F410602

General Info

Members Datasets Scaffolds Average Seq Length
331 163 330 115

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0379657|Ga0451807_0379657_176_589
Length 137
Sequence LGIRIYLLLFSLIPLKKNIMSEHNLHSTEEHAHDEHAGLSKSKIWQVFFILLGITVVEFIIALWLVPKGHIPLHWANPIYIVLTLFKAFYIVAYFMHLKFEKIGLALSIIVPILFIIGLILVLSNESHYWVDLRPKV

Samples

Sample ID Description Type Environment
1 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
159 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
160 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 3.63
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.55
Nodule 0
Rhizoplane 0.3
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1013446 3300001915 Bacteria 1388
2 JGI24740J21852_10006124 3300001979 Bacteria 5021
3 JGI24740J21852_10048624 3300001979 Bacteria 1231
4 JGI24739J22299_10116219 3300001989 Bacteria 801
5 JGI24737J22298_10000384 3300001990 Bacteria 15070
6 JGI24737J22298_10012680 3300001990 Bacteria 2747
7 JGI24743J22301_10037524 3300001991 Bacteria 966
8 JGI24735J21928_10000003 3300002067 Bacteria 385983
9 JGI24735J21928_10009809 3300002067 Bacteria 3067
10 JGI24744J21845_10000638 3300002077 Bacteria 6410
11 JGI25162J39368_1000203 3300002737 Bacteria 62704
12 JGI25162J39368_1002524 3300002737 Bacteria 7000
13 JGI25157J39369_1010744 3300002741 Bacteria 1199
14 JGI25164J39214_1001000 3300002772 Bacteria 8838
15 JGI25165J46597_1001414 3300003214 Bacteria 12976
16 rootH1_10019188 3300003316 Bacteria 26527
17 rootH1_10106633 3300003316 Bacteria 2729
18 rootH2_10231543 3300003320 Bacteria 6041
19 rootL2_10258214 3300003322 Bacteria 1110
20 rootH1_10004106 3300003323 Bacteria 40486
21 rootH1_10093014 3300003323 Bacteria 3616
22 rootH1_10213025 3300003323 Bacteria 1013
23 Ga0065714_10010554 3300005288 Bacteria 2090
24 Ga0065714_10101155 3300005288 Bacteria 1650
25 Ga0070658_10000060 3300005327 Bacteria 112561
26 Ga0070658_10121439 3300005327 Bacteria 2171
27 Ga0070658_10310660 3300005327 Bacteria 1345
28 Ga0070658_11122233 3300005327 Bacteria 684
29 Ga0070676_10000152 3300005328 Bacteria 27554
30 Ga0070660_100003098 3300005339 Bacteria 11425
31 Ga0070691_10840564 3300005341 Bacteria 562
32 Ga0070661_100354147 3300005344 Bacteria 1152
33 Ga0070675_100308019 3300005354 Bacteria 1397
34 Ga0070671_101307564 3300005355 Bacteria 640
35 Ga0070673_100012956 3300005364 Bacteria 5747
36 Ga0070673_101589902 3300005364 Bacteria 617
37 Ga0070659_100000199 3300005366 Bacteria 46342
38 Ga0070659_100004824 3300005366 Bacteria 9638
39 Ga0070659_100491576 3300005366 Bacteria 1045
40 Ga0070663_100022902 3300005455 Bacteria 4181
41 Ga0070681_11240059 3300005458 Bacteria 668
42 Ga0068867_100002522 3300005459 Bacteria 12881
43 Ga0070679_100192079 3300005530 Bacteria 2010
44 Ga0070684_100030112 3300005535 Bacteria 4609
45 Ga0068853_100082987 3300005539 Bacteria 2807
46 Ga0070665_100000264 3300005548 Bacteria 85867
47 Ga0068855_100000149 3300005563 Bacteria 89273
48 Ga0068855_100006331 3300005563 Bacteria 14426
49 Ga0068855_100177835 3300005563 Bacteria 2407
50 Ga0068855_100387626 3300005563 Bacteria 1533
51 Ga0068855_100911502 3300005563 Bacteria 928
52 Ga0068855_102232474 3300005563 Bacteria 549
53 Ga0068855_102433869 3300005563 Bacteria 522
54 Ga0068857_100045573 3300005577 Bacteria 3891
55 Ga0068857_100078838 3300005577 Bacteria 2940
56 Ga0068857_101267022 3300005577 Bacteria 715
57 Ga0068857_102078812 3300005577 Bacteria 557
58 Ga0068854_100447894 3300005578 Bacteria 1078
59 Ga0068854_100582804 3300005578 Bacteria 953
60 Ga0068856_100000120 3300005614 Bacteria 78280
61 Ga0068856_100001959 3300005614 Bacteria 21441
62 Ga0068856_100028099 3300005614 Bacteria 5490
63 Ga0068856_100180532 3300005614 Bacteria 2124
64 Ga0068852_100000389 3300005616 Bacteria 29439
65 Ga0068852_100121752 3300005616 Bacteria 2390
66 Ga0068866_10096118 3300005718 Bacteria 1624
67 Ga0075366_10000344 3300006195 Bacteria 21320
68 Ga0075366_10000422 3300006195 Bacteria 19817
69 Ga0075366_10010527 3300006195 Bacteria 5193
70 Ga0075366_10256889 3300006195 Bacteria 1066
71 Ga0097621_100000232 3300006237 Bacteria 37391
72 Ga0097621_101065151 3300006237 Bacteria 758
73 Ga0075370_10740826 3300006353 Bacteria 598
74 Ga0068871_100000800 3300006358 Bacteria 21155
75 Ga0068865_100003071 3300006881 Bacteria 9985
76 Ga0105240_10000371 3300009093 Bacteria 84390
77 Ga0105240_10249145 3300009093 Bacteria 2055
78 Ga0105240_10403516 3300009093 Bacteria 1539
79 Ga0105240_10574295 3300009093 Bacteria 1244
80 Ga0105240_11068917 3300009093 Bacteria 860
81 Ga0105240_11414399 3300009093 Bacteria 731
82 Ga0105240_11969298 3300009093 Bacteria 607
83 Ga0105240_12723484 3300009093 Bacteria 510
84 Ga0105245_13120554 3300009098 Bacteria 513
85 Ga0105243_10036187 3300009148 Bacteria 3830
86 Ga0105241_10000733 3300009174 Bacteria 24893
87 Ga0105241_10060036 3300009174 Bacteria 2925
88 Ga0105241_10347111 3300009174 Bacteria 1287
89 Ga0105241_10840212 3300009174 Bacteria 848
90 Ga0105242_10261405 3300009176 Bacteria 1564
91 Ga0105242_13189428 3300009176 Bacteria 509
92 Ga0105248_10393866 3300009177 Bacteria 1560
93 Ga0105237_10000535 3300009545 Bacteria 53620
94 Ga0105237_10000632 3300009545 Bacteria 49178
95 Ga0105237_10002670 3300009545 Bacteria 21900
96 Ga0105237_10003574 3300009545 Bacteria 18410
97 Ga0105237_10133851 3300009545 Bacteria 2473
98 Ga0105237_10162473 3300009545 Bacteria 2232
99 Ga0105237_10220070 3300009545 Bacteria 1899
100 Ga0105237_10404062 3300009545 Bacteria 1370
101 Ga0105237_10763891 3300009545 Bacteria 973
102 Ga0105238_10000612 3300009551 Bacteria 37482
103 Ga0105238_10041104 3300009551 Bacteria 4683
104 Ga0105238_10095839 3300009551 Bacteria 2954
105 Ga0105239_10000009 3300010375 Bacteria 361182
106 Ga0105239_10000478 3300010375 Bacteria 58328
107 Ga0105239_10001768 3300010375 Bacteria 28424
108 Ga0105239_10093223 3300010375 Bacteria 3325
109 Ga0105239_10095151 3300010375 Bacteria 3290
110 Ga0105239_10102215 3300010375 Bacteria 3172
111 Ga0105239_11081144 3300010375 Bacteria 923
112 Ga0105246_10403941 3300011119 Bacteria 1135
113 Ga0157373_10001788 3300013100 Bacteria 16341
114 Ga0157373_10890341 3300013100 Bacteria 660
115 Ga0157371_10000980 3300013102 Bacteria 31717
116 Ga0157371_10001492 3300013102 Bacteria 24223
117 Ga0157371_10032084 3300013102 Bacteria 3781
118 Ga0157370_10141317 3300013104 Bacteria 2243
119 Ga0157370_10148868 3300013104 Bacteria 2179
120 Ga0157370_10150447 3300013104 Bacteria 2166
121 Ga0157370_10526055 3300013104 Bacteria 1085
122 Ga0157369_10043369 3300013105 Bacteria 4903
123 Ga0157369_10167980 3300013105 Bacteria 2313
124 Ga0157369_10182552 3300013105 Bacteria 2207
125 Ga0157374_10005433 3300013296 Bacteria 10705
126 Ga0157374_10064857 3300013296 Bacteria 3429
127 Ga0157374_10661524 3300013296 Bacteria 1057
128 Ga0157374_10681642 3300013296 Bacteria 1040
129 Ga0157374_11005295 3300013296 Bacteria 853
130 Ga0157374_11724643 3300013296 Bacteria 651
131 Ga0157378_10005776 3300013297 Bacteria 10842
132 Ga0157378_10046222 3300013297 Bacteria 3870
133 Ga0157378_11021605 3300013297 Bacteria 862
134 Ga0157378_12090709 3300013297 Bacteria 617
135 Ga0163162_10000008 3300013306 Bacteria 316194
136 Ga0163162_10005211 3300013306 Bacteria 12536
137 Ga0163162_10199500 3300013306 Bacteria 2129
138 Ga0163162_10246746 3300013306 Bacteria 1917
139 Ga0163162_10698749 3300013306 Bacteria 1136
140 Ga0163162_11198316 3300013306 Bacteria 862
141 Ga0157372_10000190 3300013307 Bacteria 67909
142 Ga0157372_10000514 3300013307 Bacteria 42626
143 Ga0157372_10001572 3300013307 Bacteria 24881
144 Ga0157372_10333814 3300013307 Bacteria 1766
145 Ga0157375_10001485 3300013308 Bacteria 20130
146 Ga0157375_10184168 3300013308 Bacteria 2241
147 Ga0157377_10035133 3300014745 Bacteria 2747
148 Ga0157376_10014265 3300014969 Bacteria 5958
149 Ga0157376_12407194 3300014969 Bacteria 566
150 Ga0157376_12830664 3300014969 Bacteria 525
151 Ga0163161_10004399 3300017792 Bacteria 9830
152 Ga0163161_10018221 3300017792 Bacteria 4922
153 Ga0163161_10184826 3300017792 Bacteria 1600
154 Ga0206351_10021648 3300020077 Bacteria 1387
155 Ga0206351_10817434 3300020077 Bacteria 1981
156 Ga0206352_10388625 3300020078 Bacteria 1113
157 Ga0206352_11210880 3300020078 Bacteria 566
158 Ga0206350_10699165 3300020080 Bacteria 1395
159 Ga0206350_10699293 3300020080 Bacteria 808
160 Ga0154015_1629078 3300020610 Bacteria 1176
161 Ga0224712_10045119 3300022467 Bacteria 1685
162 Ga0207427_100131 3300025231 Bacteria 93947
163 Ga0209437_100048 3300025233 Bacteria 405107
164 Ga0209437_100102 3300025233 Bacteria 224216
165 Ga0209026_1000683 3300025250 Bacteria 20446
166 Ga0209026_1001195 3300025250 Bacteria 12026
167 Ga0209026_1004230 3300025250 Bacteria 4364
168 Ga0209233_1000029 3300025261 Bacteria 641642
169 Ga0209233_1000520 3300025261 Bacteria 22249
170 Ga0207647_10000588 3300025904 Bacteria 28282
171 Ga0207647_10056191 3300025904 Bacteria 2415
172 Ga0207647_10104328 3300025904 Bacteria 1680
173 Ga0207645_10000948 3300025907 Bacteria 24090
174 Ga0207705_10000233 3300025909 Bacteria 55125
175 Ga0207705_10056329 3300025909 Bacteria 2834
176 Ga0207705_10317057 3300025909 Bacteria 1198
177 Ga0207705_10843041 3300025909 Bacteria 711
178 Ga0207654_10010794 3300025911 Bacteria 4650
179 Ga0207654_10078930 3300025911 Bacteria 1976
180 Ga0207654_10242851 3300025911 Bacteria 1204
181 Ga0207707_11046396 3300025912 Bacteria 668
182 Ga0207695_10000142 3300025913 Bacteria 214715
183 Ga0207695_10131124 3300025913 Bacteria 2464
184 Ga0207695_10353305 3300025913 Bacteria 1357
185 Ga0207695_10823200 3300025913 Bacteria 808
186 Ga0207695_11590337 3300025913 Bacteria 534
187 Ga0207671_10000110 3300025914 Bacteria 126480
188 Ga0207671_10002963 3300025914 Bacteria 17464
189 Ga0207671_10003169 3300025914 Bacteria 16617
190 Ga0207671_10013990 3300025914 Bacteria 6365
191 Ga0207671_10176063 3300025914 Bacteria 1663
192 Ga0207671_10347932 3300025914 Bacteria 1175
193 Ga0207671_11289707 3300025914 Bacteria 569
194 Ga0207671_11303836 3300025914 Bacteria 565
195 Ga0207657_10011218 3300025919 Bacteria 8909
196 Ga0207657_10195182 3300025919 Bacteria 1631
197 Ga0207649_10384680 3300025920 Bacteria 1046
198 Ga0207652_10079435 3300025921 Bacteria 2866
199 Ga0207694_10082126 3300025924 Bacteria 2533
200 Ga0207694_10256314 3300025924 Bacteria 1432
201 Ga0207644_11537905 3300025931 Unclassified 558
202 Ga0207690_10000744 3300025932 Bacteria 21044
203 Ga0207690_10012764 3300025932 Bacteria 5034
204 Ga0207686_10040466 3300025934 Bacteria 2834
205 Ga0207709_10040688 3300025935 Bacteria 2784
206 Ga0207704_10000015 3300025938 Bacteria 163572
207 Ga0207667_10000496 3300025949 Bacteria 51954
208 Ga0207667_10028165 3300025949 Bacteria 6103
209 Ga0207667_10034518 3300025949 Bacteria 5431
210 Ga0207667_10339102 3300025949 Bacteria 1534
211 Ga0207667_11336993 3300025949 Bacteria 692
212 Ga0207651_10093988 3300025960 Bacteria 2203
213 Ga0207651_11452749 3300025960 Bacteria 617
214 Ga0207640_10378750 3300025981 Bacteria 1146
215 Ga0207640_11840890 3300025981 Bacteria 547
216 Ga0207703_11406916 3300026035 Bacteria 671
217 Ga0207639_10052510 3300026041 Bacteria 3106
218 Ga0207639_10077515 3300026041 Bacteria 2620
219 Ga0207639_10090973 3300026041 Bacteria 2442
220 Ga0207678_10008440 3300026067 Bacteria 9086
221 Ga0207702_10000195 3300026078 Bacteria 71757
222 Ga0207702_10011030 3300026078 Bacteria 7541
223 Ga0207702_10019399 3300026078 Bacteria 5626
224 Ga0207702_10398091 3300026078 Bacteria 1327
225 Ga0207648_10001141 3300026089 Bacteria 29844
226 Ga0207674_10091146 3300026116 Bacteria 3039
227 Ga0207674_10387652 3300026116 Bacteria 1351
228 Ga0207683_10008935 3300026121 Bacteria 8536
229 Ga0207698_10026325 3300026142 Bacteria 4113
230 Ga0207698_10094539 3300026142 Bacteria 2458
231 Ga0207698_12331910 3300026142 Unclassified 547
232 Ga0268266_10000268 3300028379 Bacteria 85976
233 Ga0307515_10001810 3300028794 Bacteria 47689
234 Ga0307515_10004229 3300028794 Bacteria 29830
235 Ga0307515_10301020 3300028794 Bacteria 1289
236 Ga0265338_10039381 3300028800 Bacteria 4459
237 Ga0307513_10804710 3300031456 Bacteria 646
238 Ga0307414_10206749 3300032004 Bacteria 1601
239 Ga0307414_10310805 3300032004 Bacteria 1337
240 Ga0307507_10002394 3300033179 Bacteria 39588
241 Ga0307510_10138221 3300033180 Bacteria 2088
242 Ga0373941_0043379 3300035115 Bacteria 1400
243 Ga0373925_1376384 3300037068 Bacteria 578
244 Ga0395899_0000325 3300037312 Bacteria 60438
245 Ga0395899_0036075 3300037312 Bacteria 3711
246 Ga0395900_0002139 3300037418 Bacteria 22114
247 Ga0395900_0025254 3300037418 Bacteria 6082
248 Ga0395898_1006911 3300037466 Bacteria 769
249 Ga0395898_1836205 3300037466 Bacteria 527
250 Ga0395905_0000729 3300037471 Bacteria 43376
251 Ga0395901_0229988 3300038443 Bacteria 1936
252 Ga0451807_0379657 3300041486 Bacteria 800
253 Ga0466966_0027709 3300044684 Bacteria 3693
254 Ga0466961_0069255 3300044693 Bacteria 2240
255 Ga0466959_0035545 3300045049 Bacteria 3684
256 Ga0466959_0042243 3300045049 Bacteria 3363
257 Ga0495638_0093942 3300046460 Bacteria 1803
258 Ga0495650_0000107 3300046471 Bacteria 200864
259 Ga0495650_0201671 3300046471 Bacteria 691
260 Ga0495585_0000014 3300046492 Bacteria 187513
261 Ga0495585_0000642 3300046492 Bacteria 32168
262 Ga0495585_0235767 3300046492 Unclassified 918
263 Ga0495585_0339186 3300046492 Bacteria 732
264 Ga0495607_0210535 3300046501 Bacteria 957
265 Ga0495583_0129263 3300046506 Bacteria 1058
266 Ga0495606_0000303 3300046507 Bacteria 84874
267 Ga0495606_0014733 3300046507 Bacteria 6080
268 Ga0495606_0051681 3300046507 Bacteria 2679
269 Ga0495606_0167624 3300046507 Bacteria 1277
270 Ga0495610_0114807 3300046512 Bacteria 1188
271 Ga0495616_0002195 3300046513 Bacteria 13047
272 Ga0495616_0002783 3300046513 Bacteria 11422
273 Ga0495631_0027770 3300046518 Bacteria 2586
274 Ga0495632_0054300 3300046519 Bacteria 1964
275 Ga0495648_0005349 3300046524 Bacteria 10697
276 Ga0495648_0112598 3300046524 Bacteria 1477
277 Ga0495652_0892458 3300046529 Bacteria 587
278 Ga0495652_1130861 3300046529 Bacteria 507
279 Ga0495654_0197170 3300046530 Bacteria 864
280 Ga0495609_0007132 3300046538 Bacteria 5618
281 Ga0495622_0221618 3300046557 Bacteria 838
282 Ga0495633_0000026 3300046558 Bacteria 204722
283 Ga0495633_0007761 3300046558 Bacteria 6134
284 Ga0495668_0000054 3300046616 Bacteria 203960
285 Ga0495668_0364074 3300046616 Bacteria 794
286 Ga0495611_0341567 3300046648 Bacteria 687
287 Ga0495625_0000021 3300046660 Bacteria 282133
288 Ga0495625_0000168 3300046660 Bacteria 102626
289 Ga0495625_0004837 3300046660 Bacteria 12573
290 Ga0495625_0021093 3300046660 Bacteria 5021
291 Ga0495625_0079963 3300046660 Bacteria 2278
292 Ga0495625_0149365 3300046660 Bacteria 1572
293 Ga0495625_0881583 3300046660 Bacteria 514
294 Ga0495661_0013773 3300046665 Bacteria 5426
295 Ga0495661_0017412 3300046665 Bacteria 4747
296 Ga0495661_0045737 3300046665 Bacteria 2675
297 Ga0495661_0129280 3300046665 Bacteria 1386
298 Ga0495670_0144197 3300046691 Bacteria 1247
299 Ga0495671_0093292 3300046692 Bacteria 1473
300 Ga0495671_0165058 3300046692 Bacteria 1077
301 Ga0495649_0000009 3300046694 Bacteria 451725
302 Ga0495600_0112004 3300046809 Bacteria 1777
303 Ga0495660_0008372 3300046810 Bacteria 6048
304 Ga0495683_0105991 3300047323 Bacteria 1347
305 Ga0495683_0138976 3300047323 Bacteria 1140
306 Ga0495687_011247 3300047443 Bacteria 4824
307 Ga0495679_083026 3300047446 Bacteria 907
308 Ga0495686_0000319 3300047472 Bacteria 79929
309 Ga0495686_0000524 3300047472 Bacteria 55256
310 Ga0495686_0210332 3300047472 Bacteria 1112
311 Ga0495614_0042699 3300048089 Bacteria 1944
312 Ga0495678_013692 3300049459 Bacteria 3797
313 Ga0495678_167743 3300049459 Bacteria 697
314 Ga0495682_0094523 3300049460 Bacteria 1073
315 Ga0501241_000397 3300049758 Bacteria 9529
316 nmdc:mga0k408_100455_c1 3300050493 Bacteria 1706
317 nmdc:mga0k408_281_c2 3300050493 Bacteria 21573
318 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
319 nmdc:mga0k408_96157_c1 3300050493 Bacteria 1743
320 Ga0500635_0001757 3300053080 Bacteria 5283
321 Ga0500608_006000 3300053122 Bacteria 4897
322 Ga0500608_031174 3300053122 Bacteria 2529
323 Ga0500618_000016 3300053125 Bacteria 164049
324 Ga0500618_018612 3300053125 Bacteria 1717
325 Ga0500564_201958 3300053138 Bacteria 816
326 Ga0500624_001883 3300053157 Bacteria 3035
327 Ga0587077_239903 3300059493 Bacteria 520
328 Ga0587080_078349 3300059503 Bacteria 674
329 Ga0587069_013753 3300059642 Bacteria 1118
330 Ga0587076_068219 3300059645 Bacteria 732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_11969298 Ga0105240_119692982 97
2 3300009098 Ga0105245_13120554 Ga0105245_131205541 97
3 3300003316 rootH1_10106633 rootH1_101066331 109
4 3300005366 Ga0070659_100491576 Ga0070659_1004915762 109
5 3300005530 Ga0070679_100192079 Ga0070679_1001920792 109
6 3300009093 Ga0105240_12723484 Ga0105240_127234842 109
7 3300009545 Ga0105237_10133851 Ga0105237_101338515 109
8 3300009551 Ga0105238_10095839 Ga0105238_100958395 109
9 3300025914 Ga0207671_11289707 Ga0207671_112897071 109
10 3300025921 Ga0207652_10079435 Ga0207652_100794353 109
11 3300025924 Ga0207694_10082126 Ga0207694_100821262 109
12 3300033180 Ga0307510_10138221 Ga0307510_101382213 109
13 3300035115 Ga0373941_0043379 Ga0373941_0043379_224_568 109
14 3300046507 Ga0495606_0167624 Ga0495606_0167624_258_602 109
15 3300046518 Ga0495631_0027770 Ga0495631_0027770_1842_2186 109
16 3300046519 Ga0495632_0054300 Ga0495632_0054300_784_1128 109
17 3300046530 Ga0495654_0197170 Ga0495654_0197170_236_580 109
18 3300046616 Ga0495668_0364074 Ga0495668_0364074_53_397 109
19 3300046660 Ga0495625_0079963 Ga0495625_0079963_1437_1781 109
20 3300047323 Ga0495683_0138976 Ga0495683_0138976_786_1130 109
21 3300053122 Ga0500608_006000 Ga0500608_006000_292_636 109
22 3300005327 Ga0070658_10000060 Ga0070658_1000006042 110
23 3300005364 Ga0070673_101589902 Ga0070673_1015899021 110
24 3300005539 Ga0068853_100082987 Ga0068853_1000829875 110
25 3300005563 Ga0068855_100006331 Ga0068855_10000633111 110
26 3300005614 Ga0068856_100001959 Ga0068856_10000195922 110
27 3300009545 Ga0105237_10162473 Ga0105237_101624733 110
28 3300010375 Ga0105239_11081144 Ga0105239_110811442 110
29 3300013296 Ga0157374_10005433 Ga0157374_1000543312 110
30 3300013297 Ga0157378_10005776 Ga0157378_100057764 110
31 3300013308 Ga0157375_10184168 Ga0157375_101841684 110
32 3300025909 Ga0207705_10000233 Ga0207705_1000023342 110
33 3300025919 Ga0207657_10195182 Ga0207657_101951822 110
34 3300025949 Ga0207667_10034518 Ga0207667_100345186 110
35 3300025960 Ga0207651_11452749 Ga0207651_114527492 110
36 3300026041 Ga0207639_10052510 Ga0207639_100525102 110
37 3300026078 Ga0207702_10011030 Ga0207702_100110305 110
38 3300026142 Ga0207698_12331910 Ga0207698_123319101 110
39 3300037312 Ga0395899_0036075 Ga0395899_0036075_2439_2783 110
40 3300037418 Ga0395900_0025254 Ga0395900_0025254_3578_3922 110
41 3300037466 Ga0395898_1836205 Ga0395898_1836205_141_485 110
42 3300037471 Ga0395905_0000729 Ga0395905_0000729_31906_32250 110
43 3300045049 Ga0466959_0035545 Ga0466959_0035545_2681_3028 110
44 iso_pu_bacteria 2919437846 2919440281 110
45 3300009174 Ga0105241_10347111 Ga0105241_103471112 111
46 3300025911 Ga0207654_10242851 Ga0207654_102428512 111
47 3300046492 Ga0495585_0235767 Ga0495585_0235767_47_397 111
48 3300001979 JGI24740J21852_10048624 JGI24740J21852_100486241 112
49 3300001989 JGI24739J22299_10116219 JGI24739J22299_101162192 112
50 3300001990 JGI24737J22298_10000384 JGI24737J22298_1000038411 112
51 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003100 112
52 3300005288 Ga0065714_10010554 Ga0065714_100105542 112
53 3300005563 Ga0068855_100387626 Ga0068855_1003876262 112
54 3300005577 Ga0068857_100078838 Ga0068857_1000788382 112
55 3300005577 Ga0068857_101267022 Ga0068857_1012670222 112
56 3300006195 Ga0075366_10010527 Ga0075366_100105273 112
57 3300006353 Ga0075370_10740826 Ga0075370_107408262 112
58 3300009093 Ga0105240_10000371 Ga0105240_1000037151 112
59 3300009174 Ga0105241_10000733 Ga0105241_100007334 112
60 3300009545 Ga0105237_10000632 Ga0105237_1000063214 112
61 3300009545 Ga0105237_10003574 Ga0105237_1000357419 112
62 3300010375 Ga0105239_10001768 Ga0105239_100017682 112
63 3300010375 Ga0105239_10093223 Ga0105239_100932234 112
64 3300013102 Ga0157371_10032084 Ga0157371_100320842 112
65 3300013104 Ga0157370_10141317 Ga0157370_101413173 112
66 3300013105 Ga0157369_10167980 Ga0157369_101679803 112
67 3300013105 Ga0157369_10182552 Ga0157369_101825522 112
68 3300013296 Ga0157374_11005295 Ga0157374_110052952 112
69 3300013306 Ga0163162_10199500 Ga0163162_101995004 112
70 3300013307 Ga0157372_10000514 Ga0157372_100005149 112
71 3300013307 Ga0157372_10333814 Ga0157372_103338142 112
72 3300014969 Ga0157376_12830664 Ga0157376_128306641 112
73 3300020077 Ga0206351_10021648 Ga0206351_100216482 112
74 3300020078 Ga0206352_10388625 Ga0206352_103886252 112
75 3300020080 Ga0206350_10699165 Ga0206350_106991652 112
76 3300020610 Ga0154015_1629078 Ga0154015_16290782 112
77 3300025261 Ga0209233_1000520 Ga0209233_10005208 112
78 3300025904 Ga0207647_10104328 Ga0207647_101043282 112
79 3300025911 Ga0207654_10010794 Ga0207654_100107942 112
80 3300025913 Ga0207695_10000142 Ga0207695_1000014232 112
81 3300025914 Ga0207671_10000110 Ga0207671_1000011012 112
82 3300025914 Ga0207671_10002963 Ga0207671_100029634 112
83 3300025949 Ga0207667_10339102 Ga0207667_103391022 112
84 3300026116 Ga0207674_10387652 Ga0207674_103876521 112
85 3300046492 Ga0495585_0339186 Ga0495585_0339186_62_412 112
86 3300046506 Ga0495583_0129263 Ga0495583_0129263_515_856 112
87 3300046665 Ga0495661_0017412 Ga0495661_0017412_2344_2685 112
88 3300050493 nmdc:mga0k408_100455_c1 nmdc:mga0k408_100455_c1_517_855 112
89 3300001990 JGI24737J22298_10012680 JGI24737J22298_100126805 113
90 3300001991 JGI24743J22301_10037524 JGI24743J22301_100375242 113
91 3300002067 JGI24735J21928_10009809 JGI24735J21928_100098092 113
92 3300002077 JGI24744J21845_10000638 JGI24744J21845_100006386 113
93 3300003316 rootH1_10019188 rootH1_1001918828 113
94 3300003320 rootH2_10231543 rootH2_102315431 113
95 3300003322 rootL2_10258214 rootL2_102582142 113
96 3300003323 rootH1_10093014 rootH1_100930144 113
97 3300005327 Ga0070658_10310660 Ga0070658_103106602 113
98 3300005328 Ga0070676_10000152 Ga0070676_1000015219 113
99 3300005344 Ga0070661_100354147 Ga0070661_1003541471 113
100 3300005354 Ga0070675_100308019 Ga0070675_1003080193 113
101 3300005355 Ga0070671_101307564 Ga0070671_1013075642 113
102 3300005364 Ga0070673_100012956 Ga0070673_1000129569 113
103 3300005459 Ga0068867_100002522 Ga0068867_1000025222 113
104 3300005548 Ga0070665_100000264 Ga0070665_10000026455 113
105 3300005563 Ga0068855_102433869 Ga0068855_1024338692 113
106 3300005577 Ga0068857_100045573 Ga0068857_1000455734 113
107 3300005577 Ga0068857_102078812 Ga0068857_1020788122 113
108 3300005578 Ga0068854_100582804 Ga0068854_1005828042 113
109 3300005616 Ga0068852_100000389 Ga0068852_10000038922 113
110 3300005718 Ga0068866_10096118 Ga0068866_100961182 113
111 3300006195 Ga0075366_10000344 Ga0075366_1000034420 113
112 3300006195 Ga0075366_10000422 Ga0075366_1000042214 113
113 3300006237 Ga0097621_100000232 Ga0097621_10000023227 113
114 3300006358 Ga0068871_100000800 Ga0068871_1000008009 113
115 3300006881 Ga0068865_100003071 Ga0068865_1000030715 113
116 3300009148 Ga0105243_10036187 Ga0105243_100361875 113
117 3300009174 Ga0105241_10060036 Ga0105241_100600364 113
118 3300009176 Ga0105242_10261405 Ga0105242_102614052 113
119 3300009177 Ga0105248_10393866 Ga0105248_103938662 113
120 3300009545 Ga0105237_10000535 Ga0105237_1000053520 113
121 3300009545 Ga0105237_10220070 Ga0105237_102200702 113
122 3300009551 Ga0105238_10000612 Ga0105238_1000061214 113
123 3300010375 Ga0105239_10095151 Ga0105239_100951515 113
124 3300011119 Ga0105246_10403941 Ga0105246_104039412 113
125 3300013100 Ga0157373_10890341 Ga0157373_108903412 113
126 3300013102 Ga0157371_10000980 Ga0157371_100009809 113
127 3300013104 Ga0157370_10148868 Ga0157370_101488684 113
128 3300013104 Ga0157370_10526055 Ga0157370_105260552 113
129 3300013296 Ga0157374_10064857 Ga0157374_100648572 113
130 3300013296 Ga0157374_10681642 Ga0157374_106816422 113
131 3300013297 Ga0157378_11021605 Ga0157378_110216052 113
132 3300013306 Ga0163162_10000008 Ga0163162_10000008112 113
133 3300013306 Ga0163162_11198316 Ga0163162_111983162 113
134 3300013307 Ga0157372_10001572 Ga0157372_1000157221 113
135 3300013308 Ga0157375_10001485 Ga0157375_100014852 113
136 3300014745 Ga0157377_10035133 Ga0157377_100351334 113
137 3300014969 Ga0157376_10014265 Ga0157376_100142657 113
138 3300017792 Ga0163161_10004399 Ga0163161_100043996 113
139 3300017792 Ga0163161_10184826 Ga0163161_101848263 113
140 3300025904 Ga0207647_10000588 Ga0207647_1000058813 113
141 3300025904 Ga0207647_10056191 Ga0207647_100561912 113
142 3300025907 Ga0207645_10000948 Ga0207645_1000094815 113
143 3300025909 Ga0207705_10056329 Ga0207705_100563294 113
144 3300025909 Ga0207705_10317057 Ga0207705_103170572 113
145 3300025911 Ga0207654_10078930 Ga0207654_100789303 113
146 3300025914 Ga0207671_10013990 Ga0207671_100139907 113
147 3300025914 Ga0207671_10176063 Ga0207671_101760632 113
148 3300025920 Ga0207649_10384680 Ga0207649_103846802 113
149 3300025924 Ga0207694_10256314 Ga0207694_102563142 113
150 3300025931 Ga0207644_11537905 Ga0207644_115379051 113
151 3300025934 Ga0207686_10040466 Ga0207686_100404662 113
152 3300025935 Ga0207709_10040688 Ga0207709_100406886 113
153 3300025938 Ga0207704_10000015 Ga0207704_10000015127 113
154 3300025949 Ga0207667_11336993 Ga0207667_113369932 113
155 3300025960 Ga0207651_10093988 Ga0207651_100939882 113
156 3300025981 Ga0207640_11840890 Ga0207640_118408901 113
157 3300026041 Ga0207639_10077515 Ga0207639_100775152 113
158 3300026089 Ga0207648_10001141 Ga0207648_1000114123 113
159 3300026116 Ga0207674_10091146 Ga0207674_100911463 113
160 3300026121 Ga0207683_10008935 Ga0207683_100089356 113
161 3300026142 Ga0207698_10026325 Ga0207698_100263252 113
162 3300028379 Ga0268266_10000268 Ga0268266_1000026854 113
163 3300028794 Ga0307515_10301020 Ga0307515_103010202 113
164 3300032004 Ga0307414_10206749 Ga0307414_102067492 113
165 3300032004 Ga0307414_10310805 Ga0307414_103108052 113
166 3300037418 Ga0395900_0002139 Ga0395900_0002139_9035_9382 113
167 3300046492 Ga0495585_0000014 Ga0495585_0000014_3907_4248 113
168 3300046529 Ga0495652_0892458 Ga0495652_0892458_60_401 113
169 3300046648 Ga0495611_0341567 Ga0495611_0341567_229_570 113
170 3300046660 Ga0495625_0000168 Ga0495625_0000168_101415_101756 113
171 3300046660 Ga0495625_0021093 Ga0495625_0021093_4575_4916 113
172 3300047443 Ga0495687_011247 Ga0495687_011247_3216_3557 113
173 3300047472 Ga0495686_0000319 Ga0495686_0000319_37618_37965 113
174 3300049758 Ga0501241_000397 Ga0501241_000397_351_707 113
175 3300050493 nmdc:mga0k408_281_c2 nmdc:mga0k408_281_c2_17657_17998 113
176 3300050493 nmdc:mga0k408_82_c1 nmdc:mga0k408_82_c1_40711_41052 113
177 3300059493 Ga0587077_239903 Ga0587077_239903_86_436 113
178 3300059503 Ga0587080_078349 Ga0587080_078349_304_651 113
179 3300059642 Ga0587069_013753 Ga0587069_013753_346_693 113
180 3300002737 JGI25162J39368_1000203 JGI25162J39368_100020350 114
181 3300002741 JGI25157J39369_1010744 JGI25157J39369_10107442 114
182 3300005288 Ga0065714_10101155 Ga0065714_101011552 114
183 3300005341 Ga0070691_10840564 Ga0070691_108405642 114
184 3300005366 Ga0070659_100004824 Ga0070659_1000048245 114
