F410602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 163 | 330 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_0379657|Ga0451807_0379657_176_589 |
| Length | 137 |
| Sequence | LGIRIYLLLFSLIPLKKNIMSEHNLHSTEEHAHDEHAGLSKSKIWQVFFILLGITVVEFIIALWLVPKGHIPLHWANPIYIVLTLFKAFYIVAYFMHLKFEKIGLALSIIVPILFIIGLILVLSNESHYWVDLRPKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 109 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 110 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 154 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 155 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 156 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 157 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 158 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 160 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.07 |
| Metatranscriptomes | 3.63 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.55 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 87.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1013446 | 3300001915 | Bacteria | 1388 |
| 2 | JGI24740J21852_10006124 | 3300001979 | Bacteria | 5021 |
| 3 | JGI24740J21852_10048624 | 3300001979 | Bacteria | 1231 |
| 4 | JGI24739J22299_10116219 | 3300001989 | Bacteria | 801 |
| 5 | JGI24737J22298_10000384 | 3300001990 | Bacteria | 15070 |
| 6 | JGI24737J22298_10012680 | 3300001990 | Bacteria | 2747 |
| 7 | JGI24743J22301_10037524 | 3300001991 | Bacteria | 966 |
| 8 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 9 | JGI24735J21928_10009809 | 3300002067 | Bacteria | 3067 |
| 10 | JGI24744J21845_10000638 | 3300002077 | Bacteria | 6410 |
| 11 | JGI25162J39368_1000203 | 3300002737 | Bacteria | 62704 |
| 12 | JGI25162J39368_1002524 | 3300002737 | Bacteria | 7000 |
| 13 | JGI25157J39369_1010744 | 3300002741 | Bacteria | 1199 |
| 14 | JGI25164J39214_1001000 | 3300002772 | Bacteria | 8838 |
| 15 | JGI25165J46597_1001414 | 3300003214 | Bacteria | 12976 |
| 16 | rootH1_10019188 | 3300003316 | Bacteria | 26527 |
| 17 | rootH1_10106633 | 3300003316 | Bacteria | 2729 |
| 18 | rootH2_10231543 | 3300003320 | Bacteria | 6041 |
| 19 | rootL2_10258214 | 3300003322 | Bacteria | 1110 |
| 20 | rootH1_10004106 | 3300003323 | Bacteria | 40486 |
| 21 | rootH1_10093014 | 3300003323 | Bacteria | 3616 |
| 22 | rootH1_10213025 | 3300003323 | Bacteria | 1013 |
| 23 | Ga0065714_10010554 | 3300005288 | Bacteria | 2090 |
| 24 | Ga0065714_10101155 | 3300005288 | Bacteria | 1650 |
| 25 | Ga0070658_10000060 | 3300005327 | Bacteria | 112561 |
| 26 | Ga0070658_10121439 | 3300005327 | Bacteria | 2171 |
| 27 | Ga0070658_10310660 | 3300005327 | Bacteria | 1345 |
| 28 | Ga0070658_11122233 | 3300005327 | Bacteria | 684 |
| 29 | Ga0070676_10000152 | 3300005328 | Bacteria | 27554 |
| 30 | Ga0070660_100003098 | 3300005339 | Bacteria | 11425 |
| 31 | Ga0070691_10840564 | 3300005341 | Bacteria | 562 |
| 32 | Ga0070661_100354147 | 3300005344 | Bacteria | 1152 |
| 33 | Ga0070675_100308019 | 3300005354 | Bacteria | 1397 |
| 34 | Ga0070671_101307564 | 3300005355 | Bacteria | 640 |
| 35 | Ga0070673_100012956 | 3300005364 | Bacteria | 5747 |
| 36 | Ga0070673_101589902 | 3300005364 | Bacteria | 617 |
| 37 | Ga0070659_100000199 | 3300005366 | Bacteria | 46342 |
| 38 | Ga0070659_100004824 | 3300005366 | Bacteria | 9638 |
| 39 | Ga0070659_100491576 | 3300005366 | Bacteria | 1045 |
| 40 | Ga0070663_100022902 | 3300005455 | Bacteria | 4181 |
| 41 | Ga0070681_11240059 | 3300005458 | Bacteria | 668 |
| 42 | Ga0068867_100002522 | 3300005459 | Bacteria | 12881 |
| 43 | Ga0070679_100192079 | 3300005530 | Bacteria | 2010 |
| 44 | Ga0070684_100030112 | 3300005535 | Bacteria | 4609 |
| 45 | Ga0068853_100082987 | 3300005539 | Bacteria | 2807 |
| 46 | Ga0070665_100000264 | 3300005548 | Bacteria | 85867 |
| 47 | Ga0068855_100000149 | 3300005563 | Bacteria | 89273 |
| 48 | Ga0068855_100006331 | 3300005563 | Bacteria | 14426 |
| 49 | Ga0068855_100177835 | 3300005563 | Bacteria | 2407 |
| 50 | Ga0068855_100387626 | 3300005563 | Bacteria | 1533 |
| 51 | Ga0068855_100911502 | 3300005563 | Bacteria | 928 |
| 52 | Ga0068855_102232474 | 3300005563 | Bacteria | 549 |
| 53 | Ga0068855_102433869 | 3300005563 | Bacteria | 522 |
| 54 | Ga0068857_100045573 | 3300005577 | Bacteria | 3891 |
| 55 | Ga0068857_100078838 | 3300005577 | Bacteria | 2940 |
| 56 | Ga0068857_101267022 | 3300005577 | Bacteria | 715 |
| 57 | Ga0068857_102078812 | 3300005577 | Bacteria | 557 |
| 58 | Ga0068854_100447894 | 3300005578 | Bacteria | 1078 |
| 59 | Ga0068854_100582804 | 3300005578 | Bacteria | 953 |
| 60 | Ga0068856_100000120 | 3300005614 | Bacteria | 78280 |
| 61 | Ga0068856_100001959 | 3300005614 | Bacteria | 21441 |
| 62 | Ga0068856_100028099 | 3300005614 | Bacteria | 5490 |
| 63 | Ga0068856_100180532 | 3300005614 | Bacteria | 2124 |
| 64 | Ga0068852_100000389 | 3300005616 | Bacteria | 29439 |
| 65 | Ga0068852_100121752 | 3300005616 | Bacteria | 2390 |
| 66 | Ga0068866_10096118 | 3300005718 | Bacteria | 1624 |
| 67 | Ga0075366_10000344 | 3300006195 | Bacteria | 21320 |
| 68 | Ga0075366_10000422 | 3300006195 | Bacteria | 19817 |
| 69 | Ga0075366_10010527 | 3300006195 | Bacteria | 5193 |
| 70 | Ga0075366_10256889 | 3300006195 | Bacteria | 1066 |
| 71 | Ga0097621_100000232 | 3300006237 | Bacteria | 37391 |
| 72 | Ga0097621_101065151 | 3300006237 | Bacteria | 758 |
| 73 | Ga0075370_10740826 | 3300006353 | Bacteria | 598 |
| 74 | Ga0068871_100000800 | 3300006358 | Bacteria | 21155 |
| 75 | Ga0068865_100003071 | 3300006881 | Bacteria | 9985 |
| 76 | Ga0105240_10000371 | 3300009093 | Bacteria | 84390 |
| 77 | Ga0105240_10249145 | 3300009093 | Bacteria | 2055 |
| 78 | Ga0105240_10403516 | 3300009093 | Bacteria | 1539 |
| 79 | Ga0105240_10574295 | 3300009093 | Bacteria | 1244 |
| 80 | Ga0105240_11068917 | 3300009093 | Bacteria | 860 |
| 81 | Ga0105240_11414399 | 3300009093 | Bacteria | 731 |
| 82 | Ga0105240_11969298 | 3300009093 | Bacteria | 607 |
| 83 | Ga0105240_12723484 | 3300009093 | Bacteria | 510 |
| 84 | Ga0105245_13120554 | 3300009098 | Bacteria | 513 |
| 85 | Ga0105243_10036187 | 3300009148 | Bacteria | 3830 |
| 86 | Ga0105241_10000733 | 3300009174 | Bacteria | 24893 |
| 87 | Ga0105241_10060036 | 3300009174 | Bacteria | 2925 |
| 88 | Ga0105241_10347111 | 3300009174 | Bacteria | 1287 |
| 89 | Ga0105241_10840212 | 3300009174 | Bacteria | 848 |
| 90 | Ga0105242_10261405 | 3300009176 | Bacteria | 1564 |
| 91 | Ga0105242_13189428 | 3300009176 | Bacteria | 509 |
| 92 | Ga0105248_10393866 | 3300009177 | Bacteria | 1560 |
| 93 | Ga0105237_10000535 | 3300009545 | Bacteria | 53620 |
| 94 | Ga0105237_10000632 | 3300009545 | Bacteria | 49178 |
| 95 | Ga0105237_10002670 | 3300009545 | Bacteria | 21900 |
| 96 | Ga0105237_10003574 | 3300009545 | Bacteria | 18410 |
| 97 | Ga0105237_10133851 | 3300009545 | Bacteria | 2473 |
| 98 | Ga0105237_10162473 | 3300009545 | Bacteria | 2232 |
| 99 | Ga0105237_10220070 | 3300009545 | Bacteria | 1899 |
| 100 | Ga0105237_10404062 | 3300009545 | Bacteria | 1370 |
| 101 | Ga0105237_10763891 | 3300009545 | Bacteria | 973 |
| 102 | Ga0105238_10000612 | 3300009551 | Bacteria | 37482 |
| 103 | Ga0105238_10041104 | 3300009551 | Bacteria | 4683 |
| 104 | Ga0105238_10095839 | 3300009551 | Bacteria | 2954 |
| 105 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 106 | Ga0105239_10000478 | 3300010375 | Bacteria | 58328 |
| 107 | Ga0105239_10001768 | 3300010375 | Bacteria | 28424 |
| 108 | Ga0105239_10093223 | 3300010375 | Bacteria | 3325 |
| 109 | Ga0105239_10095151 | 3300010375 | Bacteria | 3290 |
| 110 | Ga0105239_10102215 | 3300010375 | Bacteria | 3172 |
| 111 | Ga0105239_11081144 | 3300010375 | Bacteria | 923 |
| 112 | Ga0105246_10403941 | 3300011119 | Bacteria | 1135 |
| 113 | Ga0157373_10001788 | 3300013100 | Bacteria | 16341 |
| 114 | Ga0157373_10890341 | 3300013100 | Bacteria | 660 |
| 115 | Ga0157371_10000980 | 3300013102 | Bacteria | 31717 |
| 116 | Ga0157371_10001492 | 3300013102 | Bacteria | 24223 |
| 117 | Ga0157371_10032084 | 3300013102 | Bacteria | 3781 |
| 118 | Ga0157370_10141317 | 3300013104 | Bacteria | 2243 |
| 119 | Ga0157370_10148868 | 3300013104 | Bacteria | 2179 |
| 120 | Ga0157370_10150447 | 3300013104 | Bacteria | 2166 |
| 121 | Ga0157370_10526055 | 3300013104 | Bacteria | 1085 |
| 122 | Ga0157369_10043369 | 3300013105 | Bacteria | 4903 |
| 123 | Ga0157369_10167980 | 3300013105 | Bacteria | 2313 |
| 124 | Ga0157369_10182552 | 3300013105 | Bacteria | 2207 |
| 125 | Ga0157374_10005433 | 3300013296 | Bacteria | 10705 |
| 126 | Ga0157374_10064857 | 3300013296 | Bacteria | 3429 |
| 127 | Ga0157374_10661524 | 3300013296 | Bacteria | 1057 |
| 128 | Ga0157374_10681642 | 3300013296 | Bacteria | 1040 |
| 129 | Ga0157374_11005295 | 3300013296 | Bacteria | 853 |
| 130 | Ga0157374_11724643 | 3300013296 | Bacteria | 651 |
| 131 | Ga0157378_10005776 | 3300013297 | Bacteria | 10842 |
| 132 | Ga0157378_10046222 | 3300013297 | Bacteria | 3870 |
| 133 | Ga0157378_11021605 | 3300013297 | Bacteria | 862 |
| 134 | Ga0157378_12090709 | 3300013297 | Bacteria | 617 |
| 135 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 136 | Ga0163162_10005211 | 3300013306 | Bacteria | 12536 |
| 137 | Ga0163162_10199500 | 3300013306 | Bacteria | 2129 |
| 138 | Ga0163162_10246746 | 3300013306 | Bacteria | 1917 |
| 139 | Ga0163162_10698749 | 3300013306 | Bacteria | 1136 |
| 140 | Ga0163162_11198316 | 3300013306 | Bacteria | 862 |
| 141 | Ga0157372_10000190 | 3300013307 | Bacteria | 67909 |
| 142 | Ga0157372_10000514 | 3300013307 | Bacteria | 42626 |
| 143 | Ga0157372_10001572 | 3300013307 | Bacteria | 24881 |
| 144 | Ga0157372_10333814 | 3300013307 | Bacteria | 1766 |
| 145 | Ga0157375_10001485 | 3300013308 | Bacteria | 20130 |
| 146 | Ga0157375_10184168 | 3300013308 | Bacteria | 2241 |
| 147 | Ga0157377_10035133 | 3300014745 | Bacteria | 2747 |
| 148 | Ga0157376_10014265 | 3300014969 | Bacteria | 5958 |
| 149 | Ga0157376_12407194 | 3300014969 | Bacteria | 566 |
| 150 | Ga0157376_12830664 | 3300014969 | Bacteria | 525 |
| 151 | Ga0163161_10004399 | 3300017792 | Bacteria | 9830 |
| 152 | Ga0163161_10018221 | 3300017792 | Bacteria | 4922 |
| 153 | Ga0163161_10184826 | 3300017792 | Bacteria | 1600 |
| 154 | Ga0206351_10021648 | 3300020077 | Bacteria | 1387 |
| 155 | Ga0206351_10817434 | 3300020077 | Bacteria | 1981 |
| 156 | Ga0206352_10388625 | 3300020078 | Bacteria | 1113 |
| 157 | Ga0206352_11210880 | 3300020078 | Bacteria | 566 |
| 158 | Ga0206350_10699165 | 3300020080 | Bacteria | 1395 |
| 159 | Ga0206350_10699293 | 3300020080 | Bacteria | 808 |
| 160 | Ga0154015_1629078 | 3300020610 | Bacteria | 1176 |
| 161 | Ga0224712_10045119 | 3300022467 | Bacteria | 1685 |
| 162 | Ga0207427_100131 | 3300025231 | Bacteria | 93947 |
| 163 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 164 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 165 | Ga0209026_1000683 | 3300025250 | Bacteria | 20446 |
| 166 | Ga0209026_1001195 | 3300025250 | Bacteria | 12026 |
| 167 | Ga0209026_1004230 | 3300025250 | Bacteria | 4364 |
| 168 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 169 | Ga0209233_1000520 | 3300025261 | Bacteria | 22249 |
