_0032511
602 Ga0495686_0251307
603 Ga0496100_0108001
604 Ga0496101_0088458
605 Ga0496102_0157114
606 Ga0496103_0045704
607 Ga0496107_0000188
608 Ga0496109_0103009
609 Ga0496115_0003924
610 Ga0496118_0274690
611 Ga0496121_0006716
612 Ga0496125_0005886
613 Ga0496125_0103051
614 Ga0496126_0019454
615 Ga0501034_0671751
616 Ga0501070_0155019
617 nmdc:mga0k408_142478_c1
618 nmdc:mga05p37_107508_c1
619 nmdc:mga05p37_250085_c1
620 nmdc:mga05p37_285438_c1
621 nmdc:mga0qj67_34905_c1
622 nmdc:mga06r32_22825_c1
623 nmdc:mga0n895_57416_c1
624 nmdc:mga0rr50_101200_c1
625 Ga0495619_0102842
626 Ga0500578_0000059
627 Ga0500578_0095285
628 Ga0500644_0011507
629 Ga0500554_000965
630 Ga0500556_0014169
631 Ga0500562_039351
632 Ga0500614_016051
633 Ga0500618_000064
634 Ga0500658_0003729
635 Ga0500559_0017203
636 Ga0500559_0018259
637 Ga0500561_0001924
638 Ga0500564_000005
639 Ga0500577_0016281
640 Ga0500616_0009279
641 Ga0500622_0007091
642 Ga0500622_0031779
643 Ga0500633_0098811
644 Ga0500645_015426
645 Ga0500609_000637
646 Ga0500661_011102
647 2511124287
648 2585151416
649 2585196129
650 2643749513
651 2643782700
652 2643926474
653 2643928913
654 2644508469
655 2792458957
656 2819536998
657 2819645410
658 2843749116
659 2849564424
660 2849575295
661 2851155550
662 2898330848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05096

Glu_cyclase_2

Glutamine cyclotransferase

42

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9559 31 262
2faw-assembly2.cif.gz_B crystal structure of papaya glutaminyl cyclase 0.9557 34 263
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9509 32 263
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9441 31 262
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9314 32 263
ID Description Score Start End Superfamily
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9323 22 257 2.130.10.10
af_A0A144A3U7_117_356_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9026 60 255 2.130.10.10
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8964 22 257 2.130.10.10
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.822 56 129 2.40.10.480
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.812 56 129 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A7V8WCJ8-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9917 115 257 GO:0016603
AF-A0A2R7S5M6-F1-model_v4 deleted 0.9912 44 263
AF-A0A800CAM8-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9906 26 261 GO:0016603
AF-X0USV9-F1-model_v4 Glutamine cyclotransferase 0.9906 110 260 GO:0016603
AF-A0A2V8PDA6-F1-model_v4 Glutamine cyclotransferase 0.9904 30 262 GO:0016603

Map