F410488
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 271 | 250 | 393 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10036926|Ga0105237_100369264 |
| Length | 447 |
| Sequence | MGTREYRFRIESHSSRLTAATAATNIVQLYPSGNPGAARRPAEPGRSIVMSGPRASRVFYGWYVVAAAFAVTFVGFGSAYTFSAFVESLQRDFAASRGQISLVFSLAGFLYFGFGIVSGPLADRFGSRRLAVAGMLLTAAGLAAAGAAHTLLQVYVAYGLCAYVPAVGAVQRWFVRRRGFASGLAVAGIGVGTLVMPPLASALIAHVGWRDAYFTLAVIAAAVGVGMSLLIENDPRGRGLLPDGDAGHAGATVREAVMSRPFASLYAACLVCSFGVFVPFVHLVPYALDHDVAPSTAVLLLGAIGVGSTAGRFFLGGLADRFGRRASLLAMFAGMAVSLVAWAGAASVATLAAFALVFGVFYGGWVAVLPAVVMDYFGGRNVSAIIGILYTSVAFGTLIGPAAAGFIYDAGGGYLVPILASAAANAIAFAIVATTGRAPLAARAAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 11 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 12 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 13 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 14 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 15 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 18 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 19 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 20 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 21 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 22 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 23 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 24 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 25 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 28 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 29 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 30 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 33 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 34 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 35 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 36 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 37 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 38 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 39 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 40 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 41 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 42 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 43 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 44 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 45 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 46 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 47 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 48 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 49 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 50 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 51 | 2904699407 | |||
| 52 | 2906610324 | |||
| 53 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 54 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 55 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 56 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 57 | 2922425934 | |||
| 58 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 59 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 60 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 61 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 62 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 63 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 64 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 65 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 66 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 67 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 68 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 69 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 70 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 71 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 72 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 73 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 80 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 109 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 250 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 253 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 258 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 259 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 260 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 261 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 262 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 263 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 264 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 265 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 266 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 267 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 268 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 269 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 270 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 271 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.22 |
| Metatranscriptomes | 0 |
| Isolates | 23.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.29 |
| Nodule | 12.08 |
| Rhizoplane | 10.88 |
| Rhizosphere | 48.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10004399 | 3300001989 | Bacteria | 5398 |
| 2 | JGI25152J39213_1005545 | 3300002773 | Bacteria | 3640 |
| 3 | rootH1_10089585 | 3300003316 | Bacteria | 2478 |
| 4 | rootH1_10063411 | 3300003323 | Bacteria | 3311 |
| 5 | Ga0055532_1001187 | 3300003758 | Bacteria | 7829 |
| 6 | Ga0055532_1001626 | 3300003758 | Bacteria | 5914 |
| 7 | Ga0055532_1001651 | 3300003758 | Bacteria | 5828 |
| 8 | Ga0055527_1000976 | 3300003760 | Bacteria | 7013 |
| 9 | Ga0055535_1001117 | 3300003761 | Bacteria | 16251 |
| 10 | Ga0055535_1001195 | 3300003761 | Bacteria | 14936 |
| 11 | Ga0055542_1001055 | 3300003762 | Bacteria | 17134 |
| 12 | Ga0055529_1000585 | 3300003763 | Bacteria | 29254 |
| 13 | Ga0055534_1006526 | 3300003784 | Bacteria | 2924 |
| 14 | Ga0058692_1001705 | 3300003856 | Bacteria | 7860 |
| 15 | Ga0070670_100031239 | 3300005331 | Bacteria | 4586 |
| 16 | Ga0068868_100003958 | 3300005338 | Bacteria | 10340 |
| 17 | Ga0070660_100000204 | 3300005339 | Bacteria | 39747 |
| 18 | Ga0070675_100069257 | 3300005354 | Bacteria | 2923 |
| 19 | Ga0070675_100114455 | 3300005354 | Bacteria | 2286 |
| 20 | Ga0070675_100226627 | 3300005354 | Bacteria | 1629 |
| 21 | Ga0070673_100235435 | 3300005364 | Bacteria | 1590 |
| 22 | Ga0070659_100000406 | 3300005366 | Bacteria | 32656 |
| 23 | Ga0070714_100018193 | 3300005435 | Bacteria | 5703 |
| 24 | Ga0070714_100218185 | 3300005435 | Bacteria | 1752 |
| 25 | Ga0070714_100325580 | 3300005435 | Bacteria | 1438 |
| 26 | Ga0070694_100079824 | 3300005444 | Bacteria | 2272 |
| 27 | Ga0070663_100000140 | 3300005455 | Bacteria | 35102 |
| 28 | Ga0070663_100084515 | 3300005455 | Bacteria | 2339 |
| 29 | Ga0070681_10175005 | 3300005458 | Bacteria | 2068 |
| 30 | Ga0068867_100216305 | 3300005459 | Bacteria | 1542 |
| 31 | Ga0070679_100154718 | 3300005530 | Bacteria | 2268 |
| 32 | Ga0070665_100095034 | 3300005548 | Bacteria | 2985 |
| 33 | Ga0068856_100004583 | 3300005614 | Bacteria | 13742 |
| 34 | Ga0068859_100122625 | 3300005617 | Bacteria | 2666 |
| 35 | Ga0068863_100009717 | 3300005841 | Bacteria | 9383 |
| 36 | Ga0068858_100035919 | 3300005842 | Bacteria | 4596 |
| 37 | Ga0068858_100078196 | 3300005842 | Bacteria | 3074 |
| 38 | Ga0070717_10006534 | 3300006028 | Bacteria | 8582 |
| 39 | Ga0075365_10015426 | 3300006038 | Bacteria | 4623 |
| 40 | Ga0097621_100092077 | 3300006237 | Bacteria | 2538 |
| 41 | Ga0075370_10000045 | 3300006353 | Bacteria | 37777 |
| 42 | Ga0068871_100040461 | 3300006358 | Bacteria | 3733 |
| 43 | Ga0075428_100003470 | 3300006844 | Bacteria | 17250 |
| 44 | Ga0075431_100002096 | 3300006847 | Bacteria | 19056 |
| 45 | Ga0075434_100025165 | 3300006871 | Bacteria | 5823 |
| 46 | Ga0075429_100010685 | 3300006880 | Bacteria | 7943 |
| 47 | Ga0075429_100066089 | 3300006880 | Bacteria | 3148 |
| 48 | Ga0068865_100162138 | 3300006881 | Bacteria | 1707 |
| 49 | Ga0097620_100122623 | 3300006931 | Bacteria | 2666 |
| 50 | Ga0099824_1017862 | 3300006942 | Bacteria | 6002 |
| 51 | Ga0099822_1016995 | 3300006943 | Bacteria | 7875 |
| 52 | Ga0105250_10001900 | 3300009092 | Bacteria | 10842 |
| 53 | Ga0105240_10007272 | 3300009093 | Bacteria | 16116 |
| 54 | Ga0111539_10000519 | 3300009094 | Bacteria | 48758 |
| 55 | Ga0111539_10011801 | 3300009094 | Bacteria | 10954 |
| 56 | Ga0105245_10131720 | 3300009098 | Bacteria | 2346 |
| 57 | Ga0105247_10043792 | 3300009101 | Bacteria | 2743 |
| 58 | Ga0105247_10061512 | 3300009101 | Bacteria | 2328 |
| 59 | Ga0114129_10004610 | 3300009147 | Bacteria | 19457 |
| 60 | Ga0114129_10015270 | 3300009147 | Bacteria | 10930 |
| 61 | Ga0105242_10148366 | 3300009176 | Bacteria | 2042 |
| 62 | Ga0105248_10139300 | 3300009177 | Bacteria | 2737 |
| 63 | Ga0105237_10036926 | 3300009545 | Bacteria | 4940 |
| 64 | Ga0105237_10110473 | 3300009545 | Bacteria | 2741 |
| 65 | Ga0099796_10004008 | 3300010159 | Bacteria | 3503 |
| 66 | Ga0105239_10092032 | 3300010375 | Bacteria | 3347 |
| 67 | Ga0105239_10107968 | 3300010375 | Bacteria | 3083 |
| 68 | Ga0105246_10038830 | 3300011119 | Bacteria | 3204 |
| 69 | Ga0105246_10040266 | 3300011119 | Bacteria | 3153 |
| 70 | Ga0157373_10046347 | 3300013100 | Bacteria | 3102 |
| 71 | Ga0157370_10048288 | 3300013104 | Bacteria | 4077 |
| 72 | Ga0157369_10165968 | 3300013105 | Bacteria | 2329 |
| 73 | Ga0157374_10016011 | 3300013296 | Bacteria | 6587 |
| 74 | Ga0157374_10057060 | 3300013296 | Bacteria | 3646 |
| 75 | Ga0157378_10251029 | 3300013297 | Bacteria | 1694 |
| 76 | Ga0163162_10523881 | 3300013306 | Bacteria | 1315 |
| 77 | Ga0157375_10052972 | 3300013308 | Bacteria | 3991 |
| 78 | Ga0163163_10049393 | 3300014325 | Bacteria | 4140 |
| 79 | Ga0163163_10122569 | 3300014325 | Bacteria | 2634 |
| 80 | Ga0157379_10045596 | 3300014968 | Bacteria | 3913 |
| 81 | Ga0157376_10143016 | 3300014969 | Bacteria | 2148 |
| 82 | Ga0182006_1034852 | 3300015261 | Bacteria | 2010 |
| 83 | Ga0209566_100471 | 3300025225 | Bacteria | 28914 |
| 84 | Ga0209672_100054 | 3300025228 | Bacteria | 222217 |
| 85 | Ga0209672_100072 | 3300025228 | Bacteria | 167942 |
| 86 | Ga0209147_100085 | 3300025229 | Bacteria | 185813 |
| 87 | Ga0209147_100100 | 3300025229 | Bacteria | 162747 |
| 88 | Ga0209147_100278 | 3300025229 | Bacteria | 44611 |
| 89 | Ga0209258_100331 | 3300025242 | Bacteria | 71624 |
| 90 | Ga0209258_100823 | 3300025242 | Bacteria | 17380 |
| 91 | Ga0207425_1007059 | 3300025245 | Bacteria | 3003 |
| 92 | Ga0209677_101397 | 3300025253 | Bacteria | 10481 |
| 93 | Ga0209148_1001031 | 3300025254 | Bacteria | 17448 |
| 94 | Ga0209148_1001185 | 3300025254 | Bacteria | 14989 |
| 95 | Ga0209759_1003847 | 3300025256 | Bacteria | 5815 |
| 96 | Ga0209129_1001197 | 3300025258 | Bacteria | 14948 |
| 97 | Ga0209233_1010498 | 3300025261 | Bacteria | 2772 |
| 98 | Ga0209565_1001804 | 3300025263 | Bacteria | 8626 |
| 99 | Ga0209455_1000486 | 3300025272 | Bacteria | 29217 |
| 100 | Ga0209455_1001202 | 3300025272 | Bacteria | 12373 |
| 101 | Ga0209455_1004805 | 3300025272 | Bacteria | 4319 |
| 102 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 103 | Ga0209564_1002724 | 3300025295 | Bacteria | 13321 |
| 104 | Ga0209758_1009267 | 3300025297 | Bacteria | 6160 |
| 105 | Ga0207647_10001128 | 3300025904 | Bacteria | 20563 |
| 106 | Ga0207695_10000971 | 3300025913 | Bacteria | 51107 |
| 107 | Ga0207671_10005163 | 3300025914 | Bacteria | 12148 |
| 108 | Ga0207657_10000096 | 3300025919 | Bacteria | 85043 |
| 109 | Ga0207657_10008768 | 3300025919 | Bacteria | 10237 |
| 110 | Ga0207694_10094282 | 3300025924 | Bacteria | 2365 |
| 111 | Ga0207650_10021276 | 3300025925 | Bacteria | 4585 |
| 112 | Ga0207664_10166397 | 3300025929 | Bacteria | 1884 |
| 113 | Ga0207664_10225195 | 3300025929 | Bacteria | 1628 |
| 114 | Ga0207690_10000074 | 3300025932 | Bacteria | 87516 |
| 115 | Ga0207704_10043355 | 3300025938 | Bacteria | 2656 |
| 116 | Ga0207665_10176807 | 3300025939 | Bacteria | 1544 |
| 117 | Ga0207689_10000541 | 3300025942 | Bacteria | 35878 |
| 118 | Ga0207661_10159847 | 3300025944 | Bacteria | 1954 |
| 119 | Ga0207667_10036335 | 3300025949 | Bacteria | 5280 |
| 120 | Ga0207658_10074121 | 3300025986 | Bacteria | 2586 |
| 121 | Ga0207677_10183837 | 3300026023 | Bacteria | 1647 |
| 122 | Ga0207703_10045020 | 3300026035 | Bacteria | 3549 |
| 123 | Ga0207703_10061469 | 3300026035 | Bacteria | 3075 |
| 124 | Ga0207703_10265417 | 3300026035 | Bacteria | 1553 |
| 125 | Ga0207678_10000061 | 3300026067 | Bacteria | 85413 |
| 126 | Ga0207678_10022736 | 3300026067 | Bacteria | 5491 |
| 127 | Ga0207678_10058742 | 3300026067 | Bacteria | 3309 |
| 128 | Ga0207702_10000075 | 3300026078 | Bacteria | 112303 |
| 129 | Ga0207641_10126067 | 3300026088 | Bacteria | 2292 |
| 130 | Ga0207641_10253108 | 3300026088 | Bacteria | 1646 |
| 131 | Ga0207676_10019380 | 3300026095 | Bacteria | 4963 |
| 132 | Ga0207676_10357078 | 3300026095 | Unclassified | 1353 |
| 133 | Ga0207683_10037796 | 3300026121 | Bacteria | 4206 |
| 134 | Ga0209371_1000141 | 3300027312 | Bacteria | 118767 |
| 135 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 136 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 137 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 138 | Ga0209588_1000664 | 3300027671 | Bacteria | 8637 |
| 139 | Ga0207428_10009051 | 3300027907 | Bacteria | 8956 |
| 140 | Ga0268266_10128200 | 3300028379 | Bacteria | 2267 |
| 141 | Ga0268265_10163488 | 3300028380 | Bacteria | 1894 |
| 142 | Ga0268264_10131570 | 3300028381 | Bacteria | 2219 |
| 143 | Ga0268264_10132818 | 3300028381 | Bacteria | 2209 |
| 144 | Ga0307515_10000160 | 3300028794 | Bacteria | 164789 |
| 145 | Ga0307515_10147693 | 3300028794 | Bacteria | 2479 |
| 146 | Ga0268256_1000418 | 3300030500 | Bacteria | 38424 |
| 147 | Ga0307508_10022380 | 3300031616 | Bacteria | 5745 |
| 148 | Ga0307508_10164618 | 3300031616 | Bacteria | 1821 |
| 149 | Ga0307514_10006401 | 3300031649 | Bacteria | 10269 |
| 150 | Ga0307414_10148554 | 3300032004 | Bacteria | 1845 |
| 151 | Ga0307510_10195166 | 3300033180 | Bacteria | 1567 |
| 152 | Ga0315911_1000029 | 3300033442 | Bacteria | 82350 |
| 153 | Ga0373936_0000055 | 3300035113 | Bacteria | 59785 |
| 154 | Ga0373924_0065980 | 3300035410 | Bacteria | 1521 |
| 155 | Ga0373925_0240423 | 3300037068 | Bacteria | 1450 |
| 156 | Ga0395900_0002807 | 3300037418 | Bacteria | 19021 |
| 157 | Ga0395905_0033942 | 3300037471 | Bacteria | 4792 |
| 158 | Ga0395901_0004372 | 3300038443 | Bacteria | 14254 |
| 159 | Ga0436365_1737690 | 3300039437 | Bacteria | 2234 |
| 160 | Ga0466966_0037515 | 3300044684 | Bacteria | 3125 |
| 161 | Ga0466957_0044203 | 3300044842 | Bacteria | 2699 |
| 162 | Ga0495603_0023409 | 3300046455 | Bacteria | 3738 |
| 163 | Ga0495603_0077939 | 3300046455 | Bacteria | 1944 |
| 164 | Ga0495638_0019240 | 3300046460 | Bacteria | 4519 |
| 165 | Ga0495606_0017587 | 3300046507 | Bacteria | 5397 |
| 166 | Ga0495610_0005608 | 3300046512 | Bacteria | 8859 |
| 167 | Ga0495616_0001007 | 3300046513 | Bacteria | 20154 |
| 168 | Ga0495643_0000157 | 3300046522 | Bacteria | 110922 |
| 169 | Ga0495609_0009922 | 3300046538 | Bacteria | 4588 |
| 170 | Ga0495597_0007314 | 3300046542 | Bacteria | 5624 |
| 171 | Ga0495656_0008718 | 3300046615 | Bacteria | 3630 |
| 172 | Ga0495625_0000624 | 3300046660 | Bacteria | 51214 |
| 173 | Ga0495625_0003413 | 3300046660 | Bacteria | 15889 |
| 174 | Ga0495625_0017708 | 3300046660 | Bacteria | 5573 |
| 175 | Ga0495635_0069429 | 3300046663 | Bacteria | 2416 |
| 176 | Ga0495658_0077978 | 3300046683 | Bacteria | 1938 |
| 177 | Ga0495649_0008883 | 3300046694 | Bacteria | 6015 |
| 178 | Ga0495672_0001013 | 3300047320 | Bacteria | 28974 |
| 179 | Ga0495676_0054938 | 3300047321 | Bacteria | 3162 |
| 180 | Ga0495677_0029807 | 3300047445 | Bacteria | 1985 |
| 181 | Ga0495593_0032454 | 3300047673 | Bacteria | 2846 |
| 182 | Ga0495602_0145725 | 3300048088 | Bacteria | 1869 |
| 183 | Ga0495614_0011292 | 3300048089 | Bacteria | 3930 |
| 184 | Ga0496100_0047489 | 3300048903 | Bacteria | 2767 |
| 185 | Ga0496100_0050542 | 3300048903 | Bacteria | 2694 |
| 186 | Ga0496101_0005161 | 3300048904 | Bacteria | 8309 |
| 187 | Ga0496101_0012573 | 3300048904 | Bacteria | 5652 |
| 188 | Ga0496101_0140514 | 3300048904 | Bacteria | 1840 |
| 189 | Ga0496102_0012421 | 3300048905 | Bacteria | 7369 |
| 190 | Ga0496102_0015306 | 3300048905 | Bacteria | 6679 |
| 191 | Ga0496103_0018252 | 3300048906 | Bacteria | 4207 |
| 192 | Ga0496104_0001606 | 3300048907 | Bacteria | 19467 |
| 193 | Ga0496104_0001863 | 3300048907 | Bacteria | 18258 |
| 194 | Ga0496104_0003529 | 3300048907 | Bacteria | 13484 |
| 195 | Ga0496105_0003369 | 3300048908 | Bacteria | 11810 |
| 196 | Ga0496105_0008691 | 3300048908 | Bacteria | 7902 |
| 197 | Ga0496105_0010660 | 3300048908 | Bacteria | 7230 |
| 198 | Ga0496105_0022139 | 3300048908 | Bacteria | 5148 |
| 199 | Ga0496105_0048592 | 3300048908 | Bacteria | 3502 |
| 200 | Ga0496105_0217349 | 3300048908 | Bacteria | 1556 |
| 201 | Ga0496106_0016944 | 3300048909 | Bacteria | 5392 |
| 202 | Ga0496107_0022075 | 3300048910 | Bacteria | 4497 |
| 203 | Ga0496108_0000313 | 3300048911 | Bacteria | 41243 |
| 204 | Ga0496108_0020283 | 3300048911 | Bacteria | 5462 |
| 205 | Ga0496109_0010848 | 3300048912 | Bacteria | 7799 |
| 206 | Ga0496109_0017266 | 3300048912 | Bacteria | 6322 |
| 207 | Ga0496110_0007965 | 3300048913 | Bacteria | 8487 |
| 208 | Ga0496111_0002228 | 3300048914 | Bacteria | 11629 |
| 209 | Ga0496112_0001234 | 3300048915 | Bacteria | 19296 |
| 210 | Ga0496112_0044122 | 3300048915 | Bacteria | 4367 |
| 211 | Ga0496113_0000593 | 3300048916 | Bacteria | 18082 |
| 212 | Ga0496114_0032628 | 3300048917 | Bacteria | 4287 |
| 213 | Ga0496115_0001901 | 3300048918 | Bacteria | 14914 |
| 214 | Ga0496115_0126255 | 3300048918 | Bacteria | 2107 |
| 215 | Ga0496116_0016297 | 3300048919 | Bacteria | 5821 |
| 216 | Ga0496117_0036912 | 3300048920 | Bacteria | 3648 |
| 217 | Ga0496117_0060153 | 3300048920 | Bacteria | 2620 |
| 218 | Ga0496118_0018669 | 3300048921 | Bacteria | 6235 |
| 219 | Ga0496118_0040108 | 3300048921 | Bacteria | 3726 |
| 220 | Ga0496121_0023068 | 3300048924 | Bacteria | 6011 |
| 221 | Ga0496121_0069511 | 3300048924 | Bacteria | 2841 |
| 222 | Ga0496122_0094039 | 3300048925 | Bacteria | 2031 |
| 223 | Ga0496123_0024780 | 3300048926 | Bacteria | 4546 |
| 224 | Ga0496125_0018377 | 3300048928 | Bacteria | 6643 |
| 225 | Ga0496125_0181096 | 3300048928 | Bacteria | 1404 |
| 226 | Ga0496126_0013085 | 3300048929 | Bacteria | 8465 |
| 227 | Ga0495678_000320 | 3300049459 | Bacteria | 51263 |
| 228 | Ga0501031_0062681 | 3300049568 | Bacteria | 2423 |
| 229 | Ga0501033_0167978 | 3300049570 | Bacteria | 1576 |
| 230 | Ga0501037_0204725 | 3300049573 | Bacteria | 1393 |
| 231 | Ga0501038_0113121 | 3300049574 | Bacteria | 2246 |
| 232 | Ga0501048_0206845 | 3300049582 | Bacteria | 1392 |
| 233 | Ga0501045_0155092 | 3300049824 | Bacteria | 1704 |
| 234 | nmdc:mga07m45_305_c1 | 3300050496 | Bacteria | 19787 |
| 235 | nmdc:mga05p37_108720_c1 | 3300050507 | Bacteria | 3411 |
| 236 | nmdc:mga05p37_13825_c1 | 3300050507 | Bacteria | 9670 |
| 237 | nmdc:mga09592_700_c1 | 3300050508 | Bacteria | 25671 |
| 238 | nmdc:mga06r32_2597_c1 | 3300050510 | Bacteria | 16140 |
| 239 | nmdc:mga08y16_441_c1 | 3300050511 | Bacteria | 38348 |
| 240 | nmdc:mga08y16_63190_c1 | 3300050511 | Bacteria | 3866 |
| 241 | Ga0500643_004274 | 3300053087 | Bacteria | 6532 |
| 242 | Ga0500562_002045 | 3300053108 | Bacteria | 5042 |
| 243 | Ga0500571_000036 | 3300053110 | Bacteria | 42725 |
| 244 | Ga0500642_0032861 | 3300053130 | Bacteria | 2180 |
| 245 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 246 | Ga0500564_011334 | 3300053138 | Bacteria | 3930 |
| 247 | Ga0500603_000763 | 3300053150 | Bacteria | 7750 |
| 248 | Ga0500616_0013277 | 3300053153 | Bacteria | 4790 |
| 249 | Ga0500637_0004258 | 3300053178 | Bacteria | 6760 |
| 250 | Ga0500645_006763 | 3300053730 | Bacteria | 4061 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046663 | Ga0495635_0069429 | Ga0495635_0069429_79_1389 | 335 |
| 2 | 3300046683 | Ga0495658_0077978 | Ga0495658_0077978_160_1470 | 335 |
| 3 | 3300047673 | Ga0495593_0032454 | Ga0495593_0032454_161_1471 | 335 |
| 4 | 3300048089 | Ga0495614_0011292 | Ga0495614_0011292_67_1377 | 335 |
| 5 | 3300053110 | Ga0500571_000036 | Ga0500571_000036_4366_5676 | 335 |
| 6 | 3300053138 | Ga0500564_011334 | Ga0500564_011334_1483_2793 | 335 |
| 7 | 3300053087 | Ga0500643_004274 | Ga0500643_004274_318_1628 | 336 |
| 8 | 3300046460 | Ga0495638_0019240 | Ga0495638_0019240_803_2113 | 337 |
| 9 | 3300046513 | Ga0495616_0001007 | Ga0495616_0001007_4390_5700 | 337 |
| 10 | 3300048926 | Ga0496123_0024780 | Ga0496123_0024780_2044_3354 | 337 |
| 11 | 3300053134 | Ga0500658_0000033 | Ga0500658_0000033_54413_55723 | 337 |
| 12 | 3300002773 | JGI25152J39213_1005545 | JGI25152J39213_10055454 | 339 |
| 13 | 3300003784 | Ga0055534_1006526 | Ga0055534_10065263 | 339 |
| 14 | 3300025245 | Ga0207425_1007059 | Ga0207425_10070593 | 339 |
| 15 | 3300025258 | Ga0209129_1001197 | Ga0209129_100119713 | 339 |
| 16 | 3300025263 | Ga0209565_1001804 | Ga0209565_10018044 | 339 |
| 17 | 3300025297 | Ga0209758_1009267 | Ga0209758_10092674 | 339 |
| 18 | 3300053153 | Ga0500616_0013277 | Ga0500616_0013277_1090_2334 | 342 |
| 19 | 3300049574 | Ga0501038_0113121 | Ga0501038_0113121_15_1094 | 350 |
| 20 | 3300048907 | Ga0496104_0001606 | Ga0496104_0001606_5746_7002 | 355 |
| 21 | 3300048908 | Ga0496105_0008691 | Ga0496105_0008691_2929_4185 | 355 |
| 22 | 3300009545 | Ga0105237_10110473 | Ga0105237_101104733 | 356 |
| 23 | 3300025924 | Ga0207694_10094282 | Ga0207694_100942822 | 356 |
| 24 | 3300014969 | Ga0157376_10143016 | Ga0157376_101430162 | 358 |
| 25 | 3300005617 | Ga0068859_100122625 | Ga0068859_1001226252 | 360 |
| 26 | 3300006931 | Ga0097620_100122623 | Ga0097620_1001226232 | 360 |
| 27 | 3300026067 | Ga0207678_10058742 | Ga0207678_100587423 | 360 |
| 28 | 3300048904 | Ga0496101_0140514 | Ga0496101_0140514_68_1324 | 360 |
| 29 | 3300048919 | Ga0496116_0016297 | Ga0496116_0016297_2640_3896 | 360 |
| 30 | 3300009094 | Ga0111539_10000519 | Ga0111539_1000051950 | 362 |
| 31 | 3300005435 | Ga0070714_100018193 | Ga0070714_1000181932 | 363 |
| 32 | 3300006028 | Ga0070717_10006534 | Ga0070717_100065346 | 363 |
| 33 | 3300025929 | Ga0207664_10166397 | Ga0207664_101663972 | 363 |
| 34 | 3300053108 | Ga0500562_002045 | Ga0500562_002045_2903_4090 | 363 |
| 35 | 3300005338 | Ga0068868_100003958 | Ga0068868_1000039582 | 364 |
| 36 | 3300005354 | Ga0070675_100069257 | Ga0070675_1000692572 | 364 |
| 37 | 3300005435 | Ga0070714_100218185 | Ga0070714_1002181852 | 364 |
| 38 | 3300010375 | Ga0105239_10092032 | Ga0105239_100920322 | 364 |
| 39 | 3300013296 | Ga0157374_10057060 | Ga0157374_100570602 | 364 |
| 40 | 3300025929 | Ga0207664_10225195 | Ga0207664_102251951 | 364 |
| 41 | 3300025944 | Ga0207661_10159847 | Ga0207661_101598472 | 364 |
| 42 | 3300026067 | Ga0207678_10022736 | Ga0207678_100227364 | 364 |
| 43 | 3300026121 | Ga0207683_10037796 | Ga0207683_100377962 | 364 |
| 44 | 3300048904 | Ga0496101_0005161 | Ga0496101_0005161_6770_8020 | 364 |
| 45 | 3300048905 | Ga0496102_0015306 | Ga0496102_0015306_1905_3155 | 364 |
| 46 | 3300048908 | Ga0496105_0022139 | Ga0496105_0022139_2257_3507 | 364 |
| 47 | 3300048910 | Ga0496107_0022075 | Ga0496107_0022075_76_1326 | 364 |
| 48 | 3300048911 | Ga0496108_0020283 | Ga0496108_0020283_3004_4254 | 364 |
| 49 | 3300048912 | Ga0496109_0017266 | Ga0496109_0017266_2871_4121 | 364 |
| 50 | 3300048915 | Ga0496112_0044122 | Ga0496112_0044122_1199_2449 | 364 |
| 51 | 3300048917 | Ga0496114_0032628 | Ga0496114_0032628_1808_3058 | 364 |
| 52 | 3300048918 | Ga0496115_0001901 | Ga0496115_0001901_5773_7023 | 364 |
| 53 | 3300006038 | Ga0075365_10015426 | Ga0075365_100154263 | 365 |
| 54 | 3300011119 | Ga0105246_10038830 | Ga0105246_100388302 | 365 |
| 55 | 3300013308 | Ga0157375_10052972 | Ga0157375_100529722 | 365 |
| 56 | 3300014325 | Ga0163163_10122569 | Ga0163163_101225692 | 365 |
| 57 | 3300014968 | Ga0157379_10045596 | Ga0157379_100455964 | 365 |
| 58 | 3300026023 | Ga0207677_10183837 | Ga0207677_101838372 | 365 |
| 59 | 3300046542 | Ga0495597_0007314 | Ga0495597_0007314_1540_2757 | 365 |
| 60 | 3300046660 | Ga0495625_0003413 | Ga0495625_0003413_11965_13182 | 365 |
| 61 | 3300048908 | Ga0496105_0217349 | Ga0496105_0217349_147_1403 | 365 |
| 62 | 3300005331 | Ga0070670_100031239 | Ga0070670_1000312392 | 366 |
| 63 | 3300006871 | Ga0075434_100025165 | Ga0075434_1000251655 | 366 |
| 64 | 3300006880 | Ga0075429_100066089 | Ga0075429_1000660893 | 366 |
| 65 | 3300009101 | Ga0105247_10061512 | Ga0105247_100615122 | 366 |
| 66 | 3300009147 | Ga0114129_10004610 | Ga0114129_1000461020 | 366 |
| 67 | 3300014325 | Ga0163163_10049393 | Ga0163163_100493934 | 366 |
| 68 | 3300025925 | Ga0207650_10021276 | Ga0207650_100212765 | 367 |
| 69 | 3300025986 | Ga0207658_10074121 | Ga0207658_100741212 | 367 |
| 70 | 3300048903 | Ga0496100_0050542 | Ga0496100_0050542_559_1809 | 367 |
| 71 | 3300048904 | Ga0496101_0012573 | Ga0496101_0012573_2731_3981 | 367 |
| 72 | 3300048905 | Ga0496102_0012421 | Ga0496102_0012421_1764_3014 | 367 |
| 73 | 3300048906 | Ga0496103_0018252 | Ga0496103_0018252_2368_3618 | 367 |
| 74 | 3300048907 | Ga0496104_0003529 | Ga0496104_0003529_10009_11259 | 367 |
| 75 | 3300048908 | Ga0496105_0010660 | Ga0496105_0010660_2938_4188 | 367 |
| 76 | 3300048909 | Ga0496106_0016944 | Ga0496106_0016944_1192_2442 | 367 |
| 77 | 3300048911 | Ga0496108_0000313 | Ga0496108_0000313_9919_11169 | 367 |
| 78 | 3300048912 | Ga0496109_0010848 | Ga0496109_0010848_3946_5196 | 367 |
| 79 | 3300048913 | Ga0496110_0007965 | Ga0496110_0007965_6121_7371 | 367 |
| 80 | 3300048914 | Ga0496111_0002228 | Ga0496111_0002228_6165_7415 | 367 |
| 81 | 3300048915 | Ga0496112_0001234 | Ga0496112_0001234_5306_6556 | 367 |
| 82 | 3300048916 | Ga0496113_0000593 | Ga0496113_0000593_7875_9125 | 367 |
| 83 | 3300050507 | nmdc:mga05p37_108720_c1 | nmdc:mga05p37_108720_c1_1554_2804 | 367 |
| 84 | 3300053730 | Ga0500645_006763 | Ga0500645_006763_501_1751 | 367 |
| 85 | 3300046660 | Ga0495625_0000624 | Ga0495625_0000624_34232_35515 | 371 |
| 86 | 3300047321 | Ga0495676_0054938 | Ga0495676_0054938_297_1514 | 371 |
| 87 | 3300006844 | Ga0075428_100003470 | Ga0075428_10000347014 | 372 |
| 88 | 3300006847 | Ga0075431_100002096 | Ga0075431_10000209614 | 372 |
| 89 | 3300006880 | Ga0075429_100010685 | Ga0075429_1000106851 | 372 |
| 90 | 3300009147 | Ga0114129_10015270 | Ga0114129_100152704 | 372 |
| 91 | 3300027907 | Ga0207428_10009051 | Ga0207428_100090513 | 372 |
| 92 | 3300050507 | nmdc:mga05p37_13825_c1 | nmdc:mga05p37_13825_c1_7925_9148 | 372 |
| 93 | 3300050508 | nmdc:mga09592_700_c1 | nmdc:mga09592_700_c1_24398_25621 | 372 |
| 94 | 3300050510 | nmdc:mga06r32_2597_c1 | nmdc:mga06r32_2597_c1_5023_6246 | 372 |
| 95 | 3300050511 | nmdc:mga08y16_441_c1 | nmdc:mga08y16_441_c1_12364_13587 | 372 |
| 96 | 3300025253 | Ga0209677_101397 | Ga0209677_1013974 | 373 |
| 97 | 3300048907 | Ga0496104_0001863 | Ga0496104_0001863_14766_16070 | 373 |
| 98 | 3300048908 | Ga0496105_0048592 | Ga0496105_0048592_345_1649 | 373 |
| 99 | 3300003323 | rootH1_10063411 | rootH1_100634113 | 374 |
| 100 | 3300046507 | Ga0495606_0017587 | Ga0495606_0017587_2664_3875 | 374 |
| 101 | 3300048920 | Ga0496117_0060153 | Ga0496117_0060153_1213_2457 | 374 |
| 102 | 3300048921 | Ga0496118_0018669 | Ga0496118_0018669_1796_3040 | 374 |
| 103 | 3300048924 | Ga0496121_0023068 | Ga0496121_0023068_2766_4010 | 374 |
| 104 | 3300049824 | Ga0501045_0155092 | Ga0501045_0155092_479_1666 | 374 |
| 105 | 3300039437 | Ga0436365_1737690 | Ga0436365_1737690_198_1442 | 375 |
| 106 | 3300046615 | Ga0495656_0008718 | Ga0495656_0008718_82_1284 | 375 |
| 107 | 3300025939 | Ga0207665_10176807 | Ga0207665_101768071 | 376 |
| 108 | 3300048924 | Ga0496121_0069511 | Ga0496121_0069511_378_1628 | 376 |
| 109 | 3300025261 | Ga0209233_1010498 | Ga0209233_10104982 | 377 |
| 110 | 3300035113 | Ga0373936_0000055 | Ga0373936_0000055_53672_54913 | 377 |
| 111 | 3300046660 | Ga0495625_0017708 | Ga0495625_0017708_2655_3896 | 377 |
| 112 | 3300046694 | Ga0495649_0008883 | Ga0495649_0008883_2386_3627 | 377 |
| 113 | 3300028794 | Ga0307515_10147693 | Ga0307515_101476933 | 378 |
| 114 | 3300032004 | Ga0307414_10148554 | Ga0307414_101485543 | 378 |
| 115 | 3300006942 | Ga0099824_1017862 | Ga0099824_10178627 | 379 |
| 116 | 3300006943 | Ga0099822_1016995 | Ga0099822_10169956 | 379 |
| 117 | 3300027357 | Ga0209589_1000023 | Ga0209589_1000023138 | 379 |
| 118 | 3300027361 | Ga0209489_100032 | Ga0209489_100032138 | 379 |
| 119 | 3300027363 | Ga0209700_100040 | Ga0209700_100040138 | 379 |
| 120 | 3300046512 | Ga0495610_0005608 | Ga0495610_0005608_4115_5356 | 379 |
| 121 | 3300046522 | Ga0495643_0000157 | Ga0495643_0000157_25950_27191 | 379 |
| 122 | 3300046538 | Ga0495609_0009922 | Ga0495609_0009922_1467_2708 | 379 |
| 123 | 3300047320 | Ga0495672_0001013 | Ga0495672_0001013_25995_27236 | 379 |
| 124 | 3300047445 | Ga0495677_0029807 | Ga0495677_0029807_542_1783 | 379 |
| 125 | 3300049459 | Ga0495678_000320 | Ga0495678_000320_46987_48228 | 379 |
| 126 | 3300005435 | Ga0070714_100325580 | Ga0070714_1003255801 | 380 |
| 127 | 3300031649 | Ga0307514_10006401 | Ga0307514_100064014 | 380 |
| 128 | 3300035410 | Ga0373924_0065980 | Ga0373924_0065980_11_1222 | 380 |
| 129 | 3300037068 | Ga0373925_0240423 | Ga0373925_0240423_76_1287 | 380 |
| 130 | 3300026095 | Ga0207676_10019380 | Ga0207676_100193802 | 381 |
| 131 | 3300028381 | Ga0268264_10131570 | Ga0268264_101315702 | 381 |
| 132 | 3300028794 | Ga0307515_10000160 | Ga0307515_100001608 | 381 |
| 133 | 3300048903 | Ga0496100_0047489 | Ga0496100_0047489_1389_2603 | 381 |
| 134 | 3300048908 | Ga0496105_0003369 | Ga0496105_0003369_10213_11427 | 381 |
| 135 | 3300048918 | Ga0496115_0126255 | Ga0496115_0126255_727_1941 | 381 |
| 136 | 3300005354 | Ga0070675_100226627 | Ga0070675_1002266271 | 382 |
| 137 | 3300005455 | Ga0070663_100084515 | Ga0070663_1000845152 | 382 |
| 138 | 3300009094 | Ga0111539_10011801 | Ga0111539_100118019 | 382 |
| 139 | 3300050511 | nmdc:mga08y16_63190_c1 | nmdc:mga08y16_63190_c1_2488_3738 | 382 |
| 140 | 3300053130 | Ga0500642_0032861 | Ga0500642_0032861_126_1409 | 382 |
| 141 | 3300003758 | Ga0055532_1001187 | Ga0055532_10011873 | 383 |
| 142 | 3300003761 | Ga0055535_1001117 | Ga0055535_10011173 | 383 |
| 143 | 3300003762 | Ga0055542_1001055 | Ga0055542_10010554 | 383 |
| 144 | 3300003763 | Ga0055529_1000585 | Ga0055529_10005854 | 383 |
| 145 | 3300025228 | Ga0209672_100054 | Ga0209672_10005426 | 383 |
| 146 | 3300025229 | Ga0209147_100085 | Ga0209147_100085164 | 383 |
| 147 | 3300025242 | Ga0209258_100823 | Ga0209258_10082315 | 383 |
| 148 | 3300025254 | Ga0209148_1001031 | Ga0209148_100103115 | 383 |
| 149 | 3300025272 | Ga0209455_1000486 | Ga0209455_10004864 | 383 |
| 150 | 3300003856 | Ga0058692_1001705 | Ga0058692_10017053 | 384 |
| 151 | 3300005614 | Ga0068856_100004583 | Ga0068856_1000045835 | 384 |
| 152 | 3300026078 | Ga0207702_10000075 | Ga0207702_1000007563 | 384 |
| 153 | 3300027312 | Ga0209371_1000141 | Ga0209371_1000141100 | 384 |
| 154 | 3300030500 | Ga0268256_1000418 | Ga0268256_100041820 | 384 |
| 155 | 3300031616 | Ga0307508_10164618 | Ga0307508_101646182 | 384 |
| 156 | 3300033180 | Ga0307510_10195166 | Ga0307510_101951661 | 384 |
| 157 | 3300046455 | Ga0495603_0023409 | Ga0495603_0023409_1565_2821 | 384 |
| 158 | 3300053150 | Ga0500603_000763 | Ga0500603_000763_3543_4799 | 384 |
| 159 | 3300053178 | Ga0500637_0004258 | Ga0500637_0004258_517_1773 | 384 |
| 160 | 3300005339 | Ga0070660_100000204 | Ga0070660_10000020426 | 385 |
| 161 | 3300005366 | Ga0070659_100000406 | Ga0070659_10000040626 | 385 |
| 162 | 3300005842 | Ga0068858_100078196 | Ga0068858_1000781962 | 385 |
| 163 | 3300010375 | Ga0105239_10107968 | Ga0105239_101079683 | 385 |
| 164 | 3300013104 | Ga0157370_10048288 | Ga0157370_100482883 | 385 |
| 165 | 3300013105 | Ga0157369_10165968 | Ga0157369_101659681 | 385 |
| 166 | 3300025919 | Ga0207657_10000096 | Ga0207657_1000009653 | 385 |
| 167 | 3300025932 | Ga0207690_10000074 | Ga0207690_1000007426 | 385 |
| 168 | 3300026035 | Ga0207703_10061469 | Ga0207703_100614692 | 385 |
| 169 | 3300048920 | Ga0496117_0036912 | Ga0496117_0036912_669_2090 | 385 |
| 170 | iso_pu_bacteria | 2847939898 | 2847945966 | 385 |
| 171 | 3300038443 | Ga0395901_0004372 | Ga0395901_0004372_12291_13556 | 387 |
| 172 | 3300006353 | Ga0075370_10000045 | Ga0075370_1000004535 | 388 |
| 173 | 3300033442 | Ga0315911_1000029 | Ga0315911_100002959 | 388 |
| 174 | 3300050496 | nmdc:mga07m45_305_c1 | nmdc:mga07m45_305_c1_4083_5363 | 388 |
| 175 | 3300046455 | Ga0495603_0077939 | Ga0495603_0077939_32_1273 | 389 |
| 176 | 3300048928 | Ga0496125_0181096 | Ga0496125_0181096_122_1381 | 389 |
| 177 | 3300049582 | Ga0501048_0206845 | Ga0501048_0206845_29_1267 | 389 |
| 178 | 3300013306 | Ga0163162_10523881 | Ga0163162_105238811 | 390 |
| 179 | 3300025272 | Ga0209455_1004805 | Ga0209455_10048052 | 390 |
| 180 | 3300005455 | Ga0070663_100000140 | Ga0070663_10000014028 | 392 |
| 181 | 3300009092 | Ga0105250_10001900 | Ga0105250_100019008 | 392 |
| 182 | 3300025949 | Ga0207667_10036335 | Ga0207667_100363352 | 392 |
| 183 | 3300026067 | Ga0207678_10000061 | Ga0207678_1000006127 | 392 |
| 184 | 3300031616 | Ga0307508_10022380 | Ga0307508_100223803 | 392 |
| 185 | 3300037471 | Ga0395905_0033942 | Ga0395905_0033942_578_1816 | 392 |
| 186 | 3300048921 | Ga0496118_0040108 | Ga0496118_0040108_954_2375 | 392 |
| 187 | 3300048925 | Ga0496122_0094039 | Ga0496122_0094039_630_1904 | 392 |
| 188 | iso_pu_bacteria | 2738541300 | 2738846437 | 393 |
| 189 | iso_pu_bacteria | 2738543018 | 2739277786 | 393 |
| 190 | iso_pu_bacteria | 2738543030 | 2739346829 | 393 |
| 191 | 3300009093 | Ga0105240_10007272 | Ga0105240_1000727212 | 394 |
| 192 | 3300025913 | Ga0207695_10000971 | Ga0207695_1000097142 | 394 |
| 193 | 3300026035 | Ga0207703_10265417 | Ga0207703_102654171 | 395 |
| 194 | 3300037418 | Ga0395900_0002807 | Ga0395900_0002807_15943_17184 | 395 |
| 195 | 3300048928 | Ga0496125_0018377 | Ga0496125_0018377_1404_2654 | 396 |
| 196 | 3300003316 | rootH1_10089585 | rootH1_100895852 | 397 |
| 197 | iso_pu_bacteria | 2883291878 | 2883295167 | 397 |
| 198 | 3300005354 | Ga0070675_100114455 | Ga0070675_1001144552 | 398 |
| 199 | 3300005364 | Ga0070673_100235435 | Ga0070673_1002354352 | 398 |
| 200 | 3300005444 | Ga0070694_100079824 | Ga0070694_1000798242 | 398 |
| 201 | 3300005459 | Ga0068867_100216305 | Ga0068867_1002163051 | 398 |
| 202 | 3300005548 | Ga0070665_100095034 | Ga0070665_1000950343 | 398 |
| 203 | 3300005841 | Ga0068863_100009717 | Ga0068863_1000097175 | 398 |
| 204 | 3300005842 | Ga0068858_100035919 | Ga0068858_1000359193 | 398 |
| 205 | 3300006237 | Ga0097621_100092077 | Ga0097621_1000920772 | 398 |
| 206 | 3300006358 | Ga0068871_100040461 | Ga0068871_1000404613 | 398 |
| 207 | 3300006881 | Ga0068865_100162138 | Ga0068865_1001621382 | 398 |
| 208 | 3300009098 | Ga0105245_10131720 | Ga0105245_101317203 | 398 |
| 209 | 3300009101 | Ga0105247_10043792 | Ga0105247_100437922 | 398 |
| 210 | 3300009176 | Ga0105242_10148366 | Ga0105242_101483661 | 398 |
| 211 | 3300009177 | Ga0105248_10139300 | Ga0105248_101393002 | 398 |
| 212 | 3300009545 | Ga0105237_10036926 | Ga0105237_100369264 | 398 |
| 213 | 3300011119 | Ga0105246_10040266 | Ga0105246_100402663 | 398 |
| 214 | 3300013296 | Ga0157374_10016011 | Ga0157374_100160115 | 398 |
| 215 | 3300013297 | Ga0157378_10251029 | Ga0157378_102510291 | 398 |
| 216 | 3300025914 | Ga0207671_10005163 | Ga0207671_100051635 | 398 |
| 217 | 3300025938 | Ga0207704_10043355 | Ga0207704_100433552 | 398 |
| 218 | 3300025942 | Ga0207689_10000541 | Ga0207689_1000054125 | 398 |
| 219 | 3300026035 | Ga0207703_10045020 | Ga0207703_100450203 | 398 |
| 220 | 3300026088 | Ga0207641_10126067 | Ga0207641_101260672 | 398 |
| 221 | 3300026095 | Ga0207676_10357078 | Ga0207676_103570781 | 398 |
| 222 | 3300028379 | Ga0268266_10128200 | Ga0268266_101282002 | 398 |
| 223 | 3300028380 | Ga0268265_10163488 | Ga0268265_101634882 | 398 |
| 224 | 3300028381 | Ga0268264_10132818 | Ga0268264_101328182 | 398 |
| 225 | 3300044684 | Ga0466966_0037515 | Ga0466966_0037515_88_1332 | 398 |
| 226 | iso_pu_bacteria | 2513020051 | 2513229738 | 398 |
| 227 | iso_pu_bacteria | 2643221645 | 2644252242 | 398 |
| 228 | iso_pu_bacteria | 8056689827 | 8056695810 | 398 |
| 229 | 3300026088 | Ga0207641_10253108 | Ga0207641_102531082 | 399 |
| 230 | iso_pu_bacteria | 2738541307 | 2738883895 | 399 |
| 231 | 3300005458 | Ga0070681_10175005 | Ga0070681_101750053 | 400 |
| 232 | 3300005530 | Ga0070679_100154718 | Ga0070679_1001547182 | 400 |
| 233 | 3300013100 | Ga0157373_10046347 | Ga0157373_100463474 | 400 |
| 234 | 3300025904 | Ga0207647_10001128 | Ga0207647_100011287 | 400 |
| 235 | 3300025919 | Ga0207657_10008768 | Ga0207657_1000876810 | 400 |
| 236 | 3300027671 | Ga0209588_1000664 | Ga0209588_10006645 | 400 |
| 237 | 3300049568 | Ga0501031_0062681 | Ga0501031_0062681_393_1631 | 400 |
| 238 | 3300049570 | Ga0501033_0167978 | Ga0501033_0167978_71_1309 | 400 |
| 239 | 3300049573 | Ga0501037_0204725 | Ga0501037_0204725_127_1365 | 400 |
| 240 | iso_pu_bacteria | 2517572143 | 2517893232 | 400 |
| 241 | iso_pu_bacteria | 2728368998 | 2728754530 | 400 |
| 242 | iso_pu_bacteria | 2945972063 | 2945976724 | 401 |
| 243 | iso_pu_bacteria | 2513237096 | 2513656509 | 402 |
| 244 | iso_pu_bacteria | 2513237137 | 2513859606 | 402 |
| 245 | iso_pu_bacteria | 2513237145 | 2513917694 | 402 |
| 246 | iso_pu_bacteria | 2524023228 | 2524537194 | 402 |
| 247 | iso_pu_bacteria | 2643221658 | 2644329569 | 402 |
| 248 | iso_pu_bacteria | 2667528175 | 2671117875 | 402 |
| 249 | iso_pu_bacteria | 2791355197 | 2793069899 | 402 |
| 250 | iso_pu_bacteria | 2834641062 | 2834644053 | 402 |
| 251 | iso_pu_bacteria | 2842038055 | 2842039665 | 402 |
| 252 | iso_pu_bacteria | 2842045827 | 2842047389 | 402 |
| 253 | iso_pu_bacteria | 2858950400 | 2858952457 | 402 |
| 254 | iso_pu_bacteria | 2885374607 | 2885374824 | 402 |
| 255 | iso_pu_bacteria | 2903748898 | 2903755699 | 402 |
| 256 | iso_pu_bacteria | 2904690495 | 2904696722 | 402 |
| 257 | iso_pu_bacteria | 2904699407 | 2904704201 | 402 |
| 258 | iso_pu_bacteria | 2906610324 | 2906617561 | 402 |
| 259 | iso_pu_bacteria | 2906635258 | 2906642232 | 402 |
| 260 | iso_pu_bacteria | 2906660503 | 2906667936 | 402 |
| 261 | iso_pu_bacteria | 2908739725 | 2908743628 | 402 |
| 262 | iso_pu_bacteria | 2908756301 | 2908761342 | 402 |
| 263 | iso_pu_bacteria | 2922425934 | 2922429246 | 402 |
| 264 | iso_pu_bacteria | 2935630451 | 2935634165 | 402 |
| 265 | iso_pu_bacteria | 2941507105 | 2941511056 | 402 |
| 266 | iso_pu_bacteria | 2941515067 | 2941518440 | 402 |
| 267 | iso_pu_bacteria | 2941523033 | 2941527297 | 402 |
| 268 | iso_pu_bacteria | 3005474847 | 3005479413 | 402 |
| 269 | iso_pu_bacteria | 8003400568 | 8003402992 | 402 |
| 270 | iso_pu_bacteria | 8006933436 | 8006941745 | 402 |
| 271 | iso_pu_bacteria | 8006973647 | 8006981492 | 402 |
| 272 | iso_pu_bacteria | 8019555841 | 8019557643 | 402 |
| 273 | iso_pu_bacteria | 8019565922 | 8019567656 | 402 |
| 274 | 3300010159 | Ga0099796_10004008 | Ga0099796_100040082 | 403 |
| 275 | 3300048088 | Ga0495602_0145725 | Ga0495602_0145725_347_1642 | 403 |
| 276 | iso_pu_bacteria | 2643221621 | 2644123995 | 403 |
| 277 | iso_pu_bacteria | 8020938398 | 8020938896 | 403 |
| 278 | iso_pu_bacteria | 8020953355 | 8020953561 | 403 |
| 279 | 3300048929 | Ga0496126_0013085 | Ga0496126_0013085_5516_6772 | 404 |
| 280 | iso_pu_bacteria | 2513237139 | 2513876584 | 404 |
| 281 | iso_pu_bacteria | 2513237161 | 2514010920 | 404 |
| 282 | iso_pu_bacteria | 2524023210 | 2524465199 | 404 |
| 283 | iso_pu_bacteria | 2617270735 | 2617352852 | 404 |
| 284 | iso_pu_bacteria | 2802429603 | 2805919839 | 404 |
| 285 | iso_pu_bacteria | 2824671348 | 2824676147 | 404 |
| 286 | iso_pu_bacteria | 2824687955 | 2824691836 | 404 |
| 287 | iso_pu_bacteria | 2824696289 | 2824699435 | 404 |
| 288 | iso_pu_bacteria | 2824773399 | 2824779342 | 404 |
| 289 | iso_pu_bacteria | 2838122688 | 2838126419 | 404 |
| 290 | iso_pu_bacteria | 2841941048 | 2841943507 | 404 |
| 291 | iso_pu_bacteria | 2841949485 | 2841950546 | 404 |
| 292 | iso_pu_bacteria | 2841966195 | 2841966860 | 404 |
| 293 | iso_pu_bacteria | 2841974524 | 2841975610 | 404 |
| 294 | iso_pu_bacteria | 2841983080 | 2841988183 | 404 |
| 295 | iso_pu_bacteria | 2643221672 | 2644398348 | 405 |
| 296 | iso_pu_bacteria | 2876761206 | 2876768875 | 405 |
| 297 | iso_pu_bacteria | 2904449895 | 2904454665 | 405 |
| 298 | iso_pu_bacteria | 2929520902 | 2929524616 | 405 |
| 299 | 3300025273 | Ga0209673_1000098 | Ga0209673_100009827 | 407 |
| 300 | 3300025295 | Ga0209564_1002724 | Ga0209564_100272411 | 407 |
| 301 | iso_pu_bacteria | 2599185240 | 2599747744 | 407 |
| 302 | iso_pu_bacteria | 2599185355 | 2600209749 | 407 |
| 303 | iso_pu_bacteria | 2675903129 | 2676745926 | 407 |
| 304 | iso_pu_bacteria | 2863421361 | 2863426356 | 408 |
| 305 | 3300003758 | Ga0055532_1001626 | Ga0055532_10016264 | 409 |
| 306 | 3300025229 | Ga0209147_100278 | Ga0209147_10027839 | 409 |
| 307 | iso_pu_bacteria | 2599185239 | 2599741187 | 409 |
| 308 | iso_pu_bacteria | 2818991452 | 2819637042 | 409 |
| 309 | iso_pu_bacteria | 2870068957 | 2870069243 | 409 |
| 310 | iso_pu_bacteria | 2928157003 | 2928163193 | 409 |
| 311 | iso_pu_bacteria | 2928163908 | 2928170061 | 409 |
| 312 | iso_pu_bacteria | 2928170801 | 2928176169 | 409 |
| 313 | iso_pu_bacteria | 2981990288 | 2981995956 | 409 |
| 314 | iso_pu_bacteria | 641736154 | 642417409 | 409 |
| 315 | iso_pu_bacteria | 8018845410 | 8018848760 | 409 |
| 316 | iso_pu_bacteria | 8020945358 | 8020950466 | 409 |
| 317 | iso_pu_bacteria | 8021120328 | 8021127943 | 409 |
| 318 | 3300003758 | Ga0055532_1001651 | Ga0055532_10016514 | 410 |
| 319 | 3300003760 | Ga0055527_1000976 | Ga0055527_10009764 | 410 |
| 320 | 3300003761 | Ga0055535_1001195 | Ga0055535_10011954 | 410 |
| 321 | 3300025228 | Ga0209672_100072 | Ga0209672_100072141 | 410 |
| 322 | 3300025229 | Ga0209147_100100 | Ga0209147_100100133 | 410 |
| 323 | 3300025242 | Ga0209258_100331 | Ga0209258_10033142 | 410 |
| 324 | 3300025254 | Ga0209148_1001185 | Ga0209148_10011854 | 410 |
| 325 | 3300025256 | Ga0209759_1003847 | Ga0209759_10038474 | 410 |
| 326 | 3300025272 | Ga0209455_1001202 | Ga0209455_10012029 | 410 |
| 327 | 3300044842 | Ga0466957_0044203 | Ga0466957_0044203_989_2260 | 410 |
| 328 | 3300001989 | JGI24739J22299_10004399 | JGI24739J22299_100043994 | 413 |
| 329 | 3300015261 | Ga0182006_1034852 | Ga0182006_10348522 | 413 |
| 330 | 3300025225 | Ga0209566_100471 | Ga0209566_1004714 | 413 |
| 331 | iso_pu_bacteria | 8039098773 | 8039102058 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.9028 | 13 | 401 |
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.8974 | 12 | 398 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.8934 | 13 | 401 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8919 | 16 | 403 |
| 7ckr-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. | 0.8909 | 9 | 401 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BGC3_251_439_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9655 | 227 | 400 | 1.20.1250.20 |
| af_E7FGJ9_372_605_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9593 | 227 | 400 | 1.20.1250.20 |
| af_Q7JWI7_454_654_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9526 | 225 | 399 | 1.20.1250.20 |
| af_Q9W509_423_624_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9508 | 224 | 401 | 1.20.1250.20 |
| af_F1QY19_223_417_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9463 | 224 | 401 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0B4N4-F1-model_v4 | MFS transporter | 0.9141 | 223 | 400 |
GO:0016020
GO:0022857 |
| AF-A0A803SMW4-F1-model_v4 | FLVCR heme transporter 2 | 0.8913 | 219 | 406 |
GO:0005789
GO:0005886 GO:0022857 GO:0031966 |
| AF-A0A0C3GTB6-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8847 | 11 | 401 |
GO:0016020
GO:0022857 |
| AF-A0A522E846-F1-model_v4 | MFS transporter | 0.8826 | 223 | 400 |
GO:0016020
GO:0022857 |
| AF-E5WKG2-F1-model_v4 | deleted | 0.8809 | 228 | 399 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar