F410475

General Info

Members Datasets Scaffolds Average Seq Length
331 226 330 75

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11457426|Ga0105245_114574261
Length 86
Sequence MARRRRIPEVPVEVRIGVQHATRELVVESTETPDAVIEAVQAALAGKTSVLTLSDERGRQVVVPADKLAYVEIGESETRRVGFGSL

Samples

Sample ID Description Type Environment
1 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
123 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 6.95
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 6.95
Rhizosphere 88.82
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10101647 3300003320 Bacteria 2826
2 Ga0070658_10194385 3300005327 Bacteria 1711
3 Ga0070658_10443367 3300005327 Bacteria 1118
4 Ga0070658_10811098 3300005327 Bacteria 813
5 Ga0070683_100391931 3300005329 Bacteria 1324
6 Ga0070683_100569212 3300005329 Bacteria 1084
7 Ga0070690_100317737 3300005330 Bacteria 1121
8 Ga0070670_101171439 3300005331 Bacteria 702
9 Ga0070680_100097045 3300005336 Bacteria 2444
10 Ga0068868_100349622 3300005338 Bacteria 1266
11 Ga0070660_100030298 3300005339 Bacteria 4059
12 Ga0070660_100176638 3300005339 Bacteria 1727
13 Ga0070660_100385714 3300005339 Bacteria 1157
14 Ga0070660_101204625 3300005339 Bacteria 642
15 Ga0070691_10317273 3300005341 Bacteria 856
16 Ga0070661_100913031 3300005344 Bacteria 725
17 Ga0070661_101397892 3300005344 Bacteria 589
18 Ga0070692_10429118 3300005345 Bacteria 841
19 Ga0070659_100068509 3300005366 Bacteria 2815
20 Ga0070659_100188915 3300005366 Bacteria 1692
21 Ga0070659_101379776 3300005366 Bacteria 626
22 Ga0070659_101498310 3300005366 Bacteria 601
23 Ga0070667_101799680 3300005367 Bacteria 576
24 Ga0070709_10086214 3300005434 Bacteria 2061
25 Ga0070714_100040837 3300005435 Bacteria 3911
26 Ga0070714_100073887 3300005435 Bacteria 2955
27 Ga0070713_100058476 3300005436 Bacteria 3215
28 Ga0070710_10100873 3300005437 Bacteria 1719
29 Ga0070711_100236383 3300005439 Bacteria 1427
30 Ga0070700_101750220 3300005441 Bacteria 534
31 Ga0070663_100619684 3300005455 Bacteria 912
32 Ga0070678_101052468 3300005456 Bacteria 750
33 Ga0070678_101779283 3300005456 Bacteria 581
34 Ga0070681_10587301 3300005458 Bacteria 1028
35 Ga0070681_11302705 3300005458 Bacteria 649
36 Ga0068867_102360305 3300005459 Bacteria 506
37 Ga0070685_10403711 3300005466 Bacteria 947
38 Ga0070685_10950936 3300005466 Bacteria 642
39 Ga0070698_102024549 3300005471 Bacteria 529
40 Ga0070699_100425680 3300005518 Bacteria 1202
41 Ga0070679_100273245 3300005530 Bacteria 1644
42 Ga0070679_100564088 3300005530 Bacteria 1082
43 Ga0070684_100269308 3300005535 Bacteria 1559
44 Ga0070684_100735555 3300005535 Bacteria 920
45 Ga0070684_100957568 3300005535 Bacteria 803
46 Ga0070684_102068903 3300005535 Bacteria 537
47 Ga0070672_102174421 3300005543 Bacteria 500
48 Ga0070686_100353949 3300005544 Bacteria 1104
49 Ga0068855_101120487 3300005563 Bacteria 822
50 Ga0070664_102385071 3300005564 Bacteria 502
51 Ga0068856_101179900 3300005614 Bacteria 782
52 Ga0070702_101409552 3300005615 Bacteria 570
53 Ga0068852_100618322 3300005616 Bacteria 1089
54 Ga0068852_101463573 3300005616 Unclassified 705
55 Ga0068864_100636340 3300005618 Bacteria 1038
56 Ga0068851_10363966 3300005834 Bacteria 844
57 Ga0068870_10480893 3300005840 Bacteria 824
58 Ga0068863_101387647 3300005841 Bacteria 710
59 Ga0075363_100103520 3300006048 Bacteria 1577
60 Ga0075364_10047712 3300006051 Bacteria 2790
61 Ga0070712_100472012 3300006175 Bacteria 1048
62 Ga0075362_10723664 3300006177 Bacteria 520
63 Ga0105245_10017504 3300009098 Bacteria 6253
64 Ga0105245_10017974 3300009098 Bacteria 6176
65 Ga0105245_11457426 3300009098 Bacteria 735
66 Ga0105247_11742562 3300009101 Bacteria 516
67 Ga0105243_10055640 3300009148 Bacteria 3143
68 Ga0105243_13131480 3300009148 Bacteria 501
69 Ga0105241_11277299 3300009174 Bacteria 698
70 Ga0105242_10239674 3300009176 Bacteria 1630
71 Ga0105242_10241685 3300009176 Bacteria 1623
72 Ga0105248_10469267 3300009177 Bacteria 1419
73 Ga0105248_12356294 3300009177 Bacteria 606
74 Ga0105237_11106156 3300009545 Bacteria 799
75 Ga0105238_11757881 3300009551 Bacteria 652
76 Ga0105238_12483569 3300009551 Bacteria 554
77 Ga0105249_10088720 3300009553 Bacteria 2889
78 Ga0105239_13560150 3300010375 Bacteria 506
79 Ga0157371_10468115 3300013102 Bacteria 928
80 Ga0157369_10640954 3300013105 Bacteria 1096
81 Ga0157374_10477132 3300013296 Bacteria 1250
82 Ga0163162_10379482 3300013306 Bacteria 1547
83 Ga0157372_10128746 3300013307 Bacteria 2911
84 Ga0157372_11482520 3300013307 Unclassified 782
85 Ga0157372_11770466 3300013307 Bacteria 710
86 Ga0157375_10153496 3300013308 Bacteria 2440
87 Ga0157375_10161344 3300013308 Bacteria 2383
88 Ga0163163_10175818 3300014325 Bacteria 2187
89 Ga0157380_10798685 3300014326 Bacteria 960
90 Ga0182008_10368712 3300014497 Bacteria 765
91 Ga0182008_10484236 3300014497 Bacteria 678
92 Ga0157379_10211843 3300014968 Bacteria 1754
93 Ga0197907_11420726 3300020069 Bacteria 628
94 Ga0197907_11482230 3300020069 Bacteria 512
95 Ga0206356_10073447 3300020070 Bacteria 1619
96 Ga0206354_10276568 3300020081 Unclassified 502
97 Ga0206354_10684908 3300020081 Bacteria 1009
98 Ga0206354_10881704 3300020081 Bacteria 1401
99 Ga0206353_10152529 3300020082 Bacteria 3739
100 Ga0206353_10570134 3300020082 Bacteria 1908
101 Ga0206353_10759628 3300020082 Bacteria 7026
102 Ga0213876_10027177 3300021384 Bacteria 3020
103 Ga0224712_10037292 3300022467 Bacteria 1808
104 Ga0224712_10043186 3300022467 Bacteria 1712
105 Ga0207656_10138399 3300025321 Unclassified 1146
106 Ga0207692_10109584 3300025898 Bacteria 1529
107 Ga0207647_10354254 3300025904 Bacteria 831
108 Ga0207699_10112388 3300025906 Bacteria 1748
109 Ga0207705_10081278 3300025909 Bacteria 2362
110 Ga0207654_11426603 3300025911 Bacteria 505
111 Ga0207707_10635711 3300025912 Bacteria 901
112 Ga0207707_11563682 3300025912 Bacteria 520
113 Ga0207671_10773753 3300025914 Bacteria 762
114 Ga0207693_11241526 3300025915 Bacteria 560
115 Ga0207663_10513193 3300025916 Bacteria 932
116 Ga0207660_10065875 3300025917 Bacteria 2619
117 Ga0207657_10074248 3300025919 Bacteria 2872
118 Ga0207657_10301797 3300025919 Bacteria 1268
119 Ga0207657_10405163 3300025919 Bacteria 1072
120 Ga0207649_11014725 3300025920 Bacteria 653
121 Ga0207652_10622090 3300025921 Bacteria 967
122 Ga0207694_11040334 3300025924 Unclassified 693
123 Ga0207687_10016249 3300025927 Bacteria 4888
124 Ga0207687_10199638 3300025927 Bacteria 1562
125 Ga0207700_10021330 3300025928 Bacteria 4421
126 Ga0207664_10057525 3300025929 Bacteria 3091
127 Ga0207664_10373758 3300025929 Bacteria 1264
128 Ga0207690_10198657 3300025932 Bacteria 1521
129 Ga0207690_10773097 3300025932 Bacteria 793
130 Ga0207690_10830045 3300025932 Bacteria 765
131 Ga0207686_10144068 3300025934 Bacteria 1650
132 Ga0207686_10146593 3300025934 Bacteria 1638
133 Ga0207709_10294997 3300025935 Bacteria 1203
134 Ga0207709_11357811 3300025935 Bacteria 588
135 Ga0207669_11862891 3300025937 Bacteria 514
136 Ga0207704_10923495 3300025938 Bacteria 735
137 Ga0207691_11393796 3300025940 Bacteria 576
138 Ga0207711_10398460 3300025941 Bacteria 1279
139 Ga0207711_11892735 3300025941 Bacteria 539
140 Ga0207661_11590983 3300025944 Bacteria 598
141 Ga0207667_11008832 3300025949 Bacteria 819
142 Ga0207712_10908678 3300025961 Bacteria 778
143 Ga0207668_11415139 3300025972 Bacteria 627
144 Ga0207658_11639685 3300025986 Bacteria 588
145 Ga0207677_10537294 3300026023 Bacteria 1017
146 Ga0207678_10602202 3300026067 Bacteria 963
147 Ga0207708_10266989 3300026075 Bacteria 1383
148 Ga0207708_11270637 3300026075 Bacteria 644
149 Ga0207702_12241043 3300026078 Bacteria 535
150 Ga0207648_11663543 3300026089 Bacteria 600
151 Ga0207675_100542263 3300026118 Bacteria 1162
152 Ga0268266_10153246 3300028379 Bacteria 2080
153 Ga0307509_10009352 3300031507 Bacteria 12283
154 Ga0307408_102152688 3300031548 Bacteria 538
155 Ga0316575_10000490 3300031665 Bacteria 11470
156 Ga0316579_10016600 3300031691 Bacteria 3219
157 Ga0316576_10000810 3300031727 Bacteria 15787
158 Ga0316578_10047706 3300031728 Bacteria 2499
159 Ga0316577_10044485 3300031733 Bacteria 2483
160 Ga0307413_10720152 3300031824 Bacteria 831
161 Ga0307410_10328307 3300031852 Bacteria 1216
162 Ga0307407_10446895 3300031903 Bacteria 937
163 Ga0307407_11247176 3300031903 Bacteria 582
164 Ga0307407_11503943 3300031903 Bacteria 532
165 Ga0307409_100026299 3300031995 Bacteria 4101
166 Ga0307409_100903235 3300031995 Bacteria 897
167 Ga0307409_102503672 3300031995 Bacteria 545
168 Ga0307416_101045524 3300032002 Bacteria 920
169 Ga0307416_101532518 3300032002 Bacteria 772
170 Ga0307416_103484893 3300032002 Unclassified 526
171 Ga0307411_10009337 3300032005 Bacteria 5151
172 Ga0316585_10002619 3300032137 Bacteria 4874
173 Ga0316580_10004255 3300032139 Bacteria 4138
174 Ga0316593_10028322 3300032168 Bacteria 1805
175 Ga0307507_10000020 3300033179 Bacteria 220880
176 Ga0316592_1010047 3300033524 Bacteria 1901
177 Ga0316596_1018145 3300033541 Bacteria 1776
178 Ga0316574_0020028 3300035398 Bacteria 3954
179 Ga0316582_0057848 3300036647 Bacteria 2477
180 Ga0316584_0019343 3300036712 Bacteria 4922
181 Ga0316584_0166612 3300036712 Bacteria 1636
182 Ga0395900_1275000 3300037418 Bacteria 649
183 Ga0395898_0022534 3300037466 Bacteria 6378
184 Ga0395898_0102534 3300037466 Bacteria 2747
185 Ga0395898_0996443 3300037466 Bacteria 774
186 Ga0316581_0002136 3300037588 Bacteria 4652
187 Ga0395901_0523252 3300038443 Bacteria 1205
188 Ga0395901_0747992 3300038443 Bacteria 971
189 Ga0395901_1376889 3300038443 Bacteria 665
190 Ga0395901_1722033 3300038443 Bacteria 578
191 Ga0436365_1066991 3300039437 Bacteria 4794
192 Ga0436363_0619094 3300039450 Bacteria 1110
193 Ga0451793_1003043 3300041452 Bacteria 584
194 Ga0451841_1458719 3300041498 Bacteria 506
195 Ga0451853_1802447 3300041512 Bacteria 665
196 Ga0439448_0026187 3300042005 Bacteria 1833
197 Ga0439448_0136209 3300042005 Bacteria 848
198 Ga0466969_0044126 3300044656 Bacteria 2219
199 Ga0466969_0379141 3300044656 Bacteria 641
200 Ga0466972_0121416 3300044658 Bacteria 1232
201 Ga0466965_0797174 3300044683 Bacteria 546
202 Ga0466966_0044100 3300044684 Bacteria 2856
203 Ga0466966_0541536 3300044684 Bacteria 700
204 Ga0466961_0015613 3300044693 Bacteria 4873
205 Ga0466963_0767045 3300044694 Bacteria 680
206 Ga0466964_0259448 3300044706 Bacteria 860
207 Ga0466964_0565828 3300044706 Bacteria 619
208 Ga0466971_0012893 3300044719 Bacteria 3666
209 Ga0466957_0100006 3300044842 Bacteria 1827
210 Ga0466960_0085346 3300044901 Bacteria 1599
211 Ga0466960_0349758 3300044901 Bacteria 843
212 Ga0466959_0004825 3300045049 Bacteria 9109
213 Ga0466959_0435297 3300045049 Bacteria 890
214 Ga0466958_0162525 3300045836 Bacteria 1411
215 Ga0466967_0049493 3300045976 Bacteria 3675
216 Ga0466967_0223605 3300045976 Bacteria 1790
217 Ga0495592_0176060 3300046454 Bacteria 1461
218 Ga0495592_0203389 3300046454 Bacteria 1335
219 Ga0495651_0000788 3300046462 Bacteria 24613
220 Ga0495651_0001130 3300046462 Bacteria 20647
221 Ga0495582_0375781 3300046473 Bacteria 819
222 Ga0495664_0298617 3300046477 Bacteria 972
223 Ga0495608_0293324 3300046511 Bacteria 1008
224 Ga0495618_0015631 3300046514 Bacteria 4634
225 Ga0495628_0002650 3300046516 Bacteria 16055
226 Ga0495628_0258039 3300046516 Bacteria 1299
227 Ga0495652_0001569 3300046529 Bacteria 25007
228 Ga0495652_0002055 3300046529 Bacteria 21299
229 Ga0495665_0518486 3300046531 Bacteria 600
230 Ga0495586_0362991 3300046535 Bacteria 832
231 Ga0495645_0201375 3300046543 Bacteria 1350
232 Ga0495645_0268527 3300046543 Bacteria 1126
233 Ga0495634_0073489 3300046642 Bacteria 2248
234 Ga0495634_0537317 3300046642 Bacteria 683
235 Ga0495635_0119237 3300046663 Bacteria 1800
236 Ga0495635_0251476 3300046663 Bacteria 1191
237 Ga0495657_0113569 3300046675 Bacteria 1713
238 Ga0495599_0322541 3300046678 Bacteria 929
239 Ga0495623_0161141 3300046679 Bacteria 1318
240 Ga0495646_0129834 3300046680 Bacteria 1419
241 Ga0495670_0322235 3300046691 Bacteria 830
242 Ga0495600_0046140 3300046809 Bacteria 2843
243 Ga0495600_0269365 3300046809 Bacteria 1080
244 Ga0495581_0473626 3300047315 Bacteria 729
245 Ga0495604_0034056 3300047317 Bacteria 4030
246 Ga0495674_0530167 3300047319 Bacteria 939
247 Ga0495602_0225805 3300048088 Bacteria 1410
248 Ga0496100_0978651 3300048903 Bacteria 665
249 Ga0496101_0100033 3300048904 Bacteria 2169
250 Ga0496101_0235603 3300048904 Bacteria 1424
251 Ga0496104_0216636 3300048907 Bacteria 1826
252 Ga0496105_0316592 3300048908 Bacteria 1251
253 Ga0496106_0525219 3300048909 Bacteria 950
254 Ga0496107_0408198 3300048910 Bacteria 1010
255 Ga0496108_0133838 3300048911 Bacteria 2131
256 Ga0496108_0483806 3300048911 Bacteria 1081
257 Ga0496109_0029073 3300048912 Bacteria 4947
258 Ga0496109_1717961 3300048912 Bacteria 561
259 Ga0496110_0110628 3300048913 Bacteria 2468
260 Ga0496110_0569662 3300048913 Bacteria 1028
261 Ga0496111_0572429 3300048914 Bacteria 828
262 Ga0496111_0632915 3300048914 Bacteria 781
263 Ga0496111_0873559 3300048914 Bacteria 648
264 Ga0496112_0486320 3300048915 Bacteria 1170
265 Ga0496113_0040984 3300048916 Bacteria 3414
266 Ga0496114_0007108 3300048917 Bacteria 8832
267 Ga0496114_0535864 3300048917 Bacteria 1035
268 Ga0496114_0876822 3300048917 Bacteria 778
269 Ga0496115_0220797 3300048918 Bacteria 1564
270 Ga0501036_1084221 3300049572 Bacteria 654
271 Ga0501038_0343778 3300049574 Bacteria 1163
272 Ga0501038_1070314 3300049574 Bacteria 590
273 Ga0501039_0075963 3300049575 Bacteria 2612
274 Ga0501039_0217401 3300049575 Bacteria 1503
275 Ga0501039_0490486 3300049575 Bacteria 965
276 Ga0501040_0399169 3300049576 Bacteria 987
277 Ga0501040_0595450 3300049576 Bacteria 799
278 Ga0501041_0039758 3300049577 Bacteria 2854
279 Ga0501041_0475563 3300049577 Bacteria 794
280 Ga0501041_0521087 3300049577 Bacteria 757
281 Ga0501042_0783263 3300049578 Bacteria 694
282 Ga0501046_0093923 3300049580 Bacteria 2305
283 Ga0501047_0001309 3300049581 Bacteria 24549
284 Ga0501048_0042502 3300049582 Bacteria 3254
285 Ga0501048_0131758 3300049582 Bacteria 1767
286 Ga0501048_0302526 3300049582 Bacteria 1138
287 Ga0501048_0309737 3300049582 Bacteria 1124
288 Ga0501071_0462533 3300049587 Bacteria 971
289 Ga0501071_0531997 3300049587 Bacteria 902
290 Ga0501071_1178764 3300049587 Bacteria 592
291 Ga0501071_1619695 3300049587 Bacteria 500
292 Ga0501072_0053532 3300049588 Bacteria 3178
293 Ga0501074_1289853 3300049590 Bacteria 512
294 Ga0501075_0029495 3300049591 Bacteria 4058
295 Ga0501075_0668136 3300049591 Bacteria 792
296 Ga0501075_1560658 3300049591 Unclassified 500
297 Ga0501076_0039235 3300049592 Bacteria 3718
298 Ga0501076_0441734 3300049592 Bacteria 1071
299 Ga0501077_0038788 3300049593 Bacteria 3034
300 Ga0501079_0184048 3300049741 Bacteria 1631
301 Ga0501080_0706840 3300049742 Bacteria 889
302 Ga0501081_0971298 3300049743 Bacteria 641
303 Ga0501083_1169213 3300049744 Unclassified 501
304 Ga0501045_0028409 3300049824 Bacteria 4035
305 Ga0501045_1274724 3300049824 Bacteria 535
306 nmdc:mga03n38_150596_c1 3300050490 Bacteria 1170
307 nmdc:mga00v17_18381_c1 3300050491 Bacteria 3969
308 Ga0495601_0045834 3300053077 Bacteria 2751
309 Ga0495601_0276692 3300053077 Bacteria 1094
310 Ga0495612_0010500 3300053078 Bacteria 3741
311 Ga0495612_0107394 3300053078 Bacteria 1192
312 Ga0495619_0093922 3300053085 Bacteria 2034
313 Ga0495619_0584683 3300053085 Bacteria 764
314 Ga0587073_0267112 3300059492 Bacteria 543
315 Ga0587092_150718 3300059512 Bacteria 519
316 Ga0587122_054839 3300059628 Bacteria 524
317 Ga0587128_126659 3300059630 Bacteria 561
318 Ga0587062_070854 3300059639 Bacteria 630
319 Ga0587067_183854 3300059640 Bacteria 546
320 Ga0587075_122153 3300059644 Bacteria 540
321 Ga0587079_197711 3300059647 Bacteria 547
322 Ga0587111_0055081 3300060346 Bacteria 888
323 Ga0501082_0258600 3300060353 Bacteria 1514
324 Ga0466962_0000226 3300061719 Bacteria 23463
325 Ga0530510_0110182 3300061734 Bacteria 2016
326 Ga0530510_0321090 3300061734 Bacteria 1161
327 Ga0530510_0398786 3300061734 Bacteria 1037
328 Ga0530510_0569224 3300061734 Bacteria 861
329 Ga0530510_1116505 3300061734 Bacteria 604
330 Ga0530510_1167272 3300061734 Bacteria 590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2868088558 2868090409 57
2 3300046678 Ga0495599_0322541 Ga0495599_0322541_677_907 71
3 3300005327 Ga0070658_10194385 Ga0070658_101943853 73
4 3300005327 Ga0070658_10443367 Ga0070658_104433672 73
5 3300005327 Ga0070658_10811098 Ga0070658_108110981 73
6 3300005339 Ga0070660_100030298 Ga0070660_1000302985 73
7 3300005339 Ga0070660_100176638 Ga0070660_1001766381 73
8 3300005339 Ga0070660_101204625 Ga0070660_1012046252 73
9 3300005366 Ga0070659_100068509 Ga0070659_1000685094 73
10 3300005366 Ga0070659_101379776 Ga0070659_1013797761 73
11 3300005455 Ga0070663_100619684 Ga0070663_1006196842 73
12 3300005471 Ga0070698_102024549 Ga0070698_1020245491 73
13 3300005518 Ga0070699_100425680 Ga0070699_1004256802 73
14 3300005563 Ga0068855_101120487 Ga0068855_1011204872 73
15 3300005616 Ga0068852_101463573 Ga0068852_1014635732 73
16 3300009174 Ga0105241_11277299 Ga0105241_112772992 73
17 3300009545 Ga0105237_11106156 Ga0105237_111061563 73
18 3300009551 Ga0105238_12483569 Ga0105238_124835692 73
19 3300025904 Ga0207647_10354254 Ga0207647_103542541 73
20 3300025909 Ga0207705_10081278 Ga0207705_100812782 73
21 3300025911 Ga0207654_11426603 Ga0207654_114266032 73
22 3300025914 Ga0207671_10773753 Ga0207671_107737531 73
23 3300025919 Ga0207657_10074248 Ga0207657_100742482 73
24 3300025919 Ga0207657_10405163 Ga0207657_104051633 73
25 3300025932 Ga0207690_10198657 Ga0207690_101986573 73
26 3300025949 Ga0207667_11008832 Ga0207667_110088322 73
27 3300026067 Ga0207678_10602202 Ga0207678_106022022 73
28 3300031665 Ga0316575_10000490 Ga0316575_100004902 73
29 3300031691 Ga0316579_10016600 Ga0316579_100166002 73
30 3300031727 Ga0316576_10000810 Ga0316576_1000081012 73
31 3300031728 Ga0316578_10047706 Ga0316578_100477062 73
32 3300031733 Ga0316577_10044485 Ga0316577_100444852 73
33 3300031903 Ga0307407_10446895 Ga0307407_104468953 73
34 3300031995 Ga0307409_100903235 Ga0307409_1009032352 73
35 3300032002 Ga0307416_103484893 Ga0307416_1034848932 73
36 3300032137 Ga0316585_10002619 Ga0316585_100026193 73
37 3300032139 Ga0316580_10004255 Ga0316580_100042554 73
38 3300032168 Ga0316593_10028322 Ga0316593_100283223 73
39 3300033524 Ga0316592_1010047 Ga0316592_10100473 73
40 3300033541 Ga0316596_1018145 Ga0316596_10181452 73
41 3300035398 Ga0316574_0020028 Ga0316574_0020028_2736_2957 73
42 3300036647 Ga0316582_0057848 Ga0316582_0057848_1049_1270 73
43 3300036712 Ga0316584_0019343 Ga0316584_0019343_1203_1424 73
44 3300036712 Ga0316584_0166612 Ga0316584_0166612_1290_1511 73
45 3300037466 Ga0395898_0996443 Ga0395898_0996443_277_498 73
46 3300037588 Ga0316581_0002136 Ga0316581_0002136_2863_3084 73
47 3300038443 Ga0395901_1376889 Ga0395901_1376889_363_584 73
48 3300038443 Ga0395901_1722033 Ga0395901_1722033_221_442 73
49 3300042005 Ga0439448_0026187 Ga0439448_0026187_1366_1587 73
50 3300042005 Ga0439448_0136209 Ga0439448_0136209_287_508 73
51 3300044658 Ga0466972_0121416 Ga0466972_0121416_366_587 73
52 3300044706 Ga0466964_0259448 Ga0466964_0259448_409_630 73
53 3300059492 Ga0587073_0267112 Ga0587073_0267112_223_444 73
54 3300059512 Ga0587092_150718 Ga0587092_150718_166_387 73
55 3300059628 Ga0587122_054839 Ga0587122_054839_133_354 73
56 3300059630 Ga0587128_126659 Ga0587128_126659_213_434 73
57 3300059639 Ga0587062_070854 Ga0587062_070854_235_456 73
58 3300059640 Ga0587067_183854 Ga0587067_183854_123_344 73
59 3300059644 Ga0587075_122153 Ga0587075_122153_139_360 73
60 3300059647 Ga0587079_197711 Ga0587079_197711_188_409 73
61 3300060346 Ga0587111_0055081 Ga0587111_0055081_341_562 73
62 3300005336 Ga0070680_100097045 Ga0070680_1000970453 74
63 3300005339 Ga0070660_100385714 Ga0070660_1003857142 74
64 3300005341 Ga0070691_10317273 Ga0070691_103172732 74
65 3300005344 Ga0070661_100913031 Ga0070661_1009130312 74
66 3300005345 Ga0070692_10429118 Ga0070692_104291182 74
67 3300005366 Ga0070659_100188915 Ga0070659_1001889152 74
68 3300005435 Ga0070714_100073887 Ga0070714_1000738874 74
69 3300005441 Ga0070700_101750220 Ga0070700_1017502202 74
70 3300005458 Ga0070681_10587301 Ga0070681_105873012 74
71 3300005530 Ga0070679_100273245 Ga0070679_1002732452 74
72 3300005535 Ga0070684_102068903 Ga0070684_1020689031 74
73 3300005614 Ga0068856_101179900 Ga0068856_1011799002 74
74 3300006048 Ga0075363_100103520 Ga0075363_1001035203 74
75 3300006051 Ga0075364_10047712 Ga0075364_100477124 74
76 3300006177 Ga0075362_10723664 Ga0075362_107236642 74
77 3300009551 Ga0105238_11757881 Ga0105238_117578812 74
78 3300013102 Ga0157371_10468115 Ga0157371_104681152 74
79 3300013105 Ga0157369_10640954 Ga0157369_106409542 74
80 3300013307 Ga0157372_10128746 Ga0157372_101287463 74
81 3300013307 Ga0157372_11770466 Ga0157372_117704661 74
82 3300014497 Ga0182008_10484236 Ga0182008_104842362 74
83 3300020069 Ga0197907_11420726 Ga0197907_114207261 74
84 3300020069 Ga0197907_11482230 Ga0197907_114822301 74
85 3300020070 Ga0206356_10073447 Ga0206356_100734471 74
86 3300020081 Ga0206354_10684908 Ga0206354_106849082 74
87 3300020082 Ga0206353_10152529 Ga0206353_101525293 74
88 3300021384 Ga0213876_10027177 Ga0213876_100271774 74
89 3300022467 Ga0224712_10037292 Ga0224712_100372921 74
90 3300025912 Ga0207707_10635711 Ga0207707_106357111 74
91 3300025917 Ga0207660_10065875 Ga0207660_100658752 74
92 3300025919 Ga0207657_10301797 Ga0207657_103017972 74
93 3300025921 Ga0207652_10622090 Ga0207652_106220902 74
94 3300025924 Ga0207694_11040334 Ga0207694_110403342 74
95 3300025929 Ga0207664_10057525 Ga0207664_100575252 74
96 3300025932 Ga0207690_10773097 Ga0207690_107730972 74
97 3300026075 Ga0207708_10266989 Ga0207708_102669894 74
98 3300026078 Ga0207702_12241043 Ga0207702_122410431 74
99 3300031995 Ga0307409_102503672 Ga0307409_1025036721 74
100 3300037418 Ga0395900_1275000 Ga0395900_1275000_318_542 74
101 3300037466 Ga0395898_0022534 Ga0395898_0022534_22_246 74
102 3300037466 Ga0395898_0102534 Ga0395898_0102534_59_283 74
103 3300038443 Ga0395901_0747992 Ga0395901_0747992_11_235 74
104 3300039437 Ga0436365_1066991 Ga0436365_1066991_2686_2910 74
105 3300039450 Ga0436363_0619094 Ga0436363_0619094_783_1007 74
106 3300044683 Ga0466965_0797174 Ga0466965_0797174_18_242 74
107 3300044684 Ga0466966_0541536 Ga0466966_0541536_345_569 74
108 3300044706 Ga0466964_0565828 Ga0466964_0565828_171_395 74
109 3300044842 Ga0466957_0100006 Ga0466957_0100006_1078_1302 74
110 3300044901 Ga0466960_0085346 Ga0466960_0085346_546_770 74
111 3300044901 Ga0466960_0349758 Ga0466960_0349758_292_516 74
112 3300045049 Ga0466959_0435297 Ga0466959_0435297_243_467 74
113 3300045976 Ga0466967_0049493 Ga0466967_0049493_482_706 74
114 3300045976 Ga0466967_0223605 Ga0466967_0223605_595_819 74
115 3300046454 Ga0495592_0176060 Ga0495592_0176060_581_805 74
116 3300046462 Ga0495651_0001130 Ga0495651_0001130_14081_14305 74
117 3300046516 Ga0495628_0002650 Ga0495628_0002650_13342_13566 74
118 3300046529 Ga0495652_0002055 Ga0495652_0002055_17973_18197 74
119 3300046531 Ga0495665_0518486 Ga0495665_0518486_190_414 74
120 3300046543 Ga0495645_0201375 Ga0495645_0201375_780_1004 74
121 3300046642 Ga0495634_0537317 Ga0495634_0537317_416_640 74
122 3300046663 Ga0495635_0251476 Ga0495635_0251476_892_1116 74
123 3300046675 Ga0495657_0113569 Ga0495657_0113569_118_342 74
124 3300046809 Ga0495600_0046140 Ga0495600_0046140_1641_1865 74
125 3300047315 Ga0495581_0473626 Ga0495581_0473626_491_715 74
126 3300047317 Ga0495604_0034056 Ga0495604_0034056_1372_1596 74
127 3300047319 Ga0495674_0530167 Ga0495674_0530167_597_821 74
128 3300048903 Ga0496100_0978651 Ga0496100_0978651_364_588 74
129 3300048904 Ga0496101_0100033 Ga0496101_0100033_406_630 74
130 3300048911 Ga0496108_0483806 Ga0496108_0483806_613_837 74
131 3300048912 Ga0496109_1717961 Ga0496109_1717961_197_421 74
132 3300048913 Ga0496110_0569662 Ga0496110_0569662_599_823 74
133 3300048914 Ga0496111_0572429 Ga0496111_0572429_469_693 74
134 3300048917 Ga0496114_0876822 Ga0496114_0876822_386_610 74
135 3300048918 Ga0496115_0220797 Ga0496115_0220797_388_612 74
136 3300049574 Ga0501038_1070314 Ga0501038_1070314_56_280 74
137 3300049575 Ga0501039_0217401 Ga0501039_0217401_709_933 74
138 3300049575 Ga0501039_0490486 Ga0501039_0490486_620_844 74
139 3300049576 Ga0501040_0399169 Ga0501040_0399169_667_891 74
140 3300049576 Ga0501040_0595450 Ga0501040_0595450_49_273 74
141 3300049577 Ga0501041_0475563 Ga0501041_0475563_560_784 74
142 3300049577 Ga0501041_0521087 Ga0501041_0521087_491_715 74
143 3300049578 Ga0501042_0783263 Ga0501042_0783263_413_637 74
144 3300049581 Ga0501047_0001309 Ga0501047_0001309_8600_8824 74
145 3300049582 Ga0501048_0131758 Ga0501048_0131758_277_501 74
146 3300049582 Ga0501048_0302526 Ga0501048_0302526_903_1127 74
147 3300049587 Ga0501071_0531997 Ga0501071_0531997_464_688 74
148 3300049587 Ga0501071_1178764 Ga0501071_1178764_37_261 74
149 3300049587 Ga0501071_1619695 Ga0501071_1619695_148_372 74
150 3300049590 Ga0501074_1289853 Ga0501074_1289853_263_487 74
151 3300049591 Ga0501075_0668136 Ga0501075_0668136_380_604 74
152 3300049591 Ga0501075_1560658 Ga0501075_1560658_135_359 74
153 3300049592 Ga0501076_0441734 Ga0501076_0441734_459_683 74
154 3300049824 Ga0501045_1274724 Ga0501045_1274724_15_239 74
155 3300050490 nmdc:mga03n38_150596_c1 nmdc:mga03n38_150596_c1_433_657 74
156 3300050491 nmdc:mga00v17_18381_c1 nmdc:mga00v17_18381_c1_1110_1334 74
157 3300053077 Ga0495601_0045834 Ga0495601_0045834_1863_2087 74
158 3300061734 Ga0530510_0321090 Ga0530510_0321090_812_1036 74
159 3300061734 Ga0530510_0398786 Ga0530510_0398786_237_461 74
160 3300061734 Ga0530510_0569224 Ga0530510_0569224_88_312 74
161 3300061734 Ga0530510_1116505 Ga0530510_1116505_305_529 74
162 3300003320 rootH2_10101647 rootH2_101016474 75
163 3300005329 Ga0070683_100391931 Ga0070683_1003919312 75
164 3300005329 Ga0070683_100569212 Ga0070683_1005692122 75
165 3300005330 Ga0070690_100317737 Ga0070690_1003177372 75
166 3300005331 Ga0070670_101171439 Ga0070670_1011714391 75
167 3300005338 Ga0068868_100349622 Ga0068868_1003496221 75
168 3300005344 Ga0070661_101397892 Ga0070661_1013978921 75
169 3300005366 Ga0070659_101498310 Ga0070659_1014983102 75
170 3300005367 Ga0070667_101799680 Ga0070667_1017996802 75
171 3300005434 Ga0070709_10086214 Ga0070709_100862142 75
172 3300005435 Ga0070714_100040837 Ga0070714_1000408372 75
173 3300005436 Ga0070713_100058476 Ga0070713_1000584763 75
174 3300005437 Ga0070710_10100873 Ga0070710_101008734 75
175 3300005439 Ga0070711_100236383 Ga0070711_1002363832 75
176 3300005456 Ga0070678_101052468 Ga0070678_1010524682 75
177 3300005456 Ga0070678_101779283 Ga0070678_1017792831 75
178 3300005458 Ga0070681_11302705 Ga0070681_113027052 75
179 3300005459 Ga0068867_102360305 Ga0068867_1023603051 75
180 3300005466 Ga0070685_10403711 Ga0070685_104037111 75
181 3300005466 Ga0070685_10950936 Ga0070685_109509361 75
182 3300005530 Ga0070679_100564088 Ga0070679_1005640882 75
183 3300005535 Ga0070684_100269308 Ga0070684_1002693083 75
184 3300005535 Ga0070684_100735555 Ga0070684_1007355552 75
185 3300005535 Ga0070684_100957568 Ga0070684_1009575682 75
186 3300005543 Ga0070672_102174421 Ga0070672_1021744212 75
187 3300005544 Ga0070686_100353949 Ga0070686_1003539491 75
188 3300005564 Ga0070664_102385071 Ga0070664_1023850712 75
189 3300005615 Ga0070702_101409552 Ga0070702_1014095521 75
190 3300005616 Ga0068852_100618322 Ga0068852_1006183222 75
191 3300005618 Ga0068864_100636340 Ga0068864_1006363401 75
192 3300005834 Ga0068851_10363966 Ga0068851_103639662 75
193 3300005840 Ga0068870_10480893 Ga0068870_104808932 75
194 3300005841 Ga0068863_101387647 Ga0068863_1013876471 75
195 3300006175 Ga0070712_100472012 Ga0070712_1004720122 75
196 3300009098 Ga0105245_10017504 Ga0105245_100175047 75
197 3300009098 Ga0105245_10017974 Ga0105245_100179744 75
198 3300009098 Ga0105245_11457426 Ga0105245_114574261 75
199 3300009101 Ga0105247_11742562 Ga0105247_117425621 75
200 3300009148 Ga0105243_10055640 Ga0105243_100556402 75
201 3300009148 Ga0105243_13131480 Ga0105243_131314802 75
202 3300009176 Ga0105242_10239674 Ga0105242_102396742 75
203 3300009176 Ga0105242_10241685 Ga0105242_102416853 75
204 3300009177 Ga0105248_10469267 Ga0105248_104692672 75
205 3300009177 Ga0105248_12356294 Ga0105248_123562942 75
206 3300009553 Ga0105249_10088720 Ga0105249_100887205 75
207 3300010375 Ga0105239_13560150 Ga0105239_135601501 75
208 3300013296 Ga0157374_10477132 Ga0157374_104771322 75
209 3300013306 Ga0163162_10379482 Ga0163162_103794823 75
210 3300013307 Ga0157372_11482520 Ga0157372_114825202 75
211 3300013308 Ga0157375_10153496 Ga0157375_101534964 75
212 3300013308 Ga0157375_10161344 Ga0157375_101613443 75
213 3300014325 Ga0163163_10175818 Ga0163163_101758182 75
214 3300014326 Ga0157380_10798685 Ga0157380_107986852 75
215 3300014497 Ga0182008_10368712 Ga0182008_103687122 75
216 3300014968 Ga0157379_10211843 Ga0157379_102118432 75
217 3300020081 Ga0206354_10276568 Ga0206354_102765681 75
218 3300020081 Ga0206354_10881704 Ga0206354_108817043 75
219 3300020082 Ga0206353_10570134 Ga0206353_105701344 75
220 3300020082 Ga0206353_10759628 Ga0206353_107596284 75
221 3300022467 Ga0224712_10043186 Ga0224712_100431862 75
222 3300025321 Ga0207656_10138399 Ga0207656_101383991 75
223 3300025898 Ga0207692_10109584 Ga0207692_101095841 75
224 3300025906 Ga0207699_10112388 Ga0207699_101123882 75
225 3300025912 Ga0207707_11563682 Ga0207707_115636821 75
226 3300025915 Ga0207693_11241526 Ga0207693_112415261 75
227 3300025916 Ga0207663_10513193 Ga0207663_105131932 75
228 3300025920 Ga0207649_11014725 Ga0207649_110147252 75
229 3300025927 Ga0207687_10016249 Ga0207687_100162497 75
230 3300025927 Ga0207687_10199638 Ga0207687_101996383 75
231 3300025928 Ga0207700_10021330 Ga0207700_100213305 75
232 3300025929 Ga0207664_10373758 Ga0207664_103737582 75
233 3300025932 Ga0207690_10830045 Ga0207690_108300451 75
234 3300025934 Ga0207686_10144068 Ga0207686_101440681 75
235 3300025934 Ga0207686_10146593 Ga0207686_101465932 75
236 3300025935 Ga0207709_10294997 Ga0207709_102949971 75
237 3300025935 Ga0207709_11357811 Ga0207709_113578112 75
238 3300025937 Ga0207669_11862891 Ga0207669_118628912 75
239 3300025938 Ga0207704_10923495 Ga0207704_109234952 75
240 3300025940 Ga0207691_11393796 Ga0207691_113937962 75
241 3300025941 Ga0207711_10398460 Ga0207711_103984601 75
242 3300025941 Ga0207711_11892735 Ga0207711_118927351 75
243 3300025944 Ga0207661_11590983 Ga0207661_115909832 75
244 3300025961 Ga0207712_10908678 Ga0207712_109086781 75
245 3300025972 Ga0207668_11415139 Ga0207668_114151392 75
246 3300025986 Ga0207658_11639685 Ga0207658_116396851 75
247 3300026023 Ga0207677_10537294 Ga0207677_105372941 75
248 3300026075 Ga0207708_11270637 Ga0207708_112706371 75
249 3300026089 Ga0207648_11663543 Ga0207648_116635431 75
250 3300026118 Ga0207675_100542263 Ga0207675_1005422632 75
251 3300028379 Ga0268266_10153246 Ga0268266_101532461 75
252 3300031507 Ga0307509_10009352 Ga0307509_100093522 75
253 3300031548 Ga0307408_102152688 Ga0307408_1021526881 75
254 3300031824 Ga0307413_10720152 Ga0307413_107201522 75
255 3300031852 Ga0307410_10328307 Ga0307410_103283072 75
256 3300031903 Ga0307407_11247176 Ga0307407_112471761 75
257 3300031903 Ga0307407_11503943 Ga0307407_115039432 75
258 3300031995 Ga0307409_100026299 Ga0307409_1000262992 75
259 3300032002 Ga0307416_101045524 Ga0307416_1010455242 75
260 3300032002 Ga0307416_101532518 Ga0307416_1015325182 75
261 3300032005 Ga0307411_10009337 Ga0307411_100093375 75
262 3300033179 Ga0307507_10000020 Ga0307507_10000020188 75
263 3300038443 Ga0395901_0523252 Ga0395901_0523252_237_464 75
264 3300041452 Ga0451793_1003043 Ga0451793_1003043_192_452 75
265 3300041498 Ga0451841_1458719 Ga0451841_1458719_195_422 75
266 3300041512 Ga0451853_1802447 Ga0451853_1802447_129_356 75
267 3300044656 Ga0466969_0044126 Ga0466969_0044126_1691_1924 75
268 3300044656 Ga0466969_0379141 Ga0466969_0379141_155_382 75
269 3300044684 Ga0466966_0044100 Ga0466966_0044100_1423_1656 75
270 3300044693 Ga0466961_0015613 Ga0466961_0015613_3239_3472 75
271 3300044694 Ga0466963_0767045 Ga0466963_0767045_251_478 75
272 3300044719 Ga0466971_0012893 Ga0466971_0012893_2114_2347 75
273 3300045049 Ga0466959_0004825 Ga0466959_0004825_7317_7550 75
274 3300045836 Ga0466958_0162525 Ga0466958_0162525_73_306 75
275 3300046454 Ga0495592_0203389 Ga0495592_0203389_374_601 75
276 3300046462 Ga0495651_0000788 Ga0495651_0000788_1452_1679 75
277 3300046473 Ga0495582_0375781 Ga0495582_0375781_337_588 75
278 3300046477 Ga0495664_0298617 Ga0495664_0298617_177_404 75
279 3300046511 Ga0495608_0293324 Ga0495608_0293324_220_447 75
280 3300046514 Ga0495618_0015631 Ga0495618_0015631_1978_2205 75
281 3300046516 Ga0495628_0258039 Ga0495628_0258039_502_729 75
282 3300046529 Ga0495652_0001569 Ga0495652_0001569_5429_5656 75
283 3300046535 Ga0495586_0362991 Ga0495586_0362991_166_393 75
284 3300046543 Ga0495645_0268527 Ga0495645_0268527_330_557 75
285 3300046642 Ga0495634_0073489 Ga0495634_0073489_683_910 75
286 3300046663 Ga0495635_0119237 Ga0495635_0119237_1467_1694 75
287 3300046679 Ga0495623_0161141 Ga0495623_0161141_844_1071 75
288 3300046680 Ga0495646_0129834 Ga0495646_0129834_988_1215 75
289 3300046691 Ga0495670_0322235 Ga0495670_0322235_188_415 75
290 3300046809 Ga0495600_0269365 Ga0495600_0269365_508_735 75
291 3300048088 Ga0495602_0225805 Ga0495602_0225805_497_724 75
292 3300048904 Ga0496101_0235603 Ga0496101_0235603_626_877 75
293 3300048907 Ga0496104_0216636 Ga0496104_0216636_1388_1639 75
294 3300048908 Ga0496105_0316592 Ga0496105_0316592_982_1233 75
295 3300048909 Ga0496106_0525219 Ga0496106_0525219_79_330 75
296 3300048910 Ga0496107_0408198 Ga0496107_0408198_140_391 75
297 3300048911 Ga0496108_0133838 Ga0496108_0133838_1832_2083 75
298 3300048912 Ga0496109_0029073 Ga0496109_0029073_3476_3727 75
299 3300048913 Ga0496110_0110628 Ga0496110_0110628_976_1227 75
300 3300048914 Ga0496111_0632915 Ga0496111_0632915_92_343 75
301 3300048914 Ga0496111_0873559 Ga0496111_0873559_390_617 75
302 3300048915 Ga0496112_0486320 Ga0496112_0486320_91_318 75
303 3300048916 Ga0496113_0040984 Ga0496113_0040984_2844_3095 75
304 3300048917 Ga0496114_0007108 Ga0496114_0007108_840_1091 75
305 3300048917 Ga0496114_0535864 Ga0496114_0535864_579_839 75
306 3300049572 Ga0501036_1084221 Ga0501036_1084221_16_243 75
307 3300049574 Ga0501038_0343778 Ga0501038_0343778_780_1007 75
308 3300049575 Ga0501039_0075963 Ga0501039_0075963_900_1127 75
309 3300049577 Ga0501041_0039758 Ga0501041_0039758_1047_1274 75
310 3300049580 Ga0501046_0093923 Ga0501046_0093923_120_347 75
311 3300049582 Ga0501048_0042502 Ga0501048_0042502_66_293 75
312 3300049582 Ga0501048_0309737 Ga0501048_0309737_794_1021 75
313 3300049587 Ga0501071_0462533 Ga0501071_0462533_582_809 75
314 3300049588 Ga0501072_0053532 Ga0501072_0053532_1727_1954 75
315 3300049591 Ga0501075_0029495 Ga0501075_0029495_2396_2623 75
316 3300049592 Ga0501076_0039235 Ga0501076_0039235_99_326 75
317 3300049593 Ga0501077_0038788 Ga0501077_0038788_2174_2401 75
318 3300049741 Ga0501079_0184048 Ga0501079_0184048_1113_1340 75
319 3300049742 Ga0501080_0706840 Ga0501080_0706840_517_744 75
320 3300049743 Ga0501081_0971298 Ga0501081_0971298_104_331 75
321 3300049744 Ga0501083_1169213 Ga0501083_1169213_115_342 75
322 3300049824 Ga0501045_0028409 Ga0501045_0028409_2404_2631 75
323 3300053077 Ga0495601_0276692 Ga0495601_0276692_203_430 75
324 3300053078 Ga0495612_0010500 Ga0495612_0010500_3487_3714 75
325 3300053078 Ga0495612_0107394 Ga0495612_0107394_509_736 75
326 3300053085 Ga0495619_0093922 Ga0495619_0093922_1391_1618 75
327 3300053085 Ga0495619_0584683 Ga0495619_0584683_334_561 75
328 3300060353 Ga0501082_0258600 Ga0501082_0258600_579_806 75
329 3300061719 Ga0466962_0000226 Ga0466962_0000226_3131_3364 75
330 3300061734 Ga0530510_0110182 Ga0530510_0110182_62_289 75
331 3300061734 Ga0530510_1167272 Ga0530510_1167272_43_270 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11305

DUF3107

Protein of unknown function (DUF3107)

12

84

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rur-assembly1.cif.gz_B crystal structure of the hexadecameric form of rv3208a 0.969 1 64
7rur-assembly1.cif.gz_A crystal structure of the hexadecameric form of rv3208a 0.9508 1 63
7rus-assembly1.cif.gz_A crystal structure of the octameric form of rv3208a 0.9465 1 63
7rur-assembly1.cif.gz_C crystal structure of the hexadecameric form of rv3208a 0.9401 1 63
7rur-assembly1.cif.gz_B crystal structure of the hexadecameric form of rv3208a 0.925 1 64
ID Description Score Start End Superfamily
6gwkT00 Mainly Beta;Roll;SH3 type barrels.; 0.7174 2 65 2.30.30.100
3hfoB00 Mainly Beta;Roll;SH3 type barrels.; 0.7096 2 60 2.30.30.100
af_Q8H033_246_426_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7012 37 53 2.130.10.10
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.6911 2 61 2.30.30.60
2k57A00 Mainly Beta;Roll;SH3 type barrels.; 0.6899 2 61 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A6M8HEY9-F1-model_v4 deleted 0.965 1 73
AF-A0A1L5KR63-F1-model_v4 Uncharacterized protein 0.9593 1 65
AF-E5XQ31-F1-model_v4 ATP-binding protein 0.9576 1 74
AF-A0A3S4VBN5-F1-model_v4 Protein of uncharacterized function (DUF3107) 0.9568 1 73
AF-I9A8B3-F1-model_v4 ATP-binding protein 0.9535 1 74

Feature Viewer

pLDDT pTM Quality
87.48 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map