185 3300005458 Ga0070681_11240059 Ga0070681_112400591 114
186 3300005563 Ga0068855_100177835 Ga0068855_1001778353 114
187 3300005563 Ga0068855_102232474 Ga0068855_1022324742 114
188 3300005578 Ga0068854_100447894 Ga0068854_1004478942 114
189 3300005614 Ga0068856_100000120 Ga0068856_10000012049 114
190 3300005614 Ga0068856_100028099 Ga0068856_1000280997 114
191 3300005614 Ga0068856_100180532 Ga0068856_1001805323 114
192 3300005616 Ga0068852_100121752 Ga0068852_1001217523 114
193 3300006195 Ga0075366_10256889 Ga0075366_102568892 114
194 3300006237 Ga0097621_101065151 Ga0097621_1010651512 114
195 3300009093 Ga0105240_10249145 Ga0105240_102491452 114
196 3300009093 Ga0105240_10574295 Ga0105240_105742952 114
197 3300009093 Ga0105240_11068917 Ga0105240_110689172 114
198 3300009093 Ga0105240_11414399 Ga0105240_114143991 114
199 3300009174 Ga0105241_10840212 Ga0105241_108402122 114
200 3300009176 Ga0105242_13189428 Ga0105242_131894282 114
201 3300009545 Ga0105237_10002670 Ga0105237_100026704 114
202 3300009545 Ga0105237_10404062 Ga0105237_104040622 114
203 3300009551 Ga0105238_10041104 Ga0105238_100411044 114
204 3300010375 Ga0105239_10000009 Ga0105239_10000009257 114
205 3300010375 Ga0105239_10000478 Ga0105239_100004782 114
206 3300010375 Ga0105239_10102215 Ga0105239_101022154 114
207 3300013296 Ga0157374_11724643 Ga0157374_117246432 114
208 3300013297 Ga0157378_12090709 Ga0157378_120907092 114
209 3300013306 Ga0163162_10005211 Ga0163162_100052119 114
210 3300013306 Ga0163162_10246746 Ga0163162_102467463 114
211 3300013306 Ga0163162_10698749 Ga0163162_106987492 114
212 3300014969 Ga0157376_12407194 Ga0157376_124071941 114
213 3300017792 Ga0163161_10018221 Ga0163161_100182216 114
214 3300025233 Ga0209437_100102 Ga0209437_10010213 114
215 3300025250 Ga0209026_1000683 Ga0209026_100068313 114
216 3300025912 Ga0207707_11046396 Ga0207707_110463961 114
217 3300025913 Ga0207695_10131124 Ga0207695_101311241 114
218 3300025913 Ga0207695_10353305 Ga0207695_103533052 114
219 3300025913 Ga0207695_11590337 Ga0207695_115903372 114
220 3300025914 Ga0207671_10003169 Ga0207671_1000316913 114
221 3300025914 Ga0207671_10347932 Ga0207671_103479322 114
222 3300025932 Ga0207690_10012764 Ga0207690_100127648 114
223 3300025949 Ga0207667_10028165 Ga0207667_100281656 114
224 3300025981 Ga0207640_10378750 Ga0207640_103787502 114
225 3300026035 Ga0207703_11406916 Ga0207703_114069162 114
226 3300026078 Ga0207702_10000195 Ga0207702_1000019521 114
227 3300026078 Ga0207702_10019399 Ga0207702_100193993 114
228 3300026078 Ga0207702_10398091 Ga0207702_103980911 114
229 3300026142 Ga0207698_10094539 Ga0207698_100945393 114
230 3300028794 Ga0307515_10001810 Ga0307515_1000181010 114
231 3300028794 Ga0307515_10004229 Ga0307515_1000422919 114
232 3300031456 Ga0307513_10804710 Ga0307513_108047102 114
233 3300033179 Ga0307507_10002394 Ga0307507_1000239423 114
234 3300037068 Ga0373925_1376384 Ga0373925_1376384_201_545 114
235 3300037466 Ga0395898_1006911 Ga0395898_1006911_321_677 114
236 3300038443 Ga0395901_0229988 Ga0395901_0229988_223_579 114
237 3300041486 Ga0451807_0379657 Ga0451807_0379657_176_589 114
238 3300046460 Ga0495638_0093942 Ga0495638_0093942_784_1128 114
239 3300046471 Ga0495650_0201671 Ga0495650_0201671_175_519 114
240 3300046492 Ga0495585_0000642 Ga0495585_0000642_12204_12548 114
241 3300046501 Ga0495607_0210535 Ga0495607_0210535_363_707 114
242 3300046507 Ga0495606_0051681 Ga0495606_0051681_775_1167 114
243 3300046513 Ga0495616_0002783 Ga0495616_0002783_6559_6903 114
244 3300046524 Ga0495648_0005349 Ga0495648_0005349_7299_7643 114
245 3300046524 Ga0495648_0112598 Ga0495648_0112598_405_749 114
246 3300046529 Ga0495652_1130861 Ga0495652_1130861_88_480 114
247 3300046538 Ga0495609_0007132 Ga0495609_0007132_756_1100 114
248 3300046557 Ga0495622_0221618 Ga0495622_0221618_286_630 114
249 3300046558 Ga0495633_0000026 Ga0495633_0000026_104285_104629 114
250 3300046616 Ga0495668_0000054 Ga0495668_0000054_74472_74816 114
251 3300046660 Ga0495625_0004837 Ga0495625_0004837_11522_11866 114
252 3300046660 Ga0495625_0149365 Ga0495625_0149365_960_1313 114
253 3300046660 Ga0495625_0881583 Ga0495625_0881583_61_405 114
254 3300046665 Ga0495661_0129280 Ga0495661_0129280_754_1098 114
255 3300046691 Ga0495670_0144197 Ga0495670_0144197_816_1160 114
256 3300046692 Ga0495671_0093292 Ga0495671_0093292_1016_1360 114
257 3300046809 Ga0495600_0112004 Ga0495600_0112004_522_866 114
258 3300047472 Ga0495686_0000524 Ga0495686_0000524_51783_52127 114
259 3300047472 Ga0495686_0210332 Ga0495686_0210332_318_662 114
260 3300048089 Ga0495614_0042699 Ga0495614_0042699_102_446 114
261 3300049459 Ga0495678_013692 Ga0495678_013692_2690_3034 114
262 3300049459 Ga0495678_167743 Ga0495678_167743_90_434 114
263 3300049460 Ga0495682_0094523 Ga0495682_0094523_617_961 114
264 3300050493 nmdc:mga0k408_96157_c1 nmdc:mga0k408_96157_c1_928_1281 114
265 3300053080 Ga0500635_0001757 Ga0500635_0001757_1357_1704 114
266 3300053122 Ga0500608_031174 Ga0500608_031174_113_457 114
267 3300053125 Ga0500618_000016 Ga0500618_000016_108919_109263 114
268 3300053138 Ga0500564_201958 Ga0500564_201958_342_686 114
269 3300053157 Ga0500624_001883 Ga0500624_001883_85_429 114
270 3300059645 Ga0587076_068219 Ga0587076_068219_74_427 114
271 3300003323 rootH1_10213025 rootH1_102130252 115
272 3300005327 Ga0070658_11122233 Ga0070658_111222331 115
273 3300005339 Ga0070660_100003098 Ga0070660_1000030989 115
274 3300005366 Ga0070659_100000199 Ga0070659_10000019914 115
275 3300005563 Ga0068855_100000149 Ga0068855_10000014927 115
276 3300005563 Ga0068855_100911502 Ga0068855_1009115022 115
277 3300009545 Ga0105237_10763891 Ga0105237_107638912 115
278 3300013296 Ga0157374_10661524 Ga0157374_106615242 115
279 3300013297 Ga0157378_10046222 Ga0157378_100462227 115
280 3300025909 Ga0207705_10843041 Ga0207705_108430411 115
281 3300025914 Ga0207671_11303836 Ga0207671_113038362 115
282 3300025919 Ga0207657_10011218 Ga0207657_100112187 115
283 3300025932 Ga0207690_10000744 Ga0207690_100007447 115
284 3300025949 Ga0207667_10000496 Ga0207667_1000049626 115
285 3300026041 Ga0207639_10090973 Ga0207639_100909733 115
286 3300028800 Ga0265338_10039381 Ga0265338_100393814 115
287 3300046471 Ga0495650_0000107 Ga0495650_0000107_138571_138918 115
288 3300046507 Ga0495606_0000303 Ga0495606_0000303_45992_46339 115
289 3300046507 Ga0495606_0014733 Ga0495606_0014733_619_966 115
290 3300046512 Ga0495610_0114807 Ga0495610_0114807_175_522 115
291 3300046513 Ga0495616_0002195 Ga0495616_0002195_6772_7119 115
292 3300046558 Ga0495633_0007761 Ga0495633_0007761_3858_4205 115
293 3300046660 Ga0495625_0000021 Ga0495625_0000021_85389_85736 115
294 3300046665 Ga0495661_0013773 Ga0495661_0013773_4405_4752 115
295 3300046665 Ga0495661_0045737 Ga0495661_0045737_1905_2252 115
296 3300046692 Ga0495671_0165058 Ga0495671_0165058_310_657 115
297 3300046694 Ga0495649_0000009 Ga0495649_0000009_373791_374138 115
298 3300046810 Ga0495660_0008372 Ga0495660_0008372_2578_2925 115
299 3300047323 Ga0495683_0105991 Ga0495683_0105991_797_1144 115
300 3300047446 Ga0495679_083026 Ga0495679_083026_268_615 115
301 3300053125 Ga0500618_018612 Ga0500618_018612_161_508 115
302 3300001915 JGI24741J21665_1013446 JGI24741J21665_10134462 116
303 3300001979 JGI24740J21852_10006124 JGI24740J21852_100061247 116
304 3300002737 JGI25162J39368_1002524 JGI25162J39368_10025246 116
305 3300002772 JGI25164J39214_1001000 JGI25164J39214_10010007 116
306 3300003214 JGI25165J46597_1001414 JGI25165J46597_10014148 116
307 3300003323 rootH1_10004106 rootH1_1000410636 116
308 3300005327 Ga0070658_10121439 Ga0070658_101214394 116
309 3300005455 Ga0070663_100022902 Ga0070663_1000229026 116
310 3300005535 Ga0070684_100030112 Ga0070684_1000301124 116
311 3300009093 Ga0105240_10403516 Ga0105240_104035162 116
312 3300013100 Ga0157373_10001788 Ga0157373_100017882 116
313 3300013102 Ga0157371_10001492 Ga0157371_1000149219 116
314 3300013104 Ga0157370_10150447 Ga0157370_101504474 116
315 3300013105 Ga0157369_10043369 Ga0157369_100433692 116
316 3300013307 Ga0157372_10000190 Ga0157372_1000019045 116
317 3300020077 Ga0206351_10817434 Ga0206351_108174344 116
318 3300020078 Ga0206352_11210880 Ga0206352_112108801 116
319 3300020080 Ga0206350_10699293 Ga0206350_106992932 116
320 3300022467 Ga0224712_10045119 Ga0224712_100451192 116
321 3300025231 Ga0207427_100131 Ga0207427_10013140 116
322 3300025233 Ga0209437_100048 Ga0209437_10004870 116
323 3300025250 Ga0209026_1001195 Ga0209026_10011953 116
324 3300025250 Ga0209026_1004230 Ga0209026_10042305 116
325 3300025261 Ga0209233_1000029 Ga0209233_1000029307 116
326 3300025913 Ga0207695_10823200 Ga0207695_108232002 116
327 3300026067 Ga0207678_10008440 Ga0207678_100084404 116
328 3300037312 Ga0395899_0000325 Ga0395899_0000325_44624_44974 116
329 3300044684 Ga0466966_0027709 Ga0466966_0027709_2455_2805 116
330 3300044693 Ga0466961_0069255 Ga0466961_0069255_1759_2109 116
331 3300045049 Ga0466959_0042243 Ga0466959_0042243_471_821 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

45

121

0.94

Feature Viewer

pLDDT pTM Quality
71.7 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map