F410488

General Info

Members Datasets Scaffolds Average Seq Length
331 271 250 393

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10036926|Ga0105237_100369264
Length 447
Sequence MGTREYRFRIESHSSRLTAATAATNIVQLYPSGNPGAARRPAEPGRSIVMSGPRASRVFYGWYVVAAAFAVTFVGFGSAYTFSAFVESLQRDFAASRGQISLVFSLAGFLYFGFGIVSGPLADRFGSRRLAVAGMLLTAAGLAAAGAAHTLLQVYVAYGLCAYVPAVGAVQRWFVRRRGFASGLAVAGIGVGTLVMPPLASALIAHVGWRDAYFTLAVIAAAVGVGMSLLIENDPRGRGLLPDGDAGHAGATVREAVMSRPFASLYAACLVCSFGVFVPFVHLVPYALDHDVAPSTAVLLLGAIGVGSTAGRFFLGGLADRFGRRASLLAMFAGMAVSLVAWAGAASVATLAAFALVFGVFYGGWVAVLPAVVMDYFGGRNVSAIIGILYTSVAFGTLIGPAAAGFIYDAGGGYLVPILASAAANAIAFAIVATTGRAPLAARAAGR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2643221621 Achromobacter sp. Root83 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221672 Variovorax sp. Root434 Isolate Unclassified
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
20 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
21 2738541300 Massilia sp. GV016 Isolate Unclassified
22 2738541307 Variovorax sp. GV008 Isolate Unclassified
23 2738543018 Massilia sp. GV045 Isolate Unclassified
24 2738543030 Massilia sp. GV097 Isolate Unclassified
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
32 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
33 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
34 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
35 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
36 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
37 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
38 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
39 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
40 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
41 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
42 2858950400 Achromobacter sp. K91 Isolate Unclassified
43 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
44 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
45 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
46 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
47 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
48 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
49 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
50 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
51 2904699407
52 2906610324
53 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
54 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
55 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
56 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
57 2922425934
58 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
59 2928163908 Burkholderia sp. 567 Isolate Unclassified
60 2928170801 Burkholderia sp. 572 Isolate Unclassified
61 2929520902 Variovorax beijingensis 502 Isolate Unclassified
62 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
63 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
64 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
65 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
66 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
67 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
68 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
69 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
74 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
109 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
255 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
260 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
261 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
262 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
263 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
264 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
265 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
266 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
267 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
268 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
269 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
270 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
271 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.22
Metatranscriptomes 0
Isolates 23.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.29
Nodule 12.08
Rhizoplane 10.88
Rhizosphere 48.34
Stem 0
Stem Tuber 0
Unclassified 15.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004399 3300001989 Bacteria 5398
2 JGI25152J39213_1005545 3300002773 Bacteria 3640
3 rootH1_10089585 3300003316 Bacteria 2478
4 rootH1_10063411 3300003323 Bacteria 3311
5 Ga0055532_1001187 3300003758 Bacteria 7829
6 Ga0055532_1001626 3300003758 Bacteria 5914
7 Ga0055532_1001651 3300003758 Bacteria 5828
8 Ga0055527_1000976 3300003760 Bacteria 7013
9 Ga0055535_1001117 3300003761 Bacteria 16251
10 Ga0055535_1001195 3300003761 Bacteria 14936
11 Ga0055542_1001055 3300003762 Bacteria 17134
12 Ga0055529_1000585 3300003763 Bacteria 29254
13 Ga0055534_1006526 3300003784 Bacteria 2924
14 Ga0058692_1001705 3300003856 Bacteria 7860
15 Ga0070670_100031239 3300005331 Bacteria 4586
16 Ga0068868_100003958 3300005338 Bacteria 10340
17 Ga0070660_100000204 3300005339 Bacteria 39747
18 Ga0070675_100069257 3300005354 Bacteria 2923
19 Ga0070675_100114455 3300005354 Bacteria 2286
20 Ga0070675_100226627 3300005354 Bacteria 1629
21 Ga0070673_100235435 3300005364 Bacteria 1590
22 Ga0070659_100000406 3300005366 Bacteria 32656
23 Ga0070714_100018193 3300005435 Bacteria 5703
24 Ga0070714_100218185 3300005435 Bacteria 1752
25 Ga0070714_100325580 3300005435 Bacteria 1438
26 Ga0070694_100079824 3300005444 Bacteria 2272
27 Ga0070663_100000140 3300005455 Bacteria 35102
28 Ga0070663_100084515 3300005455 Bacteria 2339
29 Ga0070681_10175005 3300005458 Bacteria 2068
30 Ga0068867_100216305 3300005459 Bacteria 1542
31 Ga0070679_100154718 3300005530 Bacteria 2268
32 Ga0070665_100095034 3300005548 Bacteria 2985
33 Ga0068856_100004583 3300005614 Bacteria 13742
34 Ga0068859_100122625 3300005617 Bacteria 2666
35 Ga0068863_100009717 3300005841 Bacteria 9383
36 Ga0068858_100035919 3300005842 Bacteria 4596
37 Ga0068858_100078196 3300005842 Bacteria 3074
38 Ga0070717_10006534 3300006028 Bacteria 8582
39 Ga0075365_10015426 3300006038 Bacteria 4623
40 Ga0097621_100092077 3300006237 Bacteria 2538
41 Ga0075370_10000045 3300006353 Bacteria 37777
42 Ga0068871_100040461 3300006358 Bacteria 3733
43 Ga0075428_100003470 3300006844 Bacteria 17250
44 Ga0075431_100002096 3300006847 Bacteria 19056
45 Ga0075434_100025165 3300006871 Bacteria 5823
46 Ga0075429_100010685 3300006880 Bacteria 7943
47 Ga0075429_100066089 3300006880 Bacteria 3148
48 Ga0068865_100162138 3300006881 Bacteria 1707
49 Ga0097620_100122623 3300006931 Bacteria 2666
50 Ga0099824_1017862 3300006942 Bacteria 6002
51 Ga0099822_1016995 3300006943 Bacteria 7875
52 Ga0105250_10001900 3300009092 Bacteria 10842
53 Ga0105240_10007272 3300009093 Bacteria 16116
54 Ga0111539_10000519 3300009094 Bacteria 48758
55 Ga0111539_10011801 3300009094 Bacteria 10954
56 Ga0105245_10131720 3300009098 Bacteria 2346
57 Ga0105247_10043792 3300009101 Bacteria 2743
58 Ga0105247_10061512 3300009101 Bacteria 2328
59 Ga0114129_10004610 3300009147 Bacteria 19457
60 Ga0114129_10015270 3300009147 Bacteria 10930
61 Ga0105242_10148366 3300009176 Bacteria 2042
62 Ga0105248_10139300 3300009177 Bacteria 2737
63 Ga0105237_10036926 3300009545 Bacteria 4940
64 Ga0105237_10110473 3300009545 Bacteria 2741
65 Ga0099796_10004008 3300010159 Bacteria 3503
66 Ga0105239_10092032 3300010375 Bacteria 3347
67 Ga0105239_10107968 3300010375 Bacteria 3083
68 Ga0105246_10038830 3300011119 Bacteria 3204
69 Ga0105246_10040266 3300011119 Bacteria 3153
70 Ga0157373_10046347 3300013100 Bacteria 3102
71 Ga0157370_10048288 3300013104 Bacteria 4077
72 Ga0157369_10165968 3300013105 Bacteria 2329
73 Ga0157374_10016011 3300013296 Bacteria 6587
74 Ga0157374_10057060 3300013296 Bacteria 3646
75 Ga0157378_10251029 3300013297 Bacteria 1694
76 Ga0163162_10523881 3300013306 Bacteria 1315
77 Ga0157375_10052972 3300013308 Bacteria 3991
78 Ga0163163_10049393 3300014325 Bacteria 4140
79 Ga0163163_10122569 3300014325 Bacteria 2634
80 Ga0157379_10045596 3300014968 Bacteria 3913
81 Ga0157376_10143016 3300014969 Bacteria 2148
82 Ga0182006_1034852 3300015261 Bacteria 2010
83 Ga0209566_100471 3300025225 Bacteria 28914
84 Ga0209672_100054 3300025228 Bacteria 222217
85 Ga0209672_100072 3300025228 Bacteria 167942
86 Ga0209147_100085 3300025229 Bacteria 185813
87 Ga0209147_100100 3300025229 Bacteria 162747
88 Ga0209147_100278 3300025229 Bacteria 44611
89 Ga0209258_100331 3300025242 Bacteria 71624
90 Ga0209258_100823 3300025242 Bacteria 17380
91 Ga0207425_1007059 3300025245 Bacteria 3003
92 Ga0209677_101397 3300025253 Bacteria 10481
93 Ga0209148_1001031 3300025254 Bacteria 17448
94 Ga0209148_1001185 3300025254 Bacteria 14989
95 Ga0209759_1003847 3300025256 Bacteria 5815
96 Ga0209129_1001197 3300025258 Bacteria 14948
97 Ga0209233_1010498 3300025261 Bacteria 2772
98 Ga0209565_1001804 3300025263 Bacteria 8626
99 Ga0209455_1000486 3300025272 Bacteria 29217
100 Ga0209455_1001202 3300025272 Bacteria 12373
101 Ga0209455_1004805 3300025272 Bacteria 4319
102 Ga0209673_1000098 3300025273 Bacteria 193352
103 Ga0209564_1002724 3300025295 Bacteria 13321
104 Ga0209758_1009267 3300025297 Bacteria 6160
105 Ga0207647_10001128 3300025904 Bacteria 20563
106 Ga0207695_10000971 3300025913 Bacteria 51107
107 Ga0207671_10005163 3300025914 Bacteria 12148
108 Ga0207657_10000096 3300025919 Bacteria 85043
109 Ga0207657_10008768 3300025919 Bacteria 10237
110 Ga0207694_10094282 3300025924 Bacteria 2365
111 Ga0207650_10021276 3300025925 Bacteria 4585
112 Ga0207664_10166397 3300025929 Bacteria 1884
113 Ga0207664_10225195 3300025929 Bacteria 1628
114 Ga0207690_10000074 3300025932 Bacteria 87516
115 Ga0207704_10043355 3300025938 Bacteria 2656
116 Ga0207665_10176807 3300025939 Bacteria 1544
117 Ga0207689_10000541 3300025942 Bacteria 35878
118 Ga0207661_10159847 3300025944 Bacteria 1954
119 Ga0207667_10036335 3300025949 Bacteria 5280
120 Ga0207658_10074121 3300025986 Bacteria 2586
121 Ga0207677_10183837 3300026023 Bacteria 1647
122 Ga0207703_10045020 3300026035 Bacteria 3549
123 Ga0207703_10061469 3300026035 Bacteria 3075
124 Ga0207703_10265417 3300026035 Bacteria 1553
125 Ga0207678_10000061 3300026067 Bacteria 85413
126 Ga0207678_10022736 3300026067 Bacteria 5491
127 Ga0207678_10058742 3300026067 Bacteria 3309
128 Ga0207702_10000075 3300026078 Bacteria 112303
129 Ga0207641_10126067 3300026088 Bacteria 2292
130 Ga0207641_10253108 3300026088 Bacteria 1646
131 Ga0207676_10019380 3300026095 Bacteria 4963
132 Ga0207676_10357078 3300026095 Unclassified 1353
133 Ga0207683_10037796 3300026121 Bacteria 4206
134 Ga0209371_1000141 3300027312 Bacteria 118767
135 Ga0209589_1000023 3300027357 Bacteria 177856
136 Ga0209489_100032 3300027361 Bacteria 177856
137 Ga0209700_100040 3300027363 Bacteria 177856
138 Ga0209588_1000664 3300027671 Bacteria 8637
139 Ga0207428_10009051 3300027907 Bacteria 8956
140 Ga0268266_10128200 3300028379 Bacteria 2267
141 Ga0268265_10163488 3300028380 Bacteria 1894
142 Ga0268264_10131570 3300028381 Bacteria 2219
143 Ga0268264_10132818 3300028381 Bacteria 2209
144 Ga0307515_10000160 3300028794 Bacteria 164789
145 Ga0307515_10147693 3300028794 Bacteria 2479
146 Ga0268256_1000418 3300030500 Bacteria 38424
147 Ga0307508_10022380 3300031616 Bacteria 5745
148 Ga0307508_10164618 3300031616 Bacteria 1821
149 Ga0307514_10006401 3300031649 Bacteria 10269
150 Ga0307414_10148554 3300032004 Bacteria 1845
151 Ga0307510_10195166 3300033180 Bacteria 1567
152 Ga0315911_1000029 3300033442 Bacteria 82350
153 Ga0373936_0000055 3300035113 Bacteria 59785
154 Ga0373924_0065980 3300035410 Bacteria 1521
155 Ga0373925_0240423 3300037068 Bacteria 1450
156 Ga0395900_0002807 3300037418 Bacteria 19021
157 Ga0395905_0033942 3300037471 Bacteria 4792
158 Ga0395901_0004372 3300038443 Bacteria 14254
159 Ga0436365_1737690 3300039437 Bacteria 2234
160 Ga0466966_0037515 3300044684 Bacteria 3125
161 Ga0466957_0044203 3300044842 Bacteria 2699
162 Ga0495603_0023409 3300046455 Bacteria 3738
163 Ga0495603_0077939 3300046455 Bacteria 1944
164 Ga0495638_0019240 3300046460 Bacteria 4519
165 Ga0495606_0017587 3300046507 Bacteria 5397
166 Ga0495610_0005608 3300046512 Bacteria 8859
167 Ga0495616_0001007 3300046513 Bacteria 20154
168 Ga0495643_0000157 3300046522 Bacteria 110922
169 Ga0495609_0009922 3300046538 Bacteria 4588
170 Ga0495597_0007314 3300046542 Bacteria 5624
171 Ga0495656_0008718 3300046615 Bacteria 3630
172 Ga0495625_0000624 3300046660 Bacteria 51214
173 Ga0495625_0003413 3300046660 Bacteria 15889
174 Ga0495625_0017708 3300046660 Bacteria 5573
175 Ga0495635_0069429 3300046663 Bacteria 2416
176 Ga0495658_0077978 3300046683 Bacteria 1938
177 Ga0495649_0008883 3300046694 Bacteria 6015
178 Ga0495672_0001013 3300047320 Bacteria 28974
179 Ga0495676_0054938 3300047321 Bacteria 3162
180 Ga0495677_0029807 3300047445 Bacteria 1985
181 Ga0495593_0032454 3300047673 Bacteria 2846
182 Ga0495602_0145725 3300048088 Bacteria 1869
183 Ga0495614_0011292 3300048089 Bacteria 3930
184 Ga0496100_0047489 3300048903 Bacteria 2767
185 Ga0496100_0050542 3300048903 Bacteria 2694
186 Ga0496101_0005161 3300048904 Bacteria 8309
187 Ga0496101_0012573 3300048904 Bacteria 5652
188 Ga0496101_0140514 3300048904 Bacteria 1840
189 Ga0496102_0012421 3300048905 Bacteria 7369
190 Ga0496102_0015306 3300048905 Bacteria 6679
191 Ga0496103_0018252 3300048906 Bacteria 4207
192 Ga0496104_0001606 3300048907 Bacteria 19467
193 Ga0496104_0001863 3300048907 Bacteria 18258
194 Ga0496104_0003529 3300048907 Bacteria 13484
195 Ga0496105_0003369 3300048908 Bacteria 11810
196 Ga0496105_0008691 3300048908 Bacteria 7902
197 Ga0496105_0010660 3300048908 Bacteria 7230
198 Ga0496105_0022139 3300048908 Bacteria 5148
199 Ga0496105_0048592 3300048908 Bacteria 3502
200 Ga0496105_0217349 3300048908 Bacteria 1556
201 Ga0496106_0016944 3300048909 Bacteria 5392
202 Ga0496107_0022075 3300048910 Bacteria 4497
203 Ga0496108_0000313 3300048911 Bacteria 41243
204 Ga0496108_0020283 3300048911 Bacteria 5462
205 Ga0496109_0010848 3300048912 Bacteria 7799
206 Ga0496109_0017266 3300048912 Bacteria 6322
207 Ga0496110_0007965 3300048913 Bacteria 8487
208 Ga0496111_0002228 3300048914 Bacteria 11629
209 Ga0496112_0001234 3300048915 Bacteria 19296
210 Ga0496112_0044122 3300048915 Bacteria 4367
211 Ga0496113_0000593 3300048916 Bacteria 18082
212 Ga0496114_0032628 3300048917 Bacteria 4287
213 Ga0496115_0001901 3300048918 Bacteria 14914
214 Ga0496115_0126255 3300048918 Bacteria 2107
215 Ga0496116_0016297 3300048919 Bacteria 5821
216 Ga0496117_0036912 3300048920 Bacteria 3648
217 Ga0496117_0060153 3300048920 Bacteria 2620
218 Ga0496118_0018669 3300048921 Bacteria 6235
219 Ga0496118_0040108 3300048921 Bacteria 3726
220 Ga0496121_0023068 3300048924 Bacteria 6011
221 Ga0496121_0069511 3300048924 Bacteria 2841
222 Ga0496122_0094039 3300048925 Bacteria 2031
223 Ga0496123_0024780 3300048926 Bacteria 4546
224 Ga0496125_0018377 3300048928 Bacteria 6643
225 Ga0496125_0181096 3300048928 Bacteria 1404
226 Ga0496126_0013085 3300048929 Bacteria 8465
227 Ga0495678_000320 3300049459 Bacteria 51263
228 Ga0501031_0062681 3300049568 Bacteria 2423
229 Ga0501033_0167978 3300049570 Bacteria 1576
230 Ga0501037_0204725 3300049573 Bacteria 1393
231 Ga0501038_0113121 3300049574 Bacteria 2246
232 Ga0501048_0206845 3300049582 Bacteria 1392
233 Ga0501045_0155092 3300049824 Bacteria 1704
234 nmdc:mga07m45_305_c1 3300050496 Bacteria 19787
235 nmdc:mga05p37_108720_c1 3300050507 Bacteria 3411
236 nmdc:mga05p37_13825_c1 3300050507 Bacteria 9670
237 nmdc:mga09592_700_c1 3300050508 Bacteria 25671
238 nmdc:mga06r32_2597_c1 3300050510 Bacteria 16140
239 nmdc:mga08y16_441_c1 3300050511 Bacteria 38348
240 nmdc:mga08y16_63190_c1 3300050511 Bacteria 3866
241 Ga0500643_004274 3300053087 Bacteria 6532
242 Ga0500562_002045 3300053108 Bacteria 5042
243 Ga0500571_000036 3300053110 Bacteria 42725
244 Ga0500642_0032861 3300053130 Bacteria 2180
245 Ga0500658_0000033 3300053134 Bacteria 89738
246 Ga0500564_011334 3300053138 Bacteria 3930
247 Ga0500603_000763 3300053150 Bacteria 7750
248 Ga0500616_0013277 3300053153 Bacteria 4790
249 Ga0500637_0004258 3300053178 Bacteria 6760
250 Ga0500645_006763 3300053730 Bacteria 4061

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0069429 Ga0495635_0069429_79_1389 335
2 3300046683 Ga0495658_0077978 Ga0495658_0077978_160_1470 335
3 3300047673 Ga0495593_0032454 Ga0495593_0032454_161_1471 335
4 3300048089 Ga0495614_0011292 Ga0495614_0011292_67_1377 335
5 3300053110 Ga0500571_000036 Ga0500571_000036_4366_5676 335
6 3300053138 Ga0500564_011334 Ga0500564_011334_1483_2793 335
7 3300053087 Ga0500643_004274 Ga0500643_004274_318_1628 336
8 3300046460 Ga0495638_0019240 Ga0495638_0019240_803_2113 337
9 3300046513 Ga0495616_0001007 Ga0495616_0001007_4390_5700 337
10 3300048926 Ga0496123_0024780 Ga0496123_0024780_2044_3354 337
11 3300053134 Ga0500658_0000033 Ga0500658_0000033_54413_55723 337
12 3300002773 JGI25152J39213_1005545 JGI25152J39213_10055454 339
13 3300003784 Ga0055534_1006526 Ga0055534_10065263 339
14 3300025245 Ga0207425_1007059 Ga0207425_10070593 339
15 3300025258 Ga0209129_1001197 Ga0209129_100119713 339
16 3300025263 Ga0209565_1001804 Ga0209565_10018044 339
17 3300025297 Ga0209758_1009267 Ga0209758_10092674 339
18 3300053153 Ga0500616_0013277 Ga0500616_0013277_1090_2334 342
19 3300049574 Ga0501038_0113121 Ga0501038_0113121_15_1094 350
20 3300048907 Ga0496104_0001606 Ga0496104_0001606_5746_7002 355
21 3300048908 Ga0496105_0008691 Ga0496105_0008691_2929_4185 355
22 3300009545 Ga0105237_10110473 Ga0105237_101104733 356
23 3300025924 Ga0207694_10094282 Ga0207694_100942822 356
24 3300014969 Ga0157376_10143016 Ga0157376_101430162 358
25 3300005617 Ga0068859_100122625 Ga0068859_1001226252 360
26 3300006931 Ga0097620_100122623 Ga0097620_1001226232 360
27 3300026067 Ga0207678_10058742 Ga0207678_100587423 360
28 3300048904 Ga0496101_0140514 Ga0496101_0140514_68_1324 360
29 3300048919 Ga0496116_0016297 Ga0496116_0016297_2640_3896 360
30 3300009094 Ga0111539_10000519 Ga0111539_1000051950 362
31 3300005435 Ga0070714_100018193 Ga0070714_1000181932 363
32 3300006028 Ga0070717_10006534 Ga0070717_100065346 363
33 3300025929 Ga0207664_10166397 Ga0207664_101663972 363
34 3300053108 Ga0500562_002045 Ga0500562_002045_2903_4090 363
35 3300005338 Ga0068868_100003958 Ga0068868_1000039582 364
36 3300005354 Ga0070675_100069257 Ga0070675_1000692572 364
37 3300005435 Ga0070714_100218185 Ga0070714_1002181852 364
38 3300010375 Ga0105239_10092032 Ga0105239_100920322 364
39 3300013296 Ga0157374_10057060 Ga0157374_100570602 364
40 3300025929 Ga0207664_10225195 Ga0207664_102251951 364
41 3300025944 Ga0207661_10159847 Ga0207661_101598472 364
42 3300026067 Ga0207678_10022736 Ga0207678_100227364 364
43 3300026121 Ga0207683_10037796 Ga0207683_100377962 364
44 3300048904 Ga0496101_0005161 Ga0496101_0005161_6770_8020 364
45 3300048905 Ga0496102_0015306 Ga0496102_0015306_1905_3155 364
46 3300048908 Ga0496105_0022139 Ga0496105_0022139_2257_3507 364
47 3300048910 Ga0496107_0022075 Ga0496107_0022075_76_1326 364
48 3300048911 Ga0496108_0020283 Ga0496108_0020283_3004_4254 364
49 3300048912 Ga0496109_0017266 Ga0496109_0017266_2871_4121 364
50 3300048915 Ga0496112_0044122 Ga0496112_0044122_1199_2449 364
51 3300048917 Ga0496114_0032628 Ga0496114_0032628_1808_3058 364
52 3300048918 Ga0496115_0001901 Ga0496115_0001901_5773_7023 364
53 3300006038 Ga0075365_10015426 Ga0075365_100154263 365
54 3300011119 Ga0105246_10038830 Ga0105246_100388302 365
55 3300013308 Ga0157375_10052972 Ga0157375_100529722 365
56 3300014325 Ga0163163_10122569 Ga0163163_101225692 365
57 3300014968 Ga0157379_10045596 Ga0157379_100455964 365
58 3300026023 Ga0207677_10183837 Ga0207677_101838372 365
59 3300046542 Ga0495597_0007314 Ga0495597_0007314_1540_2757 365
60 3300046660 Ga0495625_0003413 Ga0495625_0003413_11965_13182 365
61 3300048908 Ga0496105_0217349 Ga0496105_0217349_147_1403 365
62 3300005331 Ga0070670_100031239 Ga0070670_1000312392 366
63 3300006871 Ga0075434_100025165 Ga0075434_1000251655 366
64 3300006880 Ga0075429_100066089 Ga0075429_1000660893 366
65 3300009101 Ga0105247_10061512 Ga0105247_100615122 366
66 3300009147 Ga0114129_10004610 Ga0114129_1000461020 366
67 3300014325 Ga0163163_10049393 Ga0163163_100493934 366
68 3300025925 Ga0207650_10021276 Ga0207650_100212765 367
69 3300025986 Ga0207658_10074121 Ga0207658_100741212 367
70 3300048903 Ga0496100_0050542 Ga0496100_0050542_559_1809 367
71 3300048904 Ga0496101_0012573 Ga0496101_0012573_2731_3981 367
72 3300048905 Ga0496102_0012421 Ga0496102_0012421_1764_3014 367
73 3300048906 Ga0496103_0018252 Ga0496103_0018252_2368_3618 367
74 3300048907 Ga0496104_0003529 Ga0496104_0003529_10009_11259 367
75 3300048908 Ga0496105_0010660 Ga0496105_0010660_2938_4188 367
76 3300048909 Ga0496106_0016944 Ga0496106_0016944_1192_2442 367
77 3300048911 Ga0496108_0000313 Ga0496108_0000313_9919_11169 367
78 3300048912 Ga0496109_0010848 Ga0496109_0010848_3946_5196 367
79 3300048913 Ga0496110_0007965 Ga0496110_0007965_6121_7371 367
80 3300048914 Ga0496111_0002228 Ga0496111_0002228_6165_7415 367
81 3300048915 Ga0496112_0001234 Ga0496112_0001234_5306_6556 367
82 3300048916 Ga0496113_0000593 Ga0496113_0000593_7875_9125 367
83 3300050507 nmdc:mga05p37_108720_c1 nmdc:mga05p37_108720_c1_1554_2804 367
84 3300053730 Ga0500645_006763 Ga0500645_006763_501_1751 367
85 3300046660 Ga0495625_0000624 Ga0495625_0000624_34232_35515 371
86 3300047321 Ga0495676_0054938 Ga0495676_0054938_297_1514 371
87 3300006844 Ga0075428_100003470 Ga0075428_10000347014 372
88 3300006847 Ga0075431_100002096 Ga0075431_10000209614 372
89 3300006880 Ga0075429_100010685 Ga0075429_1000106851 372
90 3300009147 Ga0114129_10015270 Ga0114129_100152704 372
91 3300027907 Ga0207428_10009051 Ga0207428_100090513 372
92 3300050507 nmdc:mga05p37_13825_c1 nmdc:mga05p37_13825_c1_7925_9148 372
93 3300050508 nmdc:mga09592_700_c1 nmdc:mga09592_700_c1_24398_25621 372
94 3300050510 nmdc:mga06r32_2597_c1 nmdc:mga06r32_2597_c1_5023_6246 372
95 3300050511 nmdc:mga08y16_441_c1 nmdc:mga08y16_441_c1_12364_13587 372
96 3300025253 Ga0209677_101397 Ga0209677_1013974 373
97 3300048907 Ga0496104_0001863 Ga0496104_0001863_14766_16070 373
98 3300048908 Ga0496105_0048592 Ga0496105_0048592_345_1649 373
99 3300003323 rootH1_10063411 rootH1_100634113 374
100 3300046507 Ga0495606_0017587 Ga0495606_0017587_2664_3875 374
101 3300048920 Ga0496117_0060153 Ga0496117_0060153_1213_2457 374
102 3300048921 Ga0496118_0018669 Ga0496118_0018669_1796_3040 374
103 3300048924 Ga0496121_0023068 Ga0496121_0023068_2766_4010 374
104 3300049824 Ga0501045_0155092 Ga0501045_0155092_479_1666 374
105 3300039437 Ga0436365_1737690 Ga0436365_1737690_198_1442 375
106 3300046615 Ga0495656_0008718 Ga0495656_0008718_82_1284 375
107 3300025939 Ga0207665_10176807 Ga0207665_101768071 376
108 3300048924 Ga0496121_0069511 Ga0496121_0069511_378_1628 376
109 3300025261 Ga0209233_1010498 Ga0209233_10104982 377
110 3300035113 Ga0373936_0000055 Ga0373936_0000055_53672_54913 377
111 3300046660 Ga0495625_0017708 Ga0495625_0017708_2655_3896 377
112 3300046694 Ga0495649_0008883 Ga0495649_0008883_2386_3627 377
113 3300028794 Ga0307515_10147693 Ga0307515_101476933 378
114 3300032004 Ga0307414_10148554 Ga0307414_101485543 378
115 3300006942 Ga0099824_1017862 Ga0099824_10178627 379
116 3300006943 Ga0099822_1016995 Ga0099822_10169956 379
117 3300027357 Ga0209589_1000023 Ga0209589_1000023138 379
118 3300027361 Ga0209489_100032 Ga0209489_100032138 379
119 3300027363 Ga0209700_100040 Ga0209700_100040138 379
120 3300046512 Ga0495610_0005608 Ga0495610_0005608_4115_5356 379
121 3300046522 Ga0495643_0000157 Ga0495643_0000157_25950_27191 379
122 3300046538 Ga0495609_0009922 Ga0495609_0009922_1467_2708 379
123 3300047320 Ga0495672_0001013 Ga0495672_0001013_25995_27236 379
124 3300047445 Ga0495677_0029807 Ga0495677_0029807_542_1783 379
125 3300049459 Ga0495678_000320 Ga0495678_000320_46987_48228 379
126 3300005435 Ga0070714_100325580 Ga0070714_1003255801 380
127 3300031649 Ga0307514_10006401 Ga0307514_100064014 380
128 3300035410 Ga0373924_0065980 Ga0373924_0065980_11_1222 380
129 3300037068 Ga0373925_0240423 Ga0373925_0240423_76_1287 380
130 3300026095 Ga0207676_10019380 Ga0207676_100193802 381
131 3300028381 Ga0268264_10131570 Ga0268264_101315702 381
132 3300028794 Ga0307515_10000160 Ga0307515_100001608 381
133 3300048903 Ga0496100_0047489 Ga0496100_0047489_1389_2603 381
134 3300048908 Ga0496105_0003369 Ga0496105_0003369_10213_11427 381
135 3300048918 Ga0496115_0126255 Ga0496115_0126255_727_1941 381
136 3300005354 Ga0070675_100226627 Ga0070675_1002266271 382
137 3300005455 Ga0070663_100084515 Ga0070663_1000845152 382
138 3300009094 Ga0111539_10011801 Ga0111539_100118019 382
139 3300050511 nmdc:mga08y16_63190_c1 nmdc:mga08y16_63190_c1_2488_3738 382
140 3300053130 Ga0500642_0032861 Ga0500642_0032861_126_1409 382
141 3300003758 Ga0055532_1001187 Ga0055532_10011873 383
142 3300003761 Ga0055535_1001117 Ga0055535_10011173 383
143 3300003762 Ga0055542_1001055 Ga0055542_10010554 383
144 3300003763 Ga0055529_1000585 Ga0055529_10005854 383
145 3300025228 Ga0209672_100054 Ga0209672_10005426 383
146 3300025229 Ga0209147_100085 Ga0209147_100085164 383
147 3300025242 Ga0209258_100823 Ga0209258_10082315 383
148 3300025254 Ga0209148_1001031 Ga0209148_100103115 383
149 3300025272 Ga0209455_1000486 Ga0209455_10004864 383
150 3300003856 Ga0058692_1001705 Ga0058692_10017053 384
151 3300005614 Ga0068856_100004583 Ga0068856_1000045835 384
152 3300026078 Ga0207702_10000075 Ga0207702_1000007563 384
153 3300027312 Ga0209371_1000141 Ga0209371_1000141100 384
154 3300030500 Ga0268256_1000418 Ga0268256_100041820 384
155 3300031616 Ga0307508_10164618 Ga0307508_101646182 384
156 3300033180 Ga0307510_10195166 Ga0307510_101951661 384
157 3300046455 Ga0495603_0023409 Ga0495603_0023409_1565_2821 384
158 3300053150 Ga0500603_000763 Ga0500603_000763_3543_4799 384
159 3300053178 Ga0500637_0004258 Ga0500637_0004258_517_1773 384
160 3300005339 Ga0070660_100000204 Ga0070660_10000020426 385
161 3300005366 Ga0070659_100000406 Ga0070659_10000040626 385
162 3300005842 Ga0068858_100078196 Ga0068858_1000781962 385
163 3300010375 Ga0105239_10107968 Ga0105239_101079683 385
164 3300013104 Ga0157370_10048288 Ga0157370_100482883 385
165 3300013105 Ga0157369_10165968 Ga0157369_101659681 385
166 3300025919 Ga0207657_10000096 Ga0207657_1000009653 385
167 3300025932 Ga0207690_10000074 Ga0207690_1000007426 385
168 3300026035 Ga0207703_10061469 Ga0207703_100614692 385
169 3300048920 Ga0496117_0036912 Ga0496117_0036912_669_2090 385
170 iso_pu_bacteria 2847939898 2847945966 385
171 3300038443 Ga0395901_0004372 Ga0395901_0004372_12291_13556 387
172 3300006353 Ga0075370_10000045 Ga0075370_1000004535 388
173 3300033442 Ga0315911_1000029 Ga0315911_100002959 388
174 3300050496 nmdc:mga07m45_305_c1 nmdc:mga07m45_305_c1_4083_5363 388
175 3300046455 Ga0495603_0077939 Ga0495603_0077939_32_1273 389
176 3300048928 Ga0496125_0181096 Ga0496125_0181096_122_1381 389
177 3300049582 Ga0501048_0206845 Ga0501048_0206845_29_1267 389
178 3300013306 Ga0163162_10523881 Ga0163162_105238811 390
179 3300025272 Ga0209455_1004805 Ga0209455_10048052 390
180 3300005455 Ga0070663_100000140 Ga0070663_10000014028 392
181 3300009092 Ga0105250_10001900 Ga0105250_100019008 392
182 3300025949 Ga0207667_10036335 Ga0207667_100363352 392
183 3300026067 Ga0207678_10000061 Ga0207678_1000006127 392
184 3300031616 Ga0307508_10022380 Ga0307508_100223803 392
185 3300037471 Ga0395905_0033942 Ga0395905_0033942_578_1816 392
186 3300048921 Ga0496118_0040108 Ga0496118_0040108_954_2375 392
187 3300048925 Ga0496122_0094039 Ga0496122_0094039_630_1904 392
188 iso_pu_bacteria 2738541300 2738846437 393
189 iso_pu_bacteria 2738543018 2739277786 393
190 iso_pu_bacteria 2738543030 2739346829 393
191 3300009093 Ga0105240_10007272 Ga0105240_1000727212 394
192 3300025913 Ga0207695_10000971 Ga0207695_1000097142 394
193 3300026035 Ga0207703_10265417 Ga0207703_102654171 395
194 3300037418 Ga0395900_0002807 Ga0395900_0002807_15943_17184 395
195 3300048928 Ga0496125_0018377 Ga0496125_0018377_1404_2654 396
196 3300003316 rootH1_10089585 rootH1_100895852 397
197 iso_pu_bacteria 2883291878 2883295167 397
198 3300005354 Ga0070675_100114455 Ga0070675_1001144552 398
199 3300005364 Ga0070673_100235435 Ga0070673_1002354352 398
200 3300005444 Ga0070694_100079824 Ga0070694_1000798242 398
201 3300005459 Ga0068867_100216305 Ga0068867_1002163051 398
202 3300005548 Ga0070665_100095034 Ga0070665_1000950343 398
203 3300005841 Ga0068863_100009717 Ga0068863_1000097175 398
204 3300005842 Ga0068858_100035919 Ga0068858_1000359193 398
205 3300006237 Ga0097621_100092077 Ga0097621_1000920772 398
206 3300006358 Ga0068871_100040461 Ga0068871_1000404613 398
207 3300006881 Ga0068865_100162138 Ga0068865_1001621382 398
208 3300009098 Ga0105245_10131720 Ga0105245_101317203 398
209 3300009101 Ga0105247_10043792 Ga0105247_100437922 398
210 3300009176 Ga0105242_10148366 Ga0105242_101483661 398
211 3300009177 Ga0105248_10139300 Ga0105248_101393002 398
212 3300009545 Ga0105237_10036926 Ga0105237_100369264 398
213 3300011119 Ga0105246_10040266 Ga0105246_100402663 398
214 3300013296 Ga0157374_10016011 Ga0157374_100160115 398
215 3300013297 Ga0157378_10251029 Ga0157378_102510291 398
216 3300025914 Ga0207671_10005163 Ga0207671_100051635 398
217 3300025938 Ga0207704_10043355 Ga0207704_100433552 398
218 3300025942 Ga0207689_10000541 Ga0207689_1000054125 398
219 3300026035 Ga0207703_10045020 Ga0207703_100450203 398
220 3300026088 Ga0207641_10126067 Ga0207641_101260672 398
221 3300026095 Ga0207676_10357078 Ga0207676_103570781 398
222 3300028379 Ga0268266_10128200 Ga0268266_101282002 398
223 3300028380 Ga0268265_10163488 Ga0268265_101634882 398
224 3300028381 Ga0268264_10132818 Ga0268264_101328182 398
225 3300044684 Ga0466966_0037515 Ga0466966_0037515_88_1332 398
226 iso_pu_bacteria 2513020051 2513229738 398
227 iso_pu_bacteria 2643221645 2644252242 398
228 iso_pu_bacteria 8056689827 8056695810 398
229 3300026088 Ga0207641_10253108 Ga0207641_102531082 399
230 iso_pu_bacteria 2738541307 2738883895 399
231 3300005458 Ga0070681_10175005 Ga0070681_101750053 400
232 3300005530 Ga0070679_100154718 Ga0070679_1001547182 400
233 3300013100 Ga0157373_10046347 Ga0157373_100463474 400
234 3300025904 Ga0207647_10001128 Ga0207647_100011287 400
235 3300025919 Ga0207657_10008768 Ga0207657_1000876810 400
236 3300027671 Ga0209588_1000664 Ga0209588_10006645 400
237 3300049568 Ga0501031_0062681 Ga0501031_0062681_393_1631 400
238 3300049570 Ga0501033_0167978 Ga0501033_0167978_71_1309 400
239 3300049573 Ga0501037_0204725 Ga0501037_0204725_127_1365 400
240 iso_pu_bacteria 2517572143 2517893232 400
241 iso_pu_bacteria 2728368998 2728754530 400
242 iso_pu_bacteria 2945972063 2945976724 401
243 iso_pu_bacteria 2513237096 2513656509 402
244 iso_pu_bacteria 2513237137 2513859606 402
245 iso_pu_bacteria 2513237145 2513917694 402
246 iso_pu_bacteria 2524023228 2524537194 402
247 iso_pu_bacteria 2643221658 2644329569 402
248 iso_pu_bacteria 2667528175 2671117875 402
249 iso_pu_bacteria 2791355197 2793069899 402
250 iso_pu_bacteria 2834641062 2834644053 402
251 iso_pu_bacteria 2842038055 2842039665 402
252 iso_pu_bacteria 2842045827 2842047389 402
253 iso_pu_bacteria 2858950400 2858952457 402
254 iso_pu_bacteria 2885374607 2885374824 402
255 iso_pu_bacteria 2903748898 2903755699 402
256 iso_pu_bacteria 2904690495 2904696722 402
257 iso_pu_bacteria 2904699407 2904704201 402
258 iso_pu_bacteria 2906610324 2906617561 402
259 iso_pu_bacteria 2906635258 2906642232 402
260 iso_pu_bacteria 2906660503 2906667936 402
261 iso_pu_bacteria 2908739725 2908743628 402
262 iso_pu_bacteria 2908756301 2908761342 402
263 iso_pu_bacteria 2922425934 2922429246 402
264 iso_pu_bacteria 2935630451 2935634165 402
265 iso_pu_bacteria 2941507105 2941511056 402
266 iso_pu_bacteria 2941515067 2941518440 402
267 iso_pu_bacteria 2941523033 2941527297 402
268 iso_pu_bacteria 3005474847 3005479413 402
269 iso_pu_bacteria 8003400568 8003402992 402
270 iso_pu_bacteria 8006933436 8006941745 402
271 iso_pu_bacteria 8006973647 8006981492 402
272 iso_pu_bacteria 8019555841 8019557643 402
273 iso_pu_bacteria 8019565922 8019567656 402
274 3300010159 Ga0099796_10004008 Ga0099796_100040082 403
275 3300048088 Ga0495602_0145725 Ga0495602_0145725_347_1642 403
276 iso_pu_bacteria 2643221621 2644123995 403
277 iso_pu_bacteria 8020938398 8020938896 403
278 iso_pu_bacteria 8020953355 8020953561 403
279 3300048929 Ga0496126_0013085 Ga0496126_0013085_5516_6772 404
280 iso_pu_bacteria 2513237139 2513876584 404
281 iso_pu_bacteria 2513237161 2514010920 404
282 iso_pu_bacteria 2524023210 2524465199 404
283 iso_pu_bacteria 2617270735 2617352852 404
284 iso_pu_bacteria 2802429603 2805919839 404
285 iso_pu_bacteria 2824671348 2824676147 404
286 iso_pu_bacteria 2824687955 2824691836 404
287 iso_pu_bacteria 2824696289 2824699435 404
288 iso_pu_bacteria 2824773399 2824779342 404
289 iso_pu_bacteria 2838122688 2838126419 404
290 iso_pu_bacteria 2841941048 2841943507 404
291 iso_pu_bacteria 2841949485 2841950546 404
292 iso_pu_bacteria 2841966195 2841966860 404
293 iso_pu_bacteria 2841974524 2841975610 404
294 iso_pu_bacteria 2841983080 2841988183 404
295 iso_pu_bacteria 2643221672 2644398348 405
296 iso_pu_bacteria 2876761206 2876768875 405
297 iso_pu_bacteria 2904449895 2904454665 405
298 iso_pu_bacteria 2929520902 2929524616 405
299 3300025273 Ga0209673_1000098 Ga0209673_100009827 407
300 3300025295 Ga0209564_1002724 Ga0209564_100272411 407
301 iso_pu_bacteria 2599185240 2599747744 407
302 iso_pu_bacteria 2599185355 2600209749 407
303 iso_pu_bacteria 2675903129 2676745926 407
304 iso_pu_bacteria 2863421361 2863426356 408
305 3300003758 Ga0055532_1001626 Ga0055532_10016264 409
306 3300025229 Ga0209147_100278 Ga0209147_10027839 409
307 iso_pu_bacteria 2599185239 2599741187 409
308 iso_pu_bacteria 2818991452 2819637042 409
309 iso_pu_bacteria 2870068957 2870069243 409
310 iso_pu_bacteria 2928157003 2928163193 409
311 iso_pu_bacteria 2928163908 2928170061 409
312 iso_pu_bacteria 2928170801 2928176169 409
313 iso_pu_bacteria 2981990288 2981995956 409
314 iso_pu_bacteria 641736154 642417409 409
315 iso_pu_bacteria 8018845410 8018848760 409
316 iso_pu_bacteria 8020945358 8020950466 409
317 iso_pu_bacteria 8021120328 8021127943 409
318 3300003758 Ga0055532_1001651 Ga0055532_10016514 410
319 3300003760 Ga0055527_1000976 Ga0055527_10009764 410
320 3300003761 Ga0055535_1001195 Ga0055535_10011954 410
321 3300025228 Ga0209672_100072 Ga0209672_100072141 410
322 3300025229 Ga0209147_100100 Ga0209147_100100133 410
323 3300025242 Ga0209258_100331 Ga0209258_10033142 410
324 3300025254 Ga0209148_1001185 Ga0209148_10011854 410
325 3300025256 Ga0209759_1003847 Ga0209759_10038474 410
326 3300025272 Ga0209455_1001202 Ga0209455_10012029 410
327 3300044842 Ga0466957_0044203 Ga0466957_0044203_989_2260 410
328 3300001989 JGI24739J22299_10004399 JGI24739J22299_100043994 413
329 3300015261 Ga0182006_1034852 Ga0182006_10348522 413
330 3300025225 Ga0209566_100471 Ga0209566_1004714 413
331 iso_pu_bacteria 8039098773 8039102058 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

263

446

0.89

PF07690

MFS_1

Major Facilitator Superfamily

67

305

0.83

PF06779

MFS_4

Uncharacterised MFS-type transporter YbfB

105

433

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.9028 13 401
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8974 12 398
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8934 13 401
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8919 16 403
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8909 9 401
ID Description Score Start End Superfamily
af_Q8BGC3_251_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9655 227 400 1.20.1250.20
af_E7FGJ9_372_605_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9593 227 400 1.20.1250.20
af_Q7JWI7_454_654_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9526 225 399 1.20.1250.20
af_Q9W509_423_624_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9508 224 401 1.20.1250.20
af_F1QY19_223_417_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9463 224 401 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2N0B4N4-F1-model_v4 MFS transporter 0.9141 223 400 GO:0016020
GO:0022857
AF-A0A803SMW4-F1-model_v4 FLVCR heme transporter 2 0.8913 219 406 GO:0005789
GO:0005886
GO:0022857
GO:0031966
AF-A0A0C3GTB6-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8847 11 401 GO:0016020
GO:0022857
AF-A0A522E846-F1-model_v4 MFS transporter 0.8826 223 400 GO:0016020
GO:0022857
AF-E5WKG2-F1-model_v4 deleted 0.8809 228 399

Feature Viewer

pLDDT pTM Quality
87.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map