| 170 | Ga0207647_10000588 | 3300025904 | Bacteria | 28282 |
| 171 | Ga0207647_10056191 | 3300025904 | Bacteria | 2415 |
| 172 | Ga0207647_10104328 | 3300025904 | Bacteria | 1680 |
| 173 | Ga0207645_10000948 | 3300025907 | Bacteria | 24090 |
| 174 | Ga0207705_10000233 | 3300025909 | Bacteria | 55125 |
| 175 | Ga0207705_10056329 | 3300025909 | Bacteria | 2834 |
| 176 | Ga0207705_10317057 | 3300025909 | Bacteria | 1198 |
| 177 | Ga0207705_10843041 | 3300025909 | Bacteria | 711 |
| 178 | Ga0207654_10010794 | 3300025911 | Bacteria | 4650 |
| 179 | Ga0207654_10078930 | 3300025911 | Bacteria | 1976 |
| 180 | Ga0207654_10242851 | 3300025911 | Bacteria | 1204 |
| 181 | Ga0207707_11046396 | 3300025912 | Bacteria | 668 |
| 182 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 183 | Ga0207695_10131124 | 3300025913 | Bacteria | 2464 |
| 184 | Ga0207695_10353305 | 3300025913 | Bacteria | 1357 |
| 185 | Ga0207695_10823200 | 3300025913 | Bacteria | 808 |
| 186 | Ga0207695_11590337 | 3300025913 | Bacteria | 534 |
| 187 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 188 | Ga0207671_10002963 | 3300025914 | Bacteria | 17464 |
| 189 | Ga0207671_10003169 | 3300025914 | Bacteria | 16617 |
| 190 | Ga0207671_10013990 | 3300025914 | Bacteria | 6365 |
| 191 | Ga0207671_10176063 | 3300025914 | Bacteria | 1663 |
| 192 | Ga0207671_10347932 | 3300025914 | Bacteria | 1175 |
| 193 | Ga0207671_11289707 | 3300025914 | Bacteria | 569 |
| 194 | Ga0207671_11303836 | 3300025914 | Bacteria | 565 |
| 195 | Ga0207657_10011218 | 3300025919 | Bacteria | 8909 |
| 196 | Ga0207657_10195182 | 3300025919 | Bacteria | 1631 |
| 197 | Ga0207649_10384680 | 3300025920 | Bacteria | 1046 |
| 198 | Ga0207652_10079435 | 3300025921 | Bacteria | 2866 |
| 199 | Ga0207694_10082126 | 3300025924 | Bacteria | 2533 |
| 200 | Ga0207694_10256314 | 3300025924 | Bacteria | 1432 |
| 201 | Ga0207644_11537905 | 3300025931 | Unclassified | 558 |
| 202 | Ga0207690_10000744 | 3300025932 | Bacteria | 21044 |
| 203 | Ga0207690_10012764 | 3300025932 | Bacteria | 5034 |
| 204 | Ga0207686_10040466 | 3300025934 | Bacteria | 2834 |
| 205 | Ga0207709_10040688 | 3300025935 | Bacteria | 2784 |
| 206 | Ga0207704_10000015 | 3300025938 | Bacteria | 163572 |
| 207 | Ga0207667_10000496 | 3300025949 | Bacteria | 51954 |
| 208 | Ga0207667_10028165 | 3300025949 | Bacteria | 6103 |
| 209 | Ga0207667_10034518 | 3300025949 | Bacteria | 5431 |
| 210 | Ga0207667_10339102 | 3300025949 | Bacteria | 1534 |
| 211 | Ga0207667_11336993 | 3300025949 | Bacteria | 692 |
| 212 | Ga0207651_10093988 | 3300025960 | Bacteria | 2203 |
| 213 | Ga0207651_11452749 | 3300025960 | Bacteria | 617 |
| 214 | Ga0207640_10378750 | 3300025981 | Bacteria | 1146 |
| 215 | Ga0207640_11840890 | 3300025981 | Bacteria | 547 |
| 216 | Ga0207703_11406916 | 3300026035 | Bacteria | 671 |
| 217 | Ga0207639_10052510 | 3300026041 | Bacteria | 3106 |
| 218 | Ga0207639_10077515 | 3300026041 | Bacteria | 2620 |
| 219 | Ga0207639_10090973 | 3300026041 | Bacteria | 2442 |
| 220 | Ga0207678_10008440 | 3300026067 | Bacteria | 9086 |
| 221 | Ga0207702_10000195 | 3300026078 | Bacteria | 71757 |
| 222 | Ga0207702_10011030 | 3300026078 | Bacteria | 7541 |
| 223 | Ga0207702_10019399 | 3300026078 | Bacteria | 5626 |
| 224 | Ga0207702_10398091 | 3300026078 | Bacteria | 1327 |
| 225 | Ga0207648_10001141 | 3300026089 | Bacteria | 29844 |
| 226 | Ga0207674_10091146 | 3300026116 | Bacteria | 3039 |
| 227 | Ga0207674_10387652 | 3300026116 | Bacteria | 1351 |
| 228 | Ga0207683_10008935 | 3300026121 | Bacteria | 8536 |
| 229 | Ga0207698_10026325 | 3300026142 | Bacteria | 4113 |
| 230 | Ga0207698_10094539 | 3300026142 | Bacteria | 2458 |
| 231 | Ga0207698_12331910 | 3300026142 | Unclassified | 547 |
| 232 | Ga0268266_10000268 | 3300028379 | Bacteria | 85976 |
| 233 | Ga0307515_10001810 | 3300028794 | Bacteria | 47689 |
| 234 | Ga0307515_10004229 | 3300028794 | Bacteria | 29830 |
| 235 | Ga0307515_10301020 | 3300028794 | Bacteria | 1289 |
| 236 | Ga0265338_10039381 | 3300028800 | Bacteria | 4459 |
| 237 | Ga0307513_10804710 | 3300031456 | Bacteria | 646 |
| 238 | Ga0307414_10206749 | 3300032004 | Bacteria | 1601 |
| 239 | Ga0307414_10310805 | 3300032004 | Bacteria | 1337 |
| 240 | Ga0307507_10002394 | 3300033179 | Bacteria | 39588 |
| 241 | Ga0307510_10138221 | 3300033180 | Bacteria | 2088 |
| 242 | Ga0373941_0043379 | 3300035115 | Bacteria | 1400 |
| 243 | Ga0373925_1376384 | 3300037068 | Bacteria | 578 |
| 244 | Ga0395899_0000325 | 3300037312 | Bacteria | 60438 |
| 245 | Ga0395899_0036075 | 3300037312 | Bacteria | 3711 |
| 246 | Ga0395900_0002139 | 3300037418 | Bacteria | 22114 |
| 247 | Ga0395900_0025254 | 3300037418 | Bacteria | 6082 |
| 248 | Ga0395898_1006911 | 3300037466 | Bacteria | 769 |
| 249 | Ga0395898_1836205 | 3300037466 | Bacteria | 527 |
| 250 | Ga0395905_0000729 | 3300037471 | Bacteria | 43376 |
| 251 | Ga0395901_0229988 | 3300038443 | Bacteria | 1936 |
| 252 | Ga0451807_0379657 | 3300041486 | Bacteria | 800 |
| 253 | Ga0466966_0027709 | 3300044684 | Bacteria | 3693 |
| 254 | Ga0466961_0069255 | 3300044693 | Bacteria | 2240 |
| 255 | Ga0466959_0035545 | 3300045049 | Bacteria | 3684 |
| 256 | Ga0466959_0042243 | 3300045049 | Bacteria | 3363 |
| 257 | Ga0495638_0093942 | 3300046460 | Bacteria | 1803 |
| 258 | Ga0495650_0000107 | 3300046471 | Bacteria | 200864 |
| 259 | Ga0495650_0201671 | 3300046471 | Bacteria | 691 |
| 260 | Ga0495585_0000014 | 3300046492 | Bacteria | 187513 |
| 261 | Ga0495585_0000642 | 3300046492 | Bacteria | 32168 |
| 262 | Ga0495585_0235767 | 3300046492 | Unclassified | 918 |
