F410603

General Info

Members Datasets Scaffolds Average Seq Length
331 169 661 230

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_1546514|Ga0451807_1546514_577_1353
Length 258
Sequence LTAATLAKQLISKKVSSSYGNLGTGKKPMDISRYKNHQKILVAVDCIIFGFDGSQLKALLIKRGFEPHKGKWSLMGGFIEKNESADQAALRVLYELTGMRNIYMEQLYAFTDVDRDTAGRVVSIAYFALINIADYSSQQLQVQYEAKWFPLSKVPSLIFDHNLMVAKAKEFLRHKVASHPIGFELLPNKFTLPQLQNLYEAIYETPLDKRNFAKKVLSLGILNRLNEKEKESSRKGAFYYVFDNDKYVKLQSNSVKFI

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
151 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
152 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
153 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
154 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
164 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
168 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
169 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 0
Rhizoplane 0.6
Rhizosphere 79.76
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_1546514 3300041486 Bacteria 1749
2 rootH1_10003484 3300003316 Bacteria 3193
3 rootH1_10003484 3300003323 Bacteria 16671
4 rootH1_10046890 3300003316 Bacteria 24549
5 rootH1_10061189 3300003316 Bacteria 2019
6 rootH1_10158392 3300003316 Bacteria 3183
7 rootH2_10002269 3300003320 Bacteria 20277
8 rootH2_10004828 3300003320 Bacteria 9895
9 rootH2_10015738 3300003320 Bacteria 9503
10 rootH2_10078081 3300003320 Bacteria 1078
11 rootH2_10220940 3300003320 Bacteria 1973
12 rootH2_10238732 3300003320 Bacteria 1667
13 rootL2_10003790 3300003322 Bacteria 7186
14 rootL2_10023351 3300003322 Bacteria 11769
15 rootL2_10037183 3300003322 Bacteria 15793
16 rootL2_10064585 3300003322 Bacteria 3535
17 rootL2_10086641 3300003322 Bacteria 3632
18 rootL2_10104542 3300003322 Bacteria 2595
19 rootL2_10169243 3300003322 Bacteria 4094
20 rootL2_10194771 3300003322 Bacteria 1221
21 rootL2_10263136 3300003322 Unclassified 2403
22 rootH1_10002424 3300003323 Bacteria 50256
23 rootH1_10014911 3300003323 Bacteria 25576
24 rootH1_10017110 3300003323 Bacteria 4871
25 rootH1_10052989 3300003323 Bacteria 13634
26 rootH1_10061100 3300003323 Bacteria 3385
27 rootH1_10099796 3300003323 Bacteria 1957
28 rootH1_10101669 3300003323 Bacteria 4931
29 Ga0065165_1001113 3300005262 Bacteria 31809
30 Ga0065712_10278982 3300005290 Bacteria 900
31 Ga0070658_10110854 3300005327 Unclassified 2273
32 Ga0070658_10278935 3300005327 Bacteria 1422
33 Ga0070670_100005836 3300005331 Bacteria 10408
34 Ga0070670_100148333 3300005331 Bacteria 2030
35 Ga0070670_100268490 3300005331 Bacteria 1488
36 Ga0070670_100827413 3300005331 Bacteria 837
37 Ga0068869_100024554 3300005334 Bacteria 4175
38 Ga0070666_10000042 3300005335 Bacteria 112296
39 Ga0070680_100085574 3300005336 Bacteria 2605
40 Ga0070682_100010734 3300005337 Bacteria 5209
41 Ga0070682_100053320 3300005337 Bacteria 2534
42 Ga0068868_100007148 3300005338 Bacteria 7934
43 Ga0068868_100722005 3300005338 Bacteria 893
44 Ga0070660_100049729 3300005339 Bacteria 3224
45 Ga0070668_100349233 3300005347 Bacteria 1251
46 Ga0070668_100909421 3300005347 Bacteria 787
47 Ga0070671_100131816 3300005355 Bacteria 2105
48 Ga0070667_100015107 3300005367 Bacteria 6378
49 Ga0070667_100088523 3300005367 Bacteria 2658
50 Ga0070667_100096917 3300005367 Unclassified 2544
51 Ga0070678_100125254 3300005456 Bacteria 2033
52 Ga0070678_100260046 3300005456 Unclassified 1459
53 Ga0070678_100643039 3300005456 Bacteria 951
54 Ga0070681_10072584 3300005458 Bacteria 3404
55 Ga0068867_100612915 3300005459 Bacteria 951
56 Ga0068867_100708340 3300005459 Bacteria 889
57 Ga0070685_10481485 3300005466 Bacteria 875
58 Ga0070698_100372741 3300005471 Bacteria 1360
59 Ga0070679_100000978 3300005530 Bacteria 24898
60 Ga0070679_100069607 3300005530 Bacteria 3509
61 Ga0070684_100645720 3300005535 Bacteria 985
62 Ga0068853_100105030 3300005539 Bacteria 2502
63 Ga0068853_100224972 3300005539 Bacteria 1715
64 Ga0070665_100223102 3300005548 Unclassified 1885
65 Ga0070665_100296286 3300005548 Bacteria 1620
66 Ga0068855_100036746 3300005563 Bacteria 5827
67 Ga0068855_100262988 3300005563 Bacteria 1921
68 Ga0068855_100280364 3300005563 Bacteria 1851
69 Ga0068855_100298827 3300005563 Bacteria 1783
70 Ga0068857_100248216 3300005577 Bacteria 1631
71 Ga0068857_100721327 3300005577 Unclassified 948
72 Ga0068854_100045577 3300005578 Bacteria 3119
73 Ga0068854_100189113 3300005578 Bacteria 1612
74 Ga0068854_100863677 3300005578 Bacteria 793
75 Ga0068856_100135867 3300005614 Bacteria 2464
76 Ga0068852_100002932 3300005616 Bacteria 11850
77 Ga0068852_100190581 3300005616 Bacteria 1934
78 Ga0068852_100505138 3300005616 Bacteria 1204
79 Ga0068859_100000130 3300005617 Bacteria 71018
80 Ga0068859_100017440 3300005617 Bacteria 7216
81 Ga0068859_100239575 3300005617 Bacteria 1903
82 Ga0068864_100017753 3300005618 Bacteria 5935
83 Ga0068864_100072037 3300005618 Bacteria 3011
84 Ga0068866_10245657 3300005718 Bacteria 1092
85 Ga0068866_10338730 3300005718 Bacteria 952
86 Ga0068861_100362939 3300005719 Bacteria 1274
87 Ga0068851_10076958 3300005834 Bacteria 1736
88 Ga0068863_100017915 3300005841 Bacteria 6778
89 Ga0068863_100120270 3300005841 Bacteria 2504
90 Ga0068858_100009083 3300005842 Bacteria 9507
91 Ga0068860_100001384 3300005843 Bacteria 26311
92 Ga0068860_100012309 3300005843 Bacteria 8428
93 Ga0068860_100216738 3300005843 Bacteria 1858
94 Ga0068862_100162342 3300005844 Unclassified 1995
95 Ga0075366_10138991 3300006195 Unclassified 1468
96 Ga0097621_100014084 3300006237 Bacteria 5977
97 Ga0097621_100139438 3300006237 Unclassified 2071
98 Ga0097621_100446854 3300006237 Unclassified 1164
99 Ga0075370_10446134 3300006353 Unclassified 778
100 Ga0068871_100108341 3300006358 Bacteria 2334
101 Ga0075428_100024940 3300006844 Bacteria 6615
102 Ga0075428_100171372 3300006844 Bacteria 2352
103 Ga0068865_100167725 3300006881 Bacteria 1680
104 Ga0097620_100000130 3300006931 Bacteria 71018
105 Ga0097620_100017440 3300006931 Bacteria 7216
106 Ga0097620_100239575 3300006931 Bacteria 1903
107 Ga0111539_10004335 3300009094 Bacteria 18566
108 Ga0111539_10011682 3300009094 Bacteria 11017
109 Ga0111539_10027052 3300009094 Bacteria 7005
110 Ga0111539_10158941 3300009094 Bacteria 2644
111 Ga0105247_10048105 3300009101 Bacteria 2619
112 Ga0105243_10885820 3300009148 Bacteria 887
113 Ga0105241_10002423 3300009174 Bacteria 13992
114 Ga0105241_10273824 3300009174 Bacteria 1439
115 Ga0105241_10288319 3300009174 Bacteria 1404
116 Ga0105242_10033483 3300009176 Bacteria 4114
117 Ga0105242_10141267 3300009176 Bacteria 2089
118 Ga0105237_10020674 3300009545 Bacteria 6778
119 Ga0105237_10167397 3300009545 Bacteria 2197
120 Ga0105237_10327433 3300009545 Bacteria 1536
121 Ga0105249_10001899 3300009553 Bacteria 18077
122 Ga0105249_10254257 3300009553 Unclassified 1743
123 Ga0105239_10037555 3300010375 Bacteria 5307
124 Ga0105239_10223124 3300010375 Bacteria 2114
125 Ga0105239_10230853 3300010375 Bacteria 2076
126 Ga0105239_10421948 3300010375 Bacteria 1511
127 Ga0105246_10039791 3300011119 Bacteria 3170
128 Ga0105246_10196036 3300011119 Bacteria 1567
129 Ga0105246_10857999 3300011119 Bacteria 811
130 Ga0157373_10003848 3300013100 Bacteria 11349
131 Ga0157373_10049135 3300013100 Bacteria 3006
132 Ga0157373_10112501 3300013100 Unclassified 1914
133 Ga0157371_10003411 3300013102 Bacteria 14433
134 Ga0157371_10023117 3300013102 Bacteria 4547
135 Ga0157371_10031232 3300013102 Unclassified 3838
136 Ga0157371_10061919 3300013102 Bacteria 2653
137 Ga0157370_10034527 3300013104 Bacteria 4922
138 Ga0157370_10156447 3300013104 Bacteria 2120
139 Ga0157369_10039592 3300013105 Bacteria 5151
140 Ga0157369_10130806 3300013105 Unclassified 2660
141 Ga0157369_10139515 3300013105 Bacteria 2566
142 Ga0157369_10679384 3300013105 Bacteria 1061
143 Ga0157374_10072220 3300013296 Bacteria 3255
144 Ga0157374_10158944 3300013296 Bacteria 2201
145 Ga0157374_10297887 3300013296 Bacteria 1595
146 Ga0157374_10586422 3300013296 Bacteria 1124
147 Ga0157378_10006356 3300013297 Bacteria 10339
148 Ga0157378_10074478 3300013297 Bacteria 3055
149 Ga0157378_10169022 3300013297 Bacteria 2049
150 Ga0157378_10273901 3300013297 Bacteria 1624
151 Ga0163162_10000445 3300013306 Bacteria 38232
152 Ga0163162_10011722 3300013306 Bacteria 8550
153 Ga0163162_10087762 3300013306 Bacteria 3190
154 Ga0163162_10446144 3300013306 Bacteria 1426
155 Ga0163162_11312943 3300013306 Bacteria 822
156 Ga0157372_10015806 3300013307 Bacteria 8097
157 Ga0157372_10019520 3300013307 Bacteria 7307
158 Ga0157372_10188066 3300013307 Unclassified 2391
159 Ga0157372_11023170 3300013307 Bacteria 956
160 Ga0157375_10269699 3300013308 Bacteria 1864
161 Ga0163163_10132325 3300014325 Bacteria 2534
162 Ga0163163_10200258 3300014325 Bacteria 2045
163 Ga0163163_10277622 3300014325 Bacteria 1727
164 Ga0163163_10759777 3300014325 Unclassified 1033
165 Ga0157380_10014598 3300014326 Bacteria 5750
166 Ga0157380_10074046 3300014326 Bacteria 2763
167 Ga0157380_10141193 3300014326 Bacteria 2070
168 Ga0157380_10330762 3300014326 Bacteria 1417
169 Ga0157380_10749247 3300014326 Bacteria 988
170 Ga0157379_10004592 3300014968 Bacteria 11847
171 Ga0157379_10300195 3300014968 Bacteria 1463
172 Ga0157376_10004244 3300014969 Bacteria 9951
173 Ga0157376_10044870 3300014969 Bacteria 3636
174 Ga0157376_10080236 3300014969 Bacteria 2798
175 Ga0157376_10134748 3300014969 Bacteria 2209
176 Ga0182006_1034608 3300015261 Bacteria 2019
177 Ga0163161_10289437 3300017792 Bacteria 1287
178 Ga0209050_1003533 3300025298 Bacteria 11407
179 Ga0209050_1009444 3300025298 Bacteria 4990
180 Ga0209050_1013973 3300025298 Bacteria 3509
181 Ga0209050_1015219 3300025298 Bacteria 3249
182 Ga0209050_1020905 3300025298 Bacteria 2413
183 Ga0207656_10108785 3300025321 Bacteria 1279
184 Ga0207682_10064988 3300025893 Bacteria 1535
185 Ga0207680_10000620 3300025903 Bacteria 16727
186 Ga0207705_10032241 3300025909 Bacteria 3743
187 Ga0207705_10040102 3300025909 Bacteria 3357
188 Ga0207654_10001195 3300025911 Bacteria 13925
189 Ga0207707_10070379 3300025912 Bacteria 3048
190 Ga0207671_10007191 3300025914 Bacteria 9700
191 Ga0207671_10322040 3300025914 Unclassified 1223
192 Ga0207660_10010034 3300025917 Bacteria 6134
193 Ga0207657_10008466 3300025919 Bacteria 10433
194 Ga0207657_10205494 3300025919 Bacteria 1582
195 Ga0207652_10004371 3300025921 Bacteria 11514
196 Ga0207650_10097641 3300025925 Unclassified 2256
197 Ga0207650_10203923 3300025925 Bacteria 1585
198 Ga0207650_10383297 3300025925 Bacteria 1161
199 Ga0207644_10111723 3300025931 Bacteria 2067
200 Ga0207644_10277077 3300025931 Bacteria 1346
201 Ga0207690_10018339 3300025932 Bacteria 4291
202 Ga0207686_10077256 3300025934 Bacteria 2161
203 Ga0207704_10137790 3300025938 Bacteria 1702
204 Ga0207691_10245072 3300025940 Bacteria 1548
205 Ga0207691_10640625 3300025940 Unclassified 898
206 Ga0207689_10004095 3300025942 Bacteria 13256
207 Ga0207689_10007825 3300025942 Bacteria 9346
208 Ga0207689_10010298 3300025942 Bacteria 8052
209 Ga0207689_10076265 3300025942 Unclassified 2756
210 Ga0207667_10002067 3300025949 Bacteria 25161
211 Ga0207667_10109995 3300025949 Bacteria 2842
212 Ga0207667_10251540 3300025949 Bacteria 1808
213 Ga0207667_10584058 3300025949 Bacteria 1128
214 Ga0207712_10041006 3300025961 Bacteria 3180
215 Ga0207640_10186347 3300025981 Bacteria 1560
216 Ga0207658_10015467 3300025986 Bacteria 5235
217 Ga0207658_10119758 3300025986 Bacteria 2096
218 Ga0207677_10003485 3300026023 Bacteria 8335
219 Ga0207677_10482579 3300026023 Bacteria 1068
220 Ga0207703_10003239 3300026035 Bacteria 13684
221 Ga0207702_10155180 3300026078 Bacteria 2086
222 Ga0207702_10751054 3300026078 Bacteria 963
223 Ga0207641_10000158 3300026088 Bacteria 96378
224 Ga0207641_10012193 3300026088 Bacteria 7055
225 Ga0207648_10100762 3300026089 Bacteria 2531
226 Ga0207648_10500370 3300026089 Bacteria 1112
227 Ga0207676_10077630 3300026095 Bacteria 2687
228 Ga0207676_10089418 3300026095 Bacteria 2524
229 Ga0207676_11129489 3300026095 Bacteria 775
230 Ga0207674_10234617 3300026116 Bacteria 1782
231 Ga0207675_100532792 3300026118 Bacteria 1172
232 Ga0207683_10156165 3300026121 Bacteria 2061
233 Ga0207683_10178080 3300026121 Bacteria 1927
234 Ga0207683_10263412 3300026121 Bacteria 1574
235 Ga0207698_10004232 3300026142 Bacteria 8730
236 Ga0207698_10577591 3300026142 Bacteria 1105
237 Ga0207428_10022990 3300027907 Bacteria 5250
238 Ga0207428_10062932 3300027907 Bacteria 2932
239 Ga0207428_10273450 3300027907 Bacteria 1255
240 Ga0268266_10131462 3300028379 Unclassified 2239
241 Ga0268265_10088970 3300028380 Unclassified 2462
242 Ga0268265_10515270 3300028380 Bacteria 1129
243 Ga0268264_10005791 3300028381 Bacteria 10476
244 Ga0268264_10014904 3300028381 Bacteria 6385
245 Ga0268264_10017359 3300028381 Bacteria 5896
246 Ga0265322_10022536 3300028654 Unclassified 1802
247 Ga0307515_10000246 3300028794 Bacteria 134348
248 Ga0265338_10062738 3300028800 Unclassified 3246
249 Ga0265324_10027056 3300029957 Bacteria 2028
250 Ga0307513_10096711 3300031456 Bacteria 2990
251 Ga0307513_10464673 3300031456 Bacteria 988
252 Ga0307513_10560683 3300031456 Bacteria 854
253 Ga0307509_10100009 3300031507 Bacteria 2940
254 Ga0307509_10266191 3300031507 Bacteria 1485
255 Ga0307509_10530136 3300031507 Bacteria 858
256 Ga0307408_100087285 3300031548 Bacteria 2346
257 Ga0307508_10000439 3300031616 Bacteria 49671
258 Ga0265342_10165130 3300031712 Unclassified 1222
259 Ga0316578_10015441 3300031728 Bacteria 4106
260 Ga0316578_10250657 3300031728 Unclassified 1062
261 Ga0307516_10205969 3300031730 Bacteria 1684
262 Ga0307413_10264995 3300031824 Bacteria 1283
263 Ga0307518_10202406 3300031838 Unclassified 1317
264 Ga0307410_10131481 3300031852 Bacteria 1839
265 Ga0307416_100000510 3300032002 Bacteria 19836
266 Ga0307415_100009175 3300032126 Bacteria 5526
267 Ga0316585_10016024 3300032137 Bacteria 2253
268 Ga0316574_0114564 3300035398 Bacteria 1729
269 Ga0373927_0050774 3300035695 Bacteria 2682
270 Ga0373937_0142992 3300036401 Bacteria 2239
271 Ga0316582_0017561 3300036647 Bacteria 4143
272 Ga0316584_0029155 3300036712 Bacteria 4074
273 Ga0316584_0207470 3300036712 Bacteria 1443
274 Ga0395899_0039226 3300037312 Bacteria 3546
275 Ga0395900_0074547 3300037418 Bacteria 3488
276 Ga0395900_0339625 3300037418 Bacteria 1478
277 Ga0395898_0087146 3300037466 Bacteria 3008
278 Ga0395905_0027900 3300037471 Bacteria 5323
279 Ga0395901_0177019 3300038443 Bacteria 2237
280 Ga0400483_274426 3300039062 Bacteria 2088
281 Ga0451807_2225211 3300041486 Bacteria 877
282 Ga0451841_0721345 3300041498 Unclassified 939
283 Ga0439445_0069068 3300042004 Unclassified 975
284 Ga0450908_049227 3300042184 Bacteria 733
285 Ga0451577_0230183 3300042876 Bacteria 1676
286 Ga0453683_0354684 3300044673 Bacteria 942
287 Ga0453684_0004254 3300044712 Bacteria 30571
288 Ga0453684_0052828 3300044712 Bacteria 5309
289 Ga0453684_0059260 3300044712 Bacteria 4938
290 Ga0453684_0232432 3300044712 Bacteria 2128
291 Ga0451576_0021533 3300045051 Bacteria 7008
292 Ga0451576_0219369 3300045051 Bacteria 1986
293 Ga0451576_0648310 3300045051 Unclassified 1110
294 Ga0495592_0410898 3300046454 Bacteria 855
295 Ga0495638_0000006 3300046460 Bacteria 668846
296 Ga0495638_0000050 3300046460 Bacteria 206131
297 Ga0495638_0151865 3300046460 Bacteria 1343
298 Ga0495632_0055775 3300046519 Bacteria 1933
299 Ga0495674_0259792 3300047319 Bacteria 1427
300 Ga0495672_0006196 3300047320 Bacteria 9330
301 Ga0495672_0062569 3300047320 Bacteria 2140
302 Ga0495680_0365730 3300047322 Bacteria 1002
303 Ga0501290_019654 3300049513 Unclassified 918
304 Ga0501217_005449 3300049661 Bacteria 2662
305 Ga0501236_000491 3300049670 Bacteria 4470
306 Ga0501253_033662 3300049683 Bacteria 993
307 Ga0501259_001729 3300049688 Bacteria 3618
308 Ga0501225_0017443 3300049705 Bacteria 1992
309 Ga0501264_000874 3300049761 Bacteria 3866
310 nmdc:mga08y16_26566_c1 3300050511 Bacteria 6102
311 nmdc:mga08y16_43112_c1 3300050511 Bacteria 4727
312 nmdc:mga08y16_86779_c1 3300050511 Bacteria 3261
313 Ga0500644_0167691 3300053088 Bacteria 891
314 Ga0500646_0048639 3300053090 Bacteria 1216
315 Ga0500583_0000047 3300053092 Bacteria 78958
316 Ga0500583_0001380 3300053092 Bacteria 6953
317 Ga0500557_040101 3300053105 Bacteria 1465
318 Ga0500655_050408 3300053133 Bacteria 829
319 Ga0500588_0002022 3300053146 Bacteria 4028
320 Ga0500589_008614 3300053147 Bacteria 4267
321 Ga0500616_0000004 3300053153 Bacteria 1002714
322 Ga0500616_0000065 3300053153 Bacteria 239287
323 Ga0500616_0004481 3300053153 Bacteria 9925
324 Ga0500616_0030304 3300053153 Bacteria 2972
325 Ga0500616_0042073 3300053153 Bacteria 2448
326 Ga0500622_0000004 3300053156 Bacteria 557587
327 Ga0500622_0000005 3300053156 Bacteria 502443
328 Ga0500622_0002426 3300053156 Bacteria 13460
329 Ga0500611_111887 3300053727 Bacteria 718
330 Ga0500587_009734 3300053739 Bacteria 1225
331 2738726480 2738541278 Bacteria 9755573
332 Ga0451807_1546514
333 rootH1_10003484
334 rootH1_10046890
335 rootH1_10061189
336 rootH1_10158392
337 rootH2_10002269
338 rootH2_10004828
339 rootH2_10015738
340 rootH2_10078081
341 rootH2_10220940
342 rootH2_10238732
343 rootL2_10003790
344 rootL2_10023351
345 rootL2_10037183
346 rootL2_10064585
347 rootL2_10086641
348 rootL2_10104542
349 rootL2_10169243
350 rootL2_10194771
351 rootL2_10263136
352 rootH1_10002424
353 rootH1_10014911
354 rootH1_10017110
355 rootH1_10052989
356 rootH1_10061100
357 rootH1_10099796
358 rootH1_10101669
359 Ga0065165_1001113
360 Ga0065712_10278982
361 Ga0070658_10110854
362 Ga0070658_10278935
363 Ga0070670_100005836
364 Ga0070670_100148333
365 Ga0070670_100268490
366 Ga0070670_100827413
367 Ga0068869_100024554
368 Ga0070666_10000042
369 Ga0070680_100085574
370 Ga0070682_100010734
371 Ga0070682_100053320
372 Ga0068868_100007148
373 Ga0068868_100722005
374 Ga0070660_100049729
375 Ga0070668_100349233
376 Ga0070668_100909421
377 Ga0070671_100131816
378 Ga0070667_100015107
379 Ga0070667_100088523
380 Ga0070667_100096917
381 Ga0070678_100125254
382 Ga0070678_100260046
383 Ga0070678_100643039
384 Ga0070681_10072584
385 Ga0068867_100612915
386 Ga0068867_100708340
387 Ga0070685_10481485
388 Ga0070698_100372741
389 Ga0070679_100000978
390 Ga0070679_100069607
391 Ga0070684_100645720
392 Ga0068853_100105030
393 Ga0068853_100224972
394 Ga0070665_100223102
395 Ga0070665_100296286
396 Ga0068855_100036746
397 Ga0068855_100262988
398 Ga0068855_100280364
399 Ga0068855_100298827
400 Ga0068857_100248216
401 Ga0068857_100721327
402 Ga0068854_100045577
403 Ga0068854_100189113
404 Ga0068854_100863677
405 Ga0068856_100135867
406 Ga0068852_100002932
407 Ga0068852_100190581
408 Ga0068852_100505138
409 Ga0068859_100000130
410 Ga0068859_100017440
411 Ga0068859_100239575
412 Ga0068864_100017753
413 Ga0068864_100072037
414 Ga0068866_10245657
415 Ga0068866_10338730
416 Ga0068861_100362939
417 Ga0068851_10076958
418 Ga0068863_100017915
419 Ga0068863_100120270
420 Ga0068858_100009083
421 Ga0068860_100001384
422 Ga0068860_100012309
423 Ga0068860_100216738
424 Ga0068862_100162342
425 Ga0075366_10138991
426 Ga0097621_100014084
427 Ga0097621_100139438
428 Ga0097621_100446854
429 Ga0075370_10446134
430 Ga0068871_100108341
431 Ga0075428_100024940
432 Ga0075428_100171372
433 Ga0068865_100167725
434 Ga0097620_100000130
435 Ga0097620_100017440
436 Ga0097620_100239575
437 Ga0111539_10004335
438 Ga0111539_10011682
439 Ga0111539_10027052
440 Ga0111539_10158941
441 Ga0105247_10048105
442 Ga0105243_10885820
443 Ga0105241_10002423
444 Ga0105241_10273824
445 Ga0105241_10288319
446 Ga0105242_10033483
447 Ga0105242_10141267
448 Ga0105237_10020674
449 Ga0105237_10167397
450 Ga0105237_10327433
451 Ga0105249_10001899
452 Ga0105249_10254257
453 Ga0105239_10037555
454 Ga0105239_10223124
455 Ga0105239_10230853
456 Ga0105239_10421948
457 Ga0105246_10039791
458 Ga0105246_10196036
459 Ga0105246_10857999
460 Ga0157373_10003848
461 Ga0157373_10049135
462 Ga0157373_10112501
463 Ga0157371_10003411
464 Ga0157371_10023117
465 Ga0157371_10031232
466 Ga0157371_10061919
467 Ga0157370_10034527
468 Ga0157370_10156447
469 Ga0157369_10039592
470 Ga0157369_10130806
471 Ga0157369_10139515
472 Ga0157369_10679384
473 Ga0157374_10072220
474 Ga0157374_10158944
475 Ga0157374_10297887
476 Ga0157374_10586422
477 Ga0157378_10006356
478 Ga0157378_10074478
479 Ga0157378_10169022
480 Ga0157378_10273901
481 Ga0163162_10000445
482 Ga0163162_10011722
483 Ga0163162_10087762
484 Ga0163162_10446144
485 Ga0163162_11312943
486 Ga0157372_10015806
487 Ga0157372_10019520
488 Ga0157372_10188066
489 Ga0157372_11023170
490 Ga0157375_10269699
491 Ga0163163_10132325
492 Ga0163163_10200258
493 Ga0163163_10277622
494 Ga0163163_10759777
495 Ga0157380_10014598
496 Ga0157380_10074046
497 Ga0157380_10141193
498 Ga0157380_10330762
499 Ga0157380_10749247
500 Ga0157379_10004592
501 Ga0157379_10300195
502 Ga0157376_10004244
503 Ga0157376_10044870
504 Ga0157376_10080236
505 Ga0157376_10134748
506 Ga0182006_1034608
507 Ga0163161_10289437
508 Ga0209050_1003533
509 Ga0209050_1009444
510 Ga0209050_1013973
511 Ga0209050_1015219
512 Ga0209050_1020905
513 Ga0207656_10108785
514 Ga0207682_10064988
515 Ga0207680_10000620
516 Ga0207705_10032241
517 Ga0207705_10040102
518 Ga0207654_10001195
519 Ga0207707_10070379
520 Ga0207671_10007191
521 Ga0207671_10322040
522 Ga0207660_10010034
523 Ga0207657_10008466
524 Ga0207657_10205494
525 Ga0207652_10004371
526 Ga0207650_10097641
527 Ga0207650_10203923
528 Ga0207650_10383297
529 Ga0207644_10111723
530 Ga0207644_10277077
531 Ga0207690_10018339
532 Ga0207686_10077256
533 Ga0207704_10137790
534 Ga0207691_10245072
535 Ga0207691_10640625
536 Ga0207689_10004095
537 Ga0207689_10007825
538 Ga0207689_10010298
539 Ga0207689_10076265
540 Ga0207667_10002067
541 Ga0207667_10109995
542 Ga0207667_10251540
543 Ga0207667_10584058
544 Ga0207712_10041006
545 Ga0207640_10186347
546 Ga0207658_10015467
547 Ga0207658_10119758
548 Ga0207677_10003485
549 Ga0207677_10482579
550 Ga0207703_10003239
551 Ga0207702_10155180
552 Ga0207702_10751054
553 Ga0207641_10000158
554 Ga0207641_10012193
555 Ga0207648_10100762
556 Ga0207648_10500370
557 Ga0207676_10077630
558 Ga0207676_10089418
559 Ga0207676_11129489
560 Ga0207674_10234617
561 Ga0207675_100532792
562 Ga0207683_10156165
563 Ga0207683_10178080
564 Ga0207683_10263412
565 Ga0207698_10004232
566 Ga0207698_10577591
567 Ga0207428_10022990
568 Ga0207428_10062932
569 Ga0207428_10273450
570 Ga0268266_10131462
571 Ga0268265_10088970
572 Ga0268265_10515270
573 Ga0268264_10005791
574 Ga0268264_10014904
575 Ga0268264_10017359
576 Ga0265322_10022536
577 Ga0307515_10000246
578 Ga0265338_10062738
579 Ga0265324_10027056
580 Ga0307513_10096711
581 Ga0307513_10464673
582 Ga0307513_10560683
583 Ga0307509_10100009
584 Ga0307509_10266191
585 Ga0307509_10530136
586 Ga0307408_100087285
587 Ga0307508_10000439
588 Ga0265342_10165130
589 Ga0316578_10015441
590 Ga0316578_10250657
591 Ga0307516_10205969
592 Ga0307413_10264995
593 Ga0307518_10202406
594 Ga0307410_10131481
595 Ga0307416_100000510
596 Ga0307415_100009175
597 Ga0316585_10016024
598 Ga0316574_0114564
599 Ga0373927_0050774
600 Ga0373937_0142992
601 Ga0316582_0017561
602 Ga0316584_0029155
603 Ga0316584_0207470
604 Ga0395899_0039226
605 Ga0395900_0074547
606 Ga0395900_0339625
607 Ga0395898_0087146
608 Ga0395905_0027900
609 Ga0395901_0177019
610 Ga0400483_274426
611 Ga0451807_2225211
612 Ga0451841_0721345
613 Ga0439445_0069068
614 Ga0450908_049227
615 Ga0451577_0230183
616 Ga0453683_0354684
617 Ga0453684_0004254
618 Ga0453684_0052828
619 Ga0453684_0059260
620 Ga0453684_0232432
621 Ga0451576_0021533
622 Ga0451576_0219369
623 Ga0451576_0648310
624 Ga0495592_0410898
625 Ga0495638_0000006
626 Ga0495638_0000050
627 Ga0495638_0151865
628 Ga0495632_0055775
629 Ga0495674_0259792
630 Ga0495672_0006196
631 Ga0495672_0062569
632 Ga0495680_0365730
633 Ga0501290_019654
634 Ga0501217_005449
635 Ga0501236_000491
636 Ga0501253_033662
637 Ga0501259_001729
638 Ga0501225_0017443
639 Ga0501264_000874
640 nmdc:mga08y16_26566_c1
641 nmdc:mga08y16_43112_c1
642 nmdc:mga08y16_86779_c1
643 Ga0500644_0167691
644 Ga0500646_0048639
645 Ga0500583_0000047
646 Ga0500583_0001380
647 Ga0500557_040101
648 Ga0500655_050408
649 Ga0500588_0002022
650 Ga0500589_008614
651 Ga0500616_0000004
652 Ga0500616_0000065
653 Ga0500616_0004481
654 Ga0500616_0030304
655 Ga0500616_0042073
656 Ga0500622_0000004
657 Ga0500622_0000005
658 Ga0500622_0002426
659 Ga0500611_111887
660 Ga0500587_009734
661 2738726480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21906

NrtR_WHD

NrtR DNA-binding winged helix domain

182

242

0.98

PF19368

AraR_C

AraR C-terminal winged HTH domain

178

258

0.94

PF00293

NUDIX

NUDIX domain

39

174

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bs6-assembly1.cif.gz_B apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.9479 1 220
5bs6-assembly2.cif.gz_D apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.9387 1 220
5bs6-assembly1.cif.gz_B apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.9235 1 220
5bs6-assembly2.cif.gz_D apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.9029 1 220
3gz6-assembly1.cif.gz_B crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna 0.8756 14 219
ID Description Score Start End Superfamily
5bs6D01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9399 3 140 3.90.79.10
2fb1D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 145 220 1.10.10.10
5bs6D01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9074 3 140 3.90.79.10
5bs6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9063 145 220 1.10.10.10
3gz5B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8972 150 218 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2A4R308-F1-model_v4 DNA mismatch repair protein MutT 0.9727 2 228 GO:0005737
AF-A0A1M5AYK0-F1-model_v4 ADP-ribose pyrophosphatase YjhB, NUDIX family 0.9719 3 229 GO:0005737
AF-A0A2W5GG01-F1-model_v4 DNA mismatch repair protein MutT 0.9694 118 221 GO:0005737
AF-A0A1H7YKI1-F1-model_v4 ADP-ribose pyrophosphatase YjhB, NUDIX family 0.9693 6 220 GO:0005737
AF-A0A3C0AQQ4-F1-model_v4 NUDIX hydrolase 0.9673 118 226 GO:0016787

Map