| 263 | Ga0495585_0339186 | 3300046492 | Bacteria | 732 |
| 264 | Ga0495607_0210535 | 3300046501 | Bacteria | 957 |
| 265 | Ga0495583_0129263 | 3300046506 | Bacteria | 1058 |
| 266 | Ga0495606_0000303 | 3300046507 | Bacteria | 84874 |
| 267 | Ga0495606_0014733 | 3300046507 | Bacteria | 6080 |
| 268 | Ga0495606_0051681 | 3300046507 | Bacteria | 2679 |
| 269 | Ga0495606_0167624 | 3300046507 | Bacteria | 1277 |
| 270 | Ga0495610_0114807 | 3300046512 | Bacteria | 1188 |
| 271 | Ga0495616_0002195 | 3300046513 | Bacteria | 13047 |
| 272 | Ga0495616_0002783 | 3300046513 | Bacteria | 11422 |
| 273 | Ga0495631_0027770 | 3300046518 | Bacteria | 2586 |
| 274 | Ga0495632_0054300 | 3300046519 | Bacteria | 1964 |
| 275 | Ga0495648_0005349 | 3300046524 | Bacteria | 10697 |
| 276 | Ga0495648_0112598 | 3300046524 | Bacteria | 1477 |
| 277 | Ga0495652_0892458 | 3300046529 | Bacteria | 587 |
| 278 | Ga0495652_1130861 | 3300046529 | Bacteria | 507 |
| 279 | Ga0495654_0197170 | 3300046530 | Bacteria | 864 |
| 280 | Ga0495609_0007132 | 3300046538 | Bacteria | 5618 |
| 281 | Ga0495622_0221618 | 3300046557 | Bacteria | 838 |
| 282 | Ga0495633_0000026 | 3300046558 | Bacteria | 204722 |
| 283 | Ga0495633_0007761 | 3300046558 | Bacteria | 6134 |
| 284 | Ga0495668_0000054 | 3300046616 | Bacteria | 203960 |
| 285 | Ga0495668_0364074 | 3300046616 | Bacteria | 794 |
| 286 | Ga0495611_0341567 | 3300046648 | Bacteria | 687 |
| 287 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 288 | Ga0495625_0000168 | 3300046660 | Bacteria | 102626 |
| 289 | Ga0495625_0004837 | 3300046660 | Bacteria | 12573 |
| 290 | Ga0495625_0021093 | 3300046660 | Bacteria | 5021 |
| 291 | Ga0495625_0079963 | 3300046660 | Bacteria | 2278 |
| 292 | Ga0495625_0149365 | 3300046660 | Bacteria | 1572 |
| 293 | Ga0495625_0881583 | 3300046660 | Bacteria | 514 |
| 294 | Ga0495661_0013773 | 3300046665 | Bacteria | 5426 |
| 295 | Ga0495661_0017412 | 3300046665 | Bacteria | 4747 |
| 296 | Ga0495661_0045737 | 3300046665 | Bacteria | 2675 |
| 297 | Ga0495661_0129280 | 3300046665 | Bacteria | 1386 |
| 298 | Ga0495670_0144197 | 3300046691 | Bacteria | 1247 |
| 299 | Ga0495671_0093292 | 3300046692 | Bacteria | 1473 |
| 300 | Ga0495671_0165058 | 3300046692 | Bacteria | 1077 |
| 301 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 302 | Ga0495600_0112004 | 3300046809 | Bacteria | 1777 |
| 303 | Ga0495660_0008372 | 3300046810 | Bacteria | 6048 |
| 304 | Ga0495683_0105991 | 3300047323 | Bacteria | 1347 |
| 305 | Ga0495683_0138976 | 3300047323 | Bacteria | 1140 |
| 306 | Ga0495687_011247 | 3300047443 | Bacteria | 4824 |
| 307 | Ga0495679_083026 | 3300047446 | Bacteria | 907 |
| 308 | Ga0495686_0000319 | 3300047472 | Bacteria | 79929 |
| 309 | Ga0495686_0000524 | 3300047472 | Bacteria | 55256 |
| 310 | Ga0495686_0210332 | 3300047472 | Bacteria | 1112 |
| 311 | Ga0495614_0042699 | 3300048089 | Bacteria | 1944 |
| 312 | Ga0495678_013692 | 3300049459 | Bacteria | 3797 |
| 313 | Ga0495678_167743 | 3300049459 | Bacteria | 697 |
| 314 | Ga0495682_0094523 | 3300049460 | Bacteria | 1073 |
| 315 | Ga0501241_000397 | 3300049758 | Bacteria | 9529 |
| 316 | nmdc:mga0k408_100455_c1 | 3300050493 | Bacteria | 1706 |
| 317 | nmdc:mga0k408_281_c2 | 3300050493 | Bacteria | 21573 |
| 318 | nmdc:mga0k408_82_c1 | 3300050493 | Bacteria | 45008 |
| 319 | nmdc:mga0k408_96157_c1 | 3300050493 | Bacteria | 1743 |
| 320 | Ga0500635_0001757 | 3300053080 | Bacteria | 5283 |
| 321 | Ga0500608_006000 | 3300053122 | Bacteria | 4897 |
| 322 | Ga0500608_031174 | 3300053122 | Bacteria | 2529 |
| 323 | Ga0500618_000016 | 3300053125 | Bacteria | 164049 |
| 324 | Ga0500618_018612 | 3300053125 | Bacteria | 1717 |
| 325 | Ga0500564_201958 | 3300053138 | Bacteria | 816 |
| 326 | Ga0500624_001883 | 3300053157 | Bacteria | 3035 |
| 327 | Ga0587077_239903 | 3300059493 | Bacteria | 520 |
| 328 | Ga0587080_078349 | 3300059503 | Bacteria | 674 |
| 329 | Ga0587069_013753 | 3300059642 | Bacteria | 1118 |
| 330 | Ga0587076_068219 | 3300059645 | Bacteria | 732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_11969298 | Ga0105240_119692982 | 97 |
| 2 | 3300009098 | Ga0105245_13120554 | Ga0105245_131205541 | 97 |
| 3 | 3300003316 | rootH1_10106633 | rootH1_101066331 | 109 |
| 4 | 3300005366 | Ga0070659_100491576 | Ga0070659_1004915762 | 109 |
| 5 | 3300005530 | Ga0070679_100192079 | Ga0070679_1001920792 | 109 |
| 6 | 3300009093 | Ga0105240_12723484 | Ga0105240_127234842 | 109 |
| 7 | 3300009545 | Ga0105237_10133851 | Ga0105237_101338515 | 109 |
| 8 | 3300009551 | Ga0105238_10095839 | Ga0105238_100958395 | 109 |
| 9 | 3300025914 | Ga0207671_11289707 | Ga0207671_112897071 | 109 |
| 10 | 3300025921 | Ga0207652_10079435 | Ga0207652_100794353 | 109 |
| 11 | 3300025924 | Ga0207694_10082126 | Ga0207694_100821262 | 109 |
| 12 | 3300033180 | Ga0307510_10138221 | Ga0307510_101382213 | 109 |
| 13 | 3300035115 | Ga0373941_0043379 | Ga0373941_0043379_224_568 | 109 |
| 14 | 3300046507 | Ga0495606_0167624 | Ga0495606_0167624_258_602 | 109 |
| 15 | 3300046518 | Ga0495631_0027770 | Ga0495631_0027770_1842_2186 | 109 |
| 16 | 3300046519 | Ga0495632_0054300 | Ga0495632_0054300_784_1128 | 109 |
| 17 | 3300046530 | Ga0495654_0197170 | Ga0495654_0197170_236_580 | 109 |
| 18 | 3300046616 | Ga0495668_0364074 | Ga0495668_0364074_53_397 | 109 |
| 19 | 3300046660 | Ga0495625_0079963 | Ga0495625_0079963_1437_1781 | 109 |
| 20 | 3300047323 | Ga0495683_0138976 | Ga0495683_0138976_786_1130 | 109 |
| 21 | 3300053122 | Ga0500608_006000 | Ga0500608_006000_292_636 | 109 |
| 22 | 3300005327 | Ga0070658_10000060 | Ga0070658_1000006042 | 110 |
| 23 | 3300005364 | Ga0070673_101589902 | Ga0070673_1015899021 | 110 |
| 24 | 3300005539 | Ga0068853_100082987 | Ga0068853_1000829875 | 110 |
| 25 | 3300005563 | Ga0068855_100006331 | Ga0068855_10000633111 | 110 |
| 26 | 3300005614 | Ga0068856_100001959 | Ga0068856_10000195922 | 110 |
| 27 | 3300009545 | Ga0105237_10162473 | Ga0105237_101624733 | 110 |
| 28 | 3300010375 | Ga0105239_11081144 | Ga0105239_110811442 | 110 |
| 29 | 3300013296 | Ga0157374_10005433 | Ga0157374_1000543312 | 110 |
| 30 | 3300013297 | Ga0157378_10005776 | Ga0157378_100057764 | 110 |
| 31 | 3300013308 | Ga0157375_10184168 | Ga0157375_101841684 | 110 |
| 32 | 3300025909 | Ga0207705_10000233 | Ga0207705_1000023342 | 110 |
| 33 | 3300025919 | Ga0207657_10195182 | Ga0207657_101951822 | 110 |
| 34 | 3300025949 | Ga0207667_10034518 | Ga0207667_100345186 | 110 |
| 35 | 3300025960 | Ga0207651_11452749 | Ga0207651_114527492 | 110 |
| 36 | 3300026041 | Ga0207639_10052510 | Ga0207639_100525102 | 110 |
| 37 | 3300026078 | Ga0207702_10011030 | Ga0207702_100110305 | 110 |
| 38 | 3300026142 | Ga0207698_12331910 | Ga0207698_123319101 | 110 |
| 39 | 3300037312 | Ga0395899_0036075 | Ga0395899_0036075_2439_2783 | 110 |
| 40 | 3300037418 | Ga0395900_0025254 | Ga0395900_0025254_3578_3922 | 110 |
| 41 | 3300037466 | Ga0395898_1836205 | Ga0395898_1836205_141_485 | 110 |
| 42 | 3300037471 | Ga0395905_0000729 | Ga0395905_0000729_31906_32250 | 110 |
| 43 | 3300045049 | Ga0466959_0035545 | Ga0466959_0035545_2681_3028 | 110 |
| 44 | iso_pu_bacteria | 2919437846 | 2919440281 | 110 |
| 45 | 3300009174 | Ga0105241_10347111 | Ga0105241_103471112 | 111 |
| 46 | 3300025911 | Ga0207654_10242851 | Ga0207654_102428512 | 111 |
| 47 | 3300046492 | Ga0495585_0235767 | Ga0495585_0235767_47_397 | 111 |
| 48 | 3300001979 | JGI24740J21852_10048624 | JGI24740J21852_100486241 | 112 |
| 49 | 3300001989 | JGI24739J22299_10116219 | JGI24739J22299_101162192 | 112 |
| 50 | 3300001990 | JGI24737J22298_10000384 | JGI24737J22298_1000038411 | 112 |
| 51 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003100 | 112 |
| 52 | 3300005288 | Ga0065714_10010554 | Ga0065714_100105542 | 112 |
| 53 | 3300005563 | Ga0068855_100387626 | Ga0068855_1003876262 | 112 |
| 54 | 3300005577 | Ga0068857_100078838 | Ga0068857_1000788382 | 112 |
| 55 | 3300005577 | Ga0068857_101267022 | Ga0068857_1012670222 | 112 |
| 56 | 3300006195 | Ga0075366_10010527 | Ga0075366_100105273 | 112 |
| 57 | 3300006353 | Ga0075370_10740826 | Ga0075370_107408262 | 112 |
| 58 | 3300009093 | Ga0105240_10000371 | Ga0105240_1000037151 | 112 |
| 59 | 3300009174 | Ga0105241_10000733 | Ga0105241_100007334 | 112 |
| 60 | 3300009545 | Ga0105237_10000632 | Ga0105237_1000063214 | 112 |
| 61 | 3300009545 | Ga0105237_10003574 | Ga0105237_1000357419 | 112 |
| 62 | 3300010375 | Ga0105239_10001768 | Ga0105239_100017682 | 112 |
| 63 | 3300010375 | Ga0105239_10093223 | Ga0105239_100932234 | 112 |
| 64 | 3300013102 | Ga0157371_10032084 | Ga0157371_100320842 | 112 |
| 65 | 3300013104 | Ga0157370_10141317 | Ga0157370_101413173 | 112 |
| 66 | 3300013105 | Ga0157369_10167980 | Ga0157369_101679803 | 112 |
| 67 | 3300013105 | Ga0157369_10182552 | Ga0157369_101825522 | 112 |
| 68 | 3300013296 | Ga0157374_11005295 | Ga0157374_110052952 | 112 |
| 69 | 3300013306 | Ga0163162_10199500 | Ga0163162_101995004 | 112 |
| 70 | 3300013307 | Ga0157372_10000514 | Ga0157372_100005149 | 112 |
| 71 | 3300013307 | Ga0157372_10333814 | Ga0157372_103338142 | 112 |
| 72 | 3300014969 | Ga0157376_12830664 | Ga0157376_128306641 | 112 |
| 73 | 3300020077 | Ga0206351_10021648 | Ga0206351_100216482 | 112 |
| 74 | 3300020078 | Ga0206352_10388625 | Ga0206352_103886252 | 112 |
| 75 | 3300020080 | Ga0206350_10699165 | Ga0206350_106991652 | 112 |
| 76 | 3300020610 | Ga0154015_1629078 | Ga0154015_16290782 | 112 |
| 77 | 3300025261 | Ga0209233_1000520 | Ga0209233_10005208 | 112 |
| 78 | 3300025904 | Ga0207647_10104328 | Ga0207647_101043282 | 112 |
| 79 | 3300025911 | Ga0207654_10010794 | Ga0207654_100107942 | 112 |
| 80 | 3300025913 | Ga0207695_10000142 | Ga0207695_1000014232 | 112 |
| 81 | 3300025914 | Ga0207671_10000110 | Ga0207671_1000011012 | 112 |
| 82 | 3300025914 | Ga0207671_10002963 | Ga0207671_100029634 | 112 |
| 83 | 3300025949 | Ga0207667_10339102 | Ga0207667_103391022 | 112 |
| 84 | 3300026116 | Ga0207674_10387652 | Ga0207674_103876521 | 112 |
| 85 | 3300046492 | Ga0495585_0339186 | Ga0495585_0339186_62_412 | 112 |
| 86 | 3300046506 | Ga0495583_0129263 | Ga0495583_0129263_515_856 | 112 |
| 87 | 3300046665 | Ga0495661_0017412 | Ga0495661_0017412_2344_2685 | 112 |
| 88 | 3300050493 | nmdc:mga0k408_100455_c1 | nmdc:mga0k408_100455_c1_517_855 | 112 |
| 89 | 3300001990 | JGI24737J22298_10012680 | JGI24737J22298_100126805 | 113 |
| 90 | 3300001991 | JGI24743J22301_10037524 | JGI24743J22301_100375242 | 113 |
| 91 | 3300002067 | JGI24735J21928_10009809 | JGI24735J21928_100098092 | 113 |
| 92 | 3300002077 | JGI24744J21845_10000638 | JGI24744J21845_100006386 | 113 |
| 93 | 3300003316 | rootH1_10019188 | rootH1_1001918828 | 113 |
| 94 | 3300003320 | rootH2_10231543 | rootH2_102315431 | 113 |
| 95 | 3300003322 | rootL2_10258214 | rootL2_102582142 | 113 |
| 96 | 3300003323 | rootH1_10093014 | rootH1_100930144 | 113 |
| 97 | 3300005327 | Ga0070658_10310660 | Ga0070658_103106602 | 113 |
| 98 | 3300005328 | Ga0070676_10000152 | Ga0070676_1000015219 | 113 |
| 99 | 3300005344 | Ga0070661_100354147 | Ga0070661_1003541471 | 113 |
| 100 | 3300005354 | Ga0070675_100308019 | Ga0070675_1003080193 | 113 |
| 101 | 3300005355 | Ga0070671_101307564 | Ga0070671_1013075642 | 113 |
| 102 | 3300005364 | Ga0070673_100012956 | Ga0070673_1000129569 | 113 |
| 103 | 3300005459 | Ga0068867_100002522 | Ga0068867_1000025222 | 113 |
| 104 | 3300005548 | Ga0070665_100000264 | Ga0070665_10000026455 | 113 |
| 105 | 3300005563 | Ga0068855_102433869 | Ga0068855_1024338692 | 113 |
| 106 | 3300005577 | Ga0068857_100045573 | Ga0068857_1000455734 | 113 |
| 107 | 3300005577 | Ga0068857_102078812 | Ga0068857_1020788122 | 113 |
| 108 | 3300005578 | Ga0068854_100582804 | Ga0068854_1005828042 | 113 |
| 109 | 3300005616 | Ga0068852_100000389 | Ga0068852_10000038922 | 113 |
| 110 | 3300005718 | Ga0068866_10096118 | Ga0068866_100961182 | 113 |
| 111 | 3300006195 | Ga0075366_10000344 | Ga0075366_1000034420 | 113 |
| 112 | 3300006195 | Ga0075366_10000422 | Ga0075366_1000042214 | 113 |
| 113 | 3300006237 | Ga0097621_100000232 | Ga0097621_10000023227 | 113 |
| 114 | 3300006358 | Ga0068871_100000800 | Ga0068871_1000008009 | 113 |
| 115 | 3300006881 | Ga0068865_100003071 | Ga0068865_1000030715 | 113 |
| 116 | 3300009148 | Ga0105243_10036187 | Ga0105243_100361875 | 113 |
| 117 | 3300009174 | Ga0105241_10060036 | Ga0105241_100600364 | 113 |
| 118 | 3300009176 | Ga0105242_10261405 | Ga0105242_102614052 | 113 |
| 119 | 3300009177 | Ga0105248_10393866 | Ga0105248_103938662 | 113 |
| 120 | 3300009545 | Ga0105237_10000535 | Ga0105237_1000053520 | 113 |
| 121 | 3300009545 | Ga0105237_10220070 | Ga0105237_102200702 | 113 |
| 122 | 3300009551 | Ga0105238_10000612 | Ga0105238_1000061214 | 113 |
| 123 | 3300010375 | Ga0105239_10095151 | Ga0105239_100951515 | 113 |
| 124 | 3300011119 | Ga0105246_10403941 | Ga0105246_104039412 | 113 |
| 125 | 3300013100 | Ga0157373_10890341 | Ga0157373_108903412 | 113 |
| 126 | 3300013102 | Ga0157371_10000980 | Ga0157371_100009809 | 113 |
| 127 | 3300013104 | Ga0157370_10148868 | Ga0157370_101488684 | 113 |
| 128 | 3300013104 | Ga0157370_10526055 | Ga0157370_105260552 | 113 |
| 129 | 3300013296 | Ga0157374_10064857 | Ga0157374_100648572 | 113 |
| 130 | 3300013296 | Ga0157374_10681642 | Ga0157374_106816422 | 113 |
| 131 | 3300013297 | Ga0157378_11021605 | Ga0157378_110216052 | 113 |
| 132 | 3300013306 | Ga0163162_10000008 | Ga0163162_10000008112 | 113 |
| 133 | 3300013306 | Ga0163162_11198316 | Ga0163162_111983162 | 113 |
| 134 | 3300013307 | Ga0157372_10001572 | Ga0157372_1000157221 | 113 |
| 135 | 3300013308 | Ga0157375_10001485 | Ga0157375_100014852 | 113 |
| 136 | 3300014745 | Ga0157377_10035133 | Ga0157377_100351334 | 113 |
| 137 | 3300014969 | Ga0157376_10014265 | Ga0157376_100142657 | 113 |
| 138 | 3300017792 | Ga0163161_10004399 | Ga0163161_100043996 | 113 |
| 139 | 3300017792 | Ga0163161_10184826 | Ga0163161_101848263 | 113 |
| 140 | 3300025904 | Ga0207647_10000588 | Ga0207647_1000058813 | 113 |
| 141 | 3300025904 | Ga0207647_10056191 | Ga0207647_100561912 | 113 |
| 142 | 3300025907 | Ga0207645_10000948 | Ga0207645_1000094815 | 113 |
| 143 | 3300025909 | Ga0207705_10056329 | Ga0207705_100563294 | 113 |
| 144 | 3300025909 | Ga0207705_10317057 | Ga0207705_103170572 | 113 |
| 145 | 3300025911 | Ga0207654_10078930 | Ga0207654_100789303 | 113 |
| 146 | 3300025914 | Ga0207671_10013990 | Ga0207671_100139907 | 113 |
| 147 | 3300025914 | Ga0207671_10176063 | Ga0207671_101760632 | 113 |
| 148 | 3300025920 | Ga0207649_10384680 | Ga0207649_103846802 | 113 |
| 149 | 3300025924 | Ga0207694_10256314 | Ga0207694_102563142 | 113 |
| 150 | 3300025931 | Ga0207644_11537905 | Ga0207644_115379051 | 113 |
| 151 | 3300025934 | Ga0207686_10040466 | Ga0207686_100404662 | 113 |
| 152 | 3300025935 | Ga0207709_10040688 | Ga0207709_100406886 | 113 |
| 153 | 3300025938 | Ga0207704_10000015 | Ga0207704_10000015127 | 113 |
| 154 | 3300025949 | Ga0207667_11336993 | Ga0207667_113369932 | 113 |
| 155 | 3300025960 | Ga0207651_10093988 | Ga0207651_100939882 | 113 |
| 156 | 3300025981 | Ga0207640_11840890 | Ga0207640_118408901 | 113 |
| 157 | 3300026041 | Ga0207639_10077515 | Ga0207639_100775152 | 113 |
| 158 | 3300026089 | Ga0207648_10001141 | Ga0207648_1000114123 | 113 |
| 159 | 3300026116 | Ga0207674_10091146 | Ga0207674_100911463 | 113 |
| 160 | 3300026121 | Ga0207683_10008935 | Ga0207683_100089356 | 113 |
| 161 | 3300026142 | Ga0207698_10026325 | Ga0207698_100263252 | 113 |
| 162 | 3300028379 | Ga0268266_10000268 | Ga0268266_1000026854 | 113 |
| 163 | 3300028794 | Ga0307515_10301020 | Ga0307515_103010202 | 113 |
| 164 | 3300032004 | Ga0307414_10206749 | Ga0307414_102067492 | 113 |
| 165 | 3300032004 | Ga0307414_10310805 | Ga0307414_103108052 | 113 |
| 166 | 3300037418 | Ga0395900_0002139 | Ga0395900_0002139_9035_9382 | 113 |
| 167 | 3300046492 | Ga0495585_0000014 | Ga0495585_0000014_3907_4248 | 113 |
| 168 | 3300046529 | Ga0495652_0892458 | Ga0495652_0892458_60_401 | 113 |
| 169 | 3300046648 | Ga0495611_0341567 | Ga0495611_0341567_229_570 | 113 |
| 170 | 3300046660 | Ga0495625_0000168 | Ga0495625_0000168_101415_101756 | 113 |
| 171 | 3300046660 | Ga0495625_0021093 | Ga0495625_0021093_4575_4916 | 113 |
| 172 | 3300047443 | Ga0495687_011247 | Ga0495687_011247_3216_3557 | 113 |
| 173 | 3300047472 | Ga0495686_0000319 | Ga0495686_0000319_37618_37965 | 113 |
| 174 | 3300049758 | Ga0501241_000397 | Ga0501241_000397_351_707 | 113 |
| 175 | 3300050493 | nmdc:mga0k408_281_c2 | nmdc:mga0k408_281_c2_17657_17998 | 113 |
| 176 | 3300050493 | nmdc:mga0k408_82_c1 | nmdc:mga0k408_82_c1_40711_41052 | 113 |
| 177 | 3300059493 | Ga0587077_239903 | Ga0587077_239903_86_436 | 113 |
| 178 | 3300059503 | Ga0587080_078349 | Ga0587080_078349_304_651 | 113 |
| 179 | 3300059642 | Ga0587069_013753 | Ga0587069_013753_346_693 | 113 |
| 180 | 3300002737 | JGI25162J39368_1000203 | JGI25162J39368_100020350 | 114 |
| 181 | 3300002741 | JGI25157J39369_1010744 | JGI25157J39369_10107442 | 114 |
| 182 | 3300005288 | Ga0065714_10101155 | Ga0065714_101011552 | 114 |
| 183 | 3300005341 | Ga0070691_10840564 | Ga0070691_108405642 | 114 |
| 184 | 3300005366 | Ga0070659_100004824 | Ga0070659_1000048245 | 114 |
| 185 | 3300005458 | Ga0070681_11240059 | Ga0070681_112400591 | 114 |
| 186 | 3300005563 | Ga0068855_100177835 | Ga0068855_1001778353 | 114 |
| 187 | 3300005563 | Ga0068855_102232474 | Ga0068855_1022324742 | 114 |
| 188 | 3300005578 | Ga0068854_100447894 | Ga0068854_1004478942 | 114 |
| 189 | 3300005614 | Ga0068856_100000120 | Ga0068856_10000012049 | 114 |
| 190 | 3300005614 | Ga0068856_100028099 | Ga0068856_1000280997 | 114 |
| 191 | 3300005614 | Ga0068856_100180532 | Ga0068856_1001805323 | 114 |
| 192 | 3300005616 | Ga0068852_100121752 | Ga0068852_1001217523 | 114 |
| 193 | 3300006195 | Ga0075366_10256889 | Ga0075366_102568892 | 114 |
| 194 | 3300006237 | Ga0097621_101065151 | Ga0097621_1010651512 | 114 |
| 195 | 3300009093 | Ga0105240_10249145 | Ga0105240_102491452 | 114 |
| 196 | 3300009093 | Ga0105240_10574295 | Ga0105240_105742952 | 114 |
| 197 | 3300009093 | Ga0105240_11068917 | Ga0105240_110689172 | 114 |
| 198 | 3300009093 | Ga0105240_11414399 | Ga0105240_114143991 | 114 |
| 199 | 3300009174 | Ga0105241_10840212 | Ga0105241_108402122 | 114 |
| 200 | 3300009176 | Ga0105242_13189428 | Ga0105242_131894282 | 114 |
| 201 | 3300009545 | Ga0105237_10002670 | Ga0105237_100026704 | 114 |
| 202 | 3300009545 | Ga0105237_10404062 | Ga0105237_104040622 | 114 |
| 203 | 3300009551 | Ga0105238_10041104 | Ga0105238_100411044 | 114 |
| 204 | 3300010375 | Ga0105239_10000009 | Ga0105239_10000009257 | 114 |
| 205 | 3300010375 | Ga0105239_10000478 | Ga0105239_100004782 | 114 |
| 206 | 3300010375 | Ga0105239_10102215 | Ga0105239_101022154 | 114 |
| 207 | 3300013296 | Ga0157374_11724643 | Ga0157374_117246432 | 114 |
| 208 | 3300013297 | Ga0157378_12090709 | Ga0157378_120907092 | 114 |
| 209 | 3300013306 | Ga0163162_10005211 | Ga0163162_100052119 | 114 |
| 210 | 3300013306 | Ga0163162_10246746 | Ga0163162_102467463 | 114 |
| 211 | 3300013306 | Ga0163162_10698749 | Ga0163162_106987492 | 114 |
| 212 | 3300014969 | Ga0157376_12407194 | Ga0157376_124071941 | 114 |
| 213 | 3300017792 | Ga0163161_10018221 | Ga0163161_100182216 | 114 |
| 214 | 3300025233 | Ga0209437_100102 | Ga0209437_10010213 | 114 |
| 215 | 3300025250 | Ga0209026_1000683 | Ga0209026_100068313 | 114 |
| 216 | 3300025912 | Ga0207707_11046396 | Ga0207707_110463961 | 114 |
| 217 | 3300025913 | Ga0207695_10131124 | Ga0207695_101311241 | 114 |
| 218 | 3300025913 | Ga0207695_10353305 | Ga0207695_103533052 | 114 |
| 219 | 3300025913 | Ga0207695_11590337 | Ga0207695_115903372 | 114 |
| 220 | 3300025914 | Ga0207671_10003169 | Ga0207671_1000316913 | 114 |
| 221 | 3300025914 | Ga0207671_10347932 | Ga0207671_103479322 | 114 |
| 222 | 3300025932 | Ga0207690_10012764 | Ga0207690_100127648 | 114 |
| 223 | 3300025949 | Ga0207667_10028165 | Ga0207667_100281656 | 114 |
| 224 | 3300025981 | Ga0207640_10378750 | Ga0207640_103787502 | 114 |
| 225 | 3300026035 | Ga0207703_11406916 | Ga0207703_114069162 | 114 |
| 226 | 3300026078 | Ga0207702_10000195 | Ga0207702_1000019521 | 114 |
| 227 | 3300026078 | Ga0207702_10019399 | Ga0207702_100193993 | 114 |
| 228 | 3300026078 | Ga0207702_10398091 | Ga0207702_103980911 | 114 |
| 229 | 3300026142 | Ga0207698_10094539 | Ga0207698_100945393 | 114 |
| 230 | 3300028794 | Ga0307515_10001810 | Ga0307515_1000181010 | 114 |
| 231 | 3300028794 | Ga0307515_10004229 | Ga0307515_1000422919 | 114 |
| 232 | 3300031456 | Ga0307513_10804710 | Ga0307513_108047102 | 114 |
| 233 | 3300033179 | Ga0307507_10002394 | Ga0307507_1000239423 | 114 |
| 234 | 3300037068 | Ga0373925_1376384 | Ga0373925_1376384_201_545 | 114 |
| 235 | 3300037466 | Ga0395898_1006911 | Ga0395898_1006911_321_677 | 114 |
| 236 | 3300038443 | Ga0395901_0229988 | Ga0395901_0229988_223_579 | 114 |
| 237 | 3300041486 | Ga0451807_0379657 | Ga0451807_0379657_176_589 | 114 |
| 238 | 3300046460 | Ga0495638_0093942 | Ga0495638_0093942_784_1128 | 114 |
| 239 | 3300046471 | Ga0495650_0201671 | Ga0495650_0201671_175_519 | 114 |
| 240 | 3300046492 | Ga0495585_0000642 | Ga0495585_0000642_12204_12548 | 114 |
| 241 | 3300046501 | Ga0495607_0210535 | Ga0495607_0210535_363_707 | 114 |
| 242 | 3300046507 | Ga0495606_0051681 | Ga0495606_0051681_775_1167 | 114 |
| 243 | 3300046513 | Ga0495616_0002783 | Ga0495616_0002783_6559_6903 | 114 |
| 244 | 3300046524 | Ga0495648_0005349 | Ga0495648_0005349_7299_7643 | 114 |
| 245 | 3300046524 | Ga0495648_0112598 | Ga0495648_0112598_405_749 | 114 |
| 246 | 3300046529 | Ga0495652_1130861 | Ga0495652_1130861_88_480 | 114 |
| 247 | 3300046538 | Ga0495609_0007132 | Ga0495609_0007132_756_1100 | 114 |
| 248 | 3300046557 | Ga0495622_0221618 | Ga0495622_0221618_286_630 | 114 |
| 249 | 3300046558 | Ga0495633_0000026 | Ga0495633_0000026_104285_104629 | 114 |
| 250 | 3300046616 | Ga0495668_0000054 | Ga0495668_0000054_74472_74816 | 114 |
| 251 | 3300046660 | Ga0495625_0004837 | Ga0495625_0004837_11522_11866 | 114 |
| 252 | 3300046660 | Ga0495625_0149365 | Ga0495625_0149365_960_1313 | 114 |
| 253 | 3300046660 | Ga0495625_0881583 | Ga0495625_0881583_61_405 | 114 |
| 254 | 3300046665 | Ga0495661_0129280 | Ga0495661_0129280_754_1098 | 114 |
| 255 | 3300046691 | Ga0495670_0144197 | Ga0495670_0144197_816_1160 | 114 |
| 256 | 3300046692 | Ga0495671_0093292 | Ga0495671_0093292_1016_1360 | 114 |
| 257 | 3300046809 | Ga0495600_0112004 | Ga0495600_0112004_522_866 | 114 |
| 258 | 3300047472 | Ga0495686_0000524 | Ga0495686_0000524_51783_52127 | 114 |
| 259 | 3300047472 | Ga0495686_0210332 | Ga0495686_0210332_318_662 | 114 |
| 260 | 3300048089 | Ga0495614_0042699 | Ga0495614_0042699_102_446 | 114 |
| 261 | 3300049459 | Ga0495678_013692 | Ga0495678_013692_2690_3034 | 114 |
| 262 | 3300049459 | Ga0495678_167743 | Ga0495678_167743_90_434 | 114 |
| 263 | 3300049460 | Ga0495682_0094523 | Ga0495682_0094523_617_961 | 114 |
| 264 | 3300050493 | nmdc:mga0k408_96157_c1 | nmdc:mga0k408_96157_c1_928_1281 | 114 |
| 265 | 3300053080 | Ga0500635_0001757 | Ga0500635_0001757_1357_1704 | 114 |
| 266 | 3300053122 | Ga0500608_031174 | Ga0500608_031174_113_457 | 114 |
| 267 | 3300053125 | Ga0500618_000016 | Ga0500618_000016_108919_109263 | 114 |
| 268 | 3300053138 | Ga0500564_201958 | Ga0500564_201958_342_686 | 114 |
| 269 | 3300053157 | Ga0500624_001883 | Ga0500624_001883_85_429 | 114 |
| 270 | 3300059645 | Ga0587076_068219 | Ga0587076_068219_74_427 | 114 |
| 271 | 3300003323 | rootH1_10213025 | rootH1_102130252 | 115 |
| 272 | 3300005327 | Ga0070658_11122233 | Ga0070658_111222331 | 115 |
| 273 | 3300005339 | Ga0070660_100003098 | Ga0070660_1000030989 | 115 |
| 274 | 3300005366 | Ga0070659_100000199 | Ga0070659_10000019914 | 115 |
| 275 | 3300005563 | Ga0068855_100000149 | Ga0068855_10000014927 | 115 |
| 276 | 3300005563 | Ga0068855_100911502 | Ga0068855_1009115022 | 115 |
| 277 | 3300009545 | Ga0105237_10763891 | Ga0105237_107638912 | 115 |
| 278 | 3300013296 | Ga0157374_10661524 | Ga0157374_106615242 | 115 |
| 279 | 3300013297 | Ga0157378_10046222 | Ga0157378_100462227 | 115 |
| 280 | 3300025909 | Ga0207705_10843041 | Ga0207705_108430411 | 115 |
| 281 | 3300025914 | Ga0207671_11303836 | Ga0207671_113038362 | 115 |
| 282 | 3300025919 | Ga0207657_10011218 | Ga0207657_100112187 | 115 |
| 283 | 3300025932 | Ga0207690_10000744 | Ga0207690_100007447 | 115 |
| 284 | 3300025949 | Ga0207667_10000496 | Ga0207667_1000049626 | 115 |
| 285 | 3300026041 | Ga0207639_10090973 | Ga0207639_100909733 | 115 |
| 286 | 3300028800 | Ga0265338_10039381 | Ga0265338_100393814 | 115 |
| 287 | 3300046471 | Ga0495650_0000107 | Ga0495650_0000107_138571_138918 | 115 |
| 288 | 3300046507 | Ga0495606_0000303 | Ga0495606_0000303_45992_46339 | 115 |
| 289 | 3300046507 | Ga0495606_0014733 | Ga0495606_0014733_619_966 | 115 |
| 290 | 3300046512 | Ga0495610_0114807 | Ga0495610_0114807_175_522 | 115 |
| 291 | 3300046513 | Ga0495616_0002195 | Ga0495616_0002195_6772_7119 | 115 |
| 292 | 3300046558 | Ga0495633_0007761 | Ga0495633_0007761_3858_4205 | 115 |
| 293 | 3300046660 | Ga0495625_0000021 | Ga0495625_0000021_85389_85736 | 115 |
| 294 | 3300046665 | Ga0495661_0013773 | Ga0495661_0013773_4405_4752 | 115 |
| 295 | 3300046665 | Ga0495661_0045737 | Ga0495661_0045737_1905_2252 | 115 |
| 296 | 3300046692 | Ga0495671_0165058 | Ga0495671_0165058_310_657 | 115 |
| 297 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_373791_374138 | 115 |
| 298 | 3300046810 | Ga0495660_0008372 | Ga0495660_0008372_2578_2925 | 115 |
| 299 | 3300047323 | Ga0495683_0105991 | Ga0495683_0105991_797_1144 | 115 |
| 300 | 3300047446 | Ga0495679_083026 | Ga0495679_083026_268_615 | 115 |
| 301 | 3300053125 | Ga0500618_018612 | Ga0500618_018612_161_508 | 115 |
| 302 | 3300001915 | JGI24741J21665_1013446 | JGI24741J21665_10134462 | 116 |
| 303 | 3300001979 | JGI24740J21852_10006124 | JGI24740J21852_100061247 | 116 |
| 304 | 3300002737 | JGI25162J39368_1002524 | JGI25162J39368_10025246 | 116 |
| 305 | 3300002772 | JGI25164J39214_1001000 | JGI25164J39214_10010007 | 116 |
| 306 | 3300003214 | JGI25165J46597_1001414 | JGI25165J46597_10014148 | 116 |
| 307 | 3300003323 | rootH1_10004106 | rootH1_1000410636 | 116 |
| 308 | 3300005327 | Ga0070658_10121439 | Ga0070658_101214394 | 116 |
| 309 | 3300005455 | Ga0070663_100022902 | Ga0070663_1000229026 | 116 |
| 310 | 3300005535 | Ga0070684_100030112 | Ga0070684_1000301124 | 116 |
| 311 | 3300009093 | Ga0105240_10403516 | Ga0105240_104035162 | 116 |
| 312 | 3300013100 | Ga0157373_10001788 | Ga0157373_100017882 | 116 |
| 313 | 3300013102 | Ga0157371_10001492 | Ga0157371_1000149219 | 116 |
| 314 | 3300013104 | Ga0157370_10150447 | Ga0157370_101504474 | 116 |
| 315 | 3300013105 | Ga0157369_10043369 | Ga0157369_100433692 | 116 |
| 316 | 3300013307 | Ga0157372_10000190 | Ga0157372_1000019045 | 116 |
| 317 | 3300020077 | Ga0206351_10817434 | Ga0206351_108174344 | 116 |
| 318 | 3300020078 | Ga0206352_11210880 | Ga0206352_112108801 | 116 |
| 319 | 3300020080 | Ga0206350_10699293 | Ga0206350_106992932 | 116 |
| 320 | 3300022467 | Ga0224712_10045119 | Ga0224712_100451192 | 116 |
| 321 | 3300025231 | Ga0207427_100131 | Ga0207427_10013140 | 116 |
| 322 | 3300025233 | Ga0209437_100048 | Ga0209437_10004870 | 116 |
| 323 | 3300025250 | Ga0209026_1001195 | Ga0209026_10011953 | 116 |
| 324 | 3300025250 | Ga0209026_1004230 | Ga0209026_10042305 | 116 |
| 325 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029307 | 116 |
| 326 | 3300025913 | Ga0207695_10823200 | Ga0207695_108232002 | 116 |
| 327 | 3300026067 | Ga0207678_10008440 | Ga0207678_100084404 | 116 |
| 328 | 3300037312 | Ga0395899_0000325 | Ga0395899_0000325_44624_44974 | 116 |
| 329 | 3300044684 | Ga0466966_0027709 | Ga0466966_0027709_2455_2805 | 116 |
| 330 | 3300044693 | Ga0466961_0069255 | Ga0466961_0069255_1759_2109 | 116 |
| 331 | 3300045049 | Ga0466959_0042243 | Ga0466959_0042243_471_821 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar