F410464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 244 | 662 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100177926|Ga0075431_1001779262 |
| Length | 253 |
| Sequence | VRSASRGVCACPPHGGCEAGKSVDNGYPCTTPEVYARAMRYALAILDLDGTLSDSLPWFRAHVNEVADRFGFRRVAEEDIAPLRRAGTREILAYLGVPRWKLPMIARHMRRLKAAHLAEIPLFPGTAAMLRSLHAGGIRLALVSSDSDANARAQLGPANAALISDFACGASVFGKAAKFRRVLKRAGVLPASAIAIGDEVRDIEAARAAGIACGAVTWGYAASEALSALQPDLLIGRMQDIASALLPGSDGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 96 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 99 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 100 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 101 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 102 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 103 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 107 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 112 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 121 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 178 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 179 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 180 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 205 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 208 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 210 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 211 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 212 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 213 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 214 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 215 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 216 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 217 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 218 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 219 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 221 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 222 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 223 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 224 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 226 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 227 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 228 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 229 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 233 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 234 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 235 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 236 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 237 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 238 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 239 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 240 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 241 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 242 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 243 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 244 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.37 |
| Metatranscriptomes | 0 |
| Isolates | 3.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.9 |
| Nodule | 1.81 |
| Rhizoplane | 3.93 |
| Rhizosphere | 69.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100177926 | 3300006847 | Bacteria | 2184 |
| 2 | JGI24751J29686_10067879 | 3300002459 | Bacteria | 734 |
| 3 | JGI25406J46586_10016487 | 3300003203 | Bacteria | 3078 |
| 4 | JGI25404J52841_10004730 | 3300003659 | Bacteria | 2780 |
| 5 | Ga0068869_100186976 | 3300005334 | Bacteria | 1627 |
| 6 | Ga0070680_100023988 | 3300005336 | Bacteria | 4870 |
| 7 | Ga0070689_100097211 | 3300005340 | Bacteria | 2328 |
| 8 | Ga0070689_101000642 | 3300005340 | Bacteria | 744 |
| 9 | Ga0070669_100288598 | 3300005353 | Bacteria | 1316 |
| 10 | Ga0070675_100256236 | 3300005354 | Bacteria | 1532 |
| 11 | Ga0070688_100355369 | 3300005365 | Bacteria | 1074 |
| 12 | Ga0070703_10006715 | 3300005406 | Bacteria | 3224 |
| 13 | Ga0070710_10184595 | 3300005437 | Bacteria | 1308 |
| 14 | Ga0070701_10015998 | 3300005438 | Bacteria | 3478 |
| 15 | Ga0070711_100078586 | 3300005439 | Bacteria | 2345 |
| 16 | Ga0070705_100000469 | 3300005440 | Bacteria | 23189 |
| 17 | Ga0070700_100003486 | 3300005441 | Bacteria | 8114 |
| 18 | Ga0070694_100009742 | 3300005444 | Bacteria | 5900 |
| 19 | Ga0070708_100019293 | 3300005445 | Bacteria | 5728 |
| 20 | Ga0070708_100113066 | 3300005445 | Bacteria | 2497 |
| 21 | Ga0070663_100563773 | 3300005455 | Bacteria | 953 |
| 22 | Ga0070681_10052098 | 3300005458 | Bacteria | 4082 |
| 23 | Ga0068867_100041268 | 3300005459 | Bacteria | 3372 |
| 24 | Ga0070706_100200494 | 3300005467 | Bacteria | 1864 |
| 25 | Ga0070698_100045815 | 3300005471 | Bacteria | 4475 |
| 26 | Ga0070698_100074285 | 3300005471 | Bacteria | 3405 |
| 27 | Ga0070699_100001512 | 3300005518 | Bacteria | 21269 |
| 28 | Ga0070679_100056498 | 3300005530 | Bacteria | 3911 |
| 29 | Ga0070697_100010899 | 3300005536 | Bacteria | 7100 |
| 30 | Ga0070695_100018365 | 3300005545 | Bacteria | 4247 |
| 31 | Ga0070696_100000758 | 3300005546 | Bacteria | 20714 |
| 32 | Ga0070665_100087509 | 3300005548 | Bacteria | 3121 |
| 33 | Ga0070704_100000433 | 3300005549 | Bacteria | 19573 |
| 34 | Ga0068859_100004727 | 3300005617 | Bacteria | 13833 |
| 35 | Ga0068864_100022313 | 3300005618 | Bacteria | 5307 |
| 36 | Ga0068864_100341653 | 3300005618 | Bacteria | 1411 |
| 37 | Ga0068861_100040785 | 3300005719 | Bacteria | 3474 |
| 38 | Ga0068870_10283204 | 3300005840 | Bacteria | 1040 |
| 39 | Ga0068863_100458781 | 3300005841 | Bacteria | 1251 |
| 40 | Ga0068858_100359294 | 3300005842 | Bacteria | 1396 |
| 41 | Ga0068858_100557147 | 3300005842 | Bacteria | 1110 |
| 42 | Ga0068860_100000803 | 3300005843 | Bacteria | 35288 |
| 43 | Ga0068860_100002721 | 3300005843 | Bacteria | 18394 |
| 44 | Ga0081455_10025659 | 3300005937 | Bacteria | 5435 |
| 45 | Ga0081455_10352341 | 3300005937 | Bacteria | 1038 |
| 46 | Ga0081540_1001417 | 3300005983 | Bacteria | 20744 |
| 47 | Ga0081539_10001720 | 3300005985 | Bacteria | 35012 |
| 48 | Ga0070717_10221973 | 3300006028 | Bacteria | 1661 |
| 49 | Ga0070717_10519285 | 3300006028 | Bacteria | 1077 |
| 50 | Ga0070712_100014673 | 3300006175 | Bacteria | 5029 |
| 51 | Ga0070712_100025768 | 3300006175 | Bacteria | 3912 |
| 52 | Ga0097621_100693240 | 3300006237 | Bacteria | 937 |
| 53 | Ga0068871_100060711 | 3300006358 | Bacteria | 3085 |
| 54 | Ga0075428_100088338 | 3300006844 | Bacteria | 3380 |
| 55 | Ga0075428_100199077 | 3300006844 | Bacteria | 2166 |
| 56 | Ga0075431_100005060 | 3300006847 | Bacteria | 12970 |
| 57 | Ga0075431_100143079 | 3300006847 | Bacteria | 2465 |
| 58 | Ga0075434_100024768 | 3300006871 | Bacteria | 5868 |
| 59 | Ga0075429_100050525 | 3300006880 | Bacteria | 3617 |
| 60 | Ga0075429_100320022 | 3300006880 | Bacteria | 1358 |
| 61 | Ga0097620_100004727 | 3300006931 | Bacteria | 13833 |
| 62 | Ga0075435_100029900 | 3300007076 | Bacteria | 4279 |
| 63 | Ga0099795_10013658 | 3300007788 | Bacteria | 2498 |
| 64 | Ga0111539_10234751 | 3300009094 | Bacteria | 2135 |
| 65 | Ga0105247_10109883 | 3300009101 | Bacteria | 1773 |
| 66 | Ga0105247_10143241 | 3300009101 | Bacteria | 1568 |
| 67 | Ga0114129_10228806 | 3300009147 | Bacteria | 2505 |
| 68 | Ga0105237_10072199 | 3300009545 | Bacteria | 3445 |
| 69 | Ga0105237_10104384 | 3300009545 | Bacteria | 2826 |
| 70 | Ga0105249_10005007 | 3300009553 | Bacteria | 11429 |
| 71 | Ga0105239_10152923 | 3300010375 | Bacteria | 2575 |
| 72 | Ga0105239_10214468 | 3300010375 | Bacteria | 2158 |
| 73 | Ga0105239_10488905 | 3300010375 | Bacteria | 1399 |
| 74 | Ga0163162_10085742 | 3300013306 | Bacteria | 3227 |
| 75 | Ga0157380_10201193 | 3300014326 | Bacteria | 1767 |
| 76 | Ga0157379_10334800 | 3300014968 | Bacteria | 1383 |
| 77 | Ga0157379_10349302 | 3300014968 | Bacteria | 1354 |
| 78 | Ga0209677_101509 | 3300025253 | Bacteria | 9980 |
| 79 | Ga0209148_1015375 | 3300025254 | Bacteria | 1337 |
| 80 | Ga0209233_1003122 | 3300025261 | Bacteria | 5889 |
| 81 | Ga0209455_1004192 | 3300025272 | Bacteria | 4819 |
| 82 | Ga0209455_1006331 | 3300025272 | Bacteria | 3508 |
| 83 | Ga0209455_1022963 | 3300025272 | Bacteria | 1178 |
| 84 | Ga0209758_1000079 | 3300025297 | Bacteria | 262874 |
| 85 | Ga0207653_10001684 | 3300025885 | Bacteria | 7077 |
| 86 | Ga0207710_10055350 | 3300025900 | Bacteria | 1788 |
| 87 | Ga0207688_10179736 | 3300025901 | Bacteria | 1261 |
| 88 | Ga0207647_10152287 | 3300025904 | Bacteria | 1351 |
| 89 | Ga0207643_10143816 | 3300025908 | Bacteria | 1426 |
| 90 | Ga0207684_10129053 | 3300025910 | Bacteria | 2170 |
| 91 | Ga0207654_10014902 | 3300025911 | Bacteria | 4023 |
| 92 | Ga0207707_10043293 | 3300025912 | Bacteria | 3927 |
| 93 | Ga0207693_10021392 | 3300025915 | Bacteria | 5140 |
| 94 | Ga0207693_10051326 | 3300025915 | Bacteria | 3237 |
| 95 | Ga0207663_10380340 | 3300025916 | Bacteria | 1075 |
| 96 | Ga0207660_10017046 | 3300025917 | Bacteria | 4820 |
| 97 | Ga0207652_10033793 | 3300025921 | Bacteria | 4308 |
| 98 | Ga0207681_10312881 | 3300025923 | Bacteria | 1246 |
| 99 | Ga0207650_10196878 | 3300025925 | Bacteria | 1612 |
| 100 | Ga0207687_10185480 | 3300025927 | Bacteria | 1615 |
| 101 | Ga0207670_10337805 | 3300025936 | Bacteria | 1189 |
| 102 | Ga0207689_10290695 | 3300025942 | Bacteria | 1354 |
| 103 | Ga0207712_10005811 | 3300025961 | Bacteria | 7775 |
| 104 | Ga0207703_10529067 | 3300026035 | Bacteria | 1110 |
| 105 | Ga0207639_10325534 | 3300026041 | Bacteria | 1366 |
| 106 | Ga0207678_10010914 | 3300026067 | Bacteria | 7982 |
| 107 | Ga0207708_10002051 | 3300026075 | Bacteria | 14854 |
| 108 | Ga0207641_10072937 | 3300026088 | Bacteria | 2958 |
| 109 | Ga0207641_10241702 | 3300026088 | Bacteria | 1683 |
| 110 | Ga0207676_10006855 | 3300026095 | Bacteria | 8069 |
| 111 | Ga0207674_10011187 | 3300026116 | Bacteria | 10088 |
| 112 | Ga0207674_10207179 | 3300026116 | Bacteria | 1910 |
| 113 | Ga0207675_100095767 | 3300026118 | Bacteria | 2794 |
| 114 | Ga0207675_100349956 | 3300026118 | Bacteria | 1448 |
| 115 | Ga0207675_100352012 | 3300026118 | Bacteria | 1443 |
| 116 | Ga0207683_10346873 | 3300026121 | Bacteria | 1362 |
| 117 | Ga0268266_10078879 | 3300028379 | Bacteria | 2866 |
| 118 | Ga0268266_10157770 | 3300028379 | Bacteria | 2051 |
| 119 | Ga0268266_11117588 | 3300028379 | Bacteria | 762 |
| 120 | Ga0268265_10000750 | 3300028380 | Bacteria | 31594 |
| 121 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 122 | Ga0268264_10001691 | 3300028381 | Bacteria | 20334 |
| 123 | Ga0307517_10092949 | 3300028786 | Bacteria | 2450 |
| 124 | Ga0307511_10167709 | 3300030521 | Bacteria | 1215 |
| 125 | Ga0307509_10024408 | 3300031507 | Bacteria | 6770 |
| 126 | Ga0307508_10193219 | 3300031616 | Bacteria | 1636 |
| 127 | Ga0307516_10007250 | 3300031730 | Bacteria | 12774 |
| 128 | Ga0307516_10043070 | 3300031730 | Bacteria | 4475 |
| 129 | Ga0307507_10073537 | 3300033179 | Bacteria | 3072 |
| 130 | Ga0307510_10005434 | 3300033180 | Bacteria | 15167 |
| 131 | Ga0307510_10196395 | 3300033180 | Bacteria | 1559 |
| 132 | Ga0373944_0112477 | 3300035089 | Bacteria | 931 |
| 133 | Ga0373923_0077259 | 3300035111 | Bacteria | 1439 |
| 134 | Ga0373932_0083093 | 3300035112 | Bacteria | 1015 |
| 135 | Ga0373936_0060149 | 3300035113 | Bacteria | 1549 |
| 136 | Ga0373954_0025347 | 3300035118 | Bacteria | 2710 |
| 137 | Ga0373955_0071046 | 3300035172 | Bacteria | 1946 |
| 138 | Ga0373924_0123900 | 3300035410 | Bacteria | 1122 |
| 139 | Ga0373935_0001100 | 3300035692 | Bacteria | 14763 |
| 140 | Ga0373935_0094692 | 3300035692 | Bacteria | 1960 |
| 141 | Ga0373927_0000432 | 3300035695 | Bacteria | 32114 |
| 142 | Ga0373927_0158102 | 3300035695 | Bacteria | 1484 |
| 143 | Ga0373933_0169893 | 3300035724 | Bacteria | 1387 |
| 144 | Ga0373947_0003013 | 3300035725 | Bacteria | 10042 |
| 145 | Ga0373925_0022216 | 3300037068 | Bacteria | 4626 |
| 146 | Ga0395905_0624853 | 3300037471 | Bacteria | 979 |
| 147 | Ga0436364_1104792 | 3300037853 | Bacteria | 3362 |
| 148 | Ga0436365_0626927 | 3300039437 | Bacteria | 4268 |
| 149 | Ga0436363_0901801 | 3300039450 | Bacteria | 2743 |
| 150 | Ga0466970_0135811 | 3300044765 | Bacteria | 1353 |
| 151 | Ga0466957_0178482 | 3300044842 | Bacteria | 1386 |
| 152 | Ga0466967_0039311 | 3300045976 | Bacteria | 4066 |
| 153 | Ga0495592_0161776 | 3300046454 | Bacteria | 1539 |
| 154 | Ga0495592_0403268 | 3300046454 | Bacteria | 865 |
| 155 | Ga0495603_0000067 | 3300046455 | Bacteria | 45466 |
| 156 | Ga0495629_0001667 | 3300046459 | Bacteria | 17433 |
| 157 | Ga0495638_0392307 | 3300046460 | Bacteria | 722 |
| 158 | Ga0495641_0007251 | 3300046461 | Bacteria | 6971 |
| 159 | Ga0495651_0012681 | 3300046462 | Bacteria | 6505 |
| 160 | Ga0495580_0033605 | 3300046472 | Bacteria | 3694 |
| 161 | Ga0495582_0000744 | 3300046473 | Bacteria | 18014 |
| 162 | Ga0495639_0004418 | 3300046475 | Bacteria | 6028 |
| 163 | Ga0495639_0278401 | 3300046475 | Bacteria | 831 |
| 164 | Ga0495662_0000276 | 3300046476 | Bacteria | 22020 |
| 165 | Ga0495664_0017849 | 3300046477 | Bacteria | 4058 |
| 166 | Ga0495664_0047002 | 3300046477 | Bacteria | 2561 |
| 167 | Ga0495594_0001204 | 3300046499 | Bacteria | 13519 |
| 168 | Ga0495610_0054803 | 3300046512 | Bacteria | 1925 |
| 169 | Ga0495618_0294007 | 3300046514 | Bacteria | 1010 |
| 170 | Ga0495628_0138383 | 3300046516 | Bacteria | 1859 |
| 171 | Ga0495630_0040678 | 3300046517 | Bacteria | 3474 |
| 172 | Ga0495666_0006144 | 3300046526 | Bacteria | 6043 |
| 173 | Ga0495652_0015722 | 3300046529 | Bacteria | 6773 |
| 174 | Ga0495652_0131748 | 3300046529 | Bacteria | 1978 |
| 175 | Ga0495665_0000307 | 3300046531 | Bacteria | 24786 |
| 176 | Ga0495640_0006166 | 3300046533 | Bacteria | 9503 |
| 177 | Ga0495587_0167864 | 3300046536 | Bacteria | 1247 |
| 178 | Ga0495645_0131014 | 3300046543 | Bacteria | 1757 |
| 179 | Ga0495622_0053269 | 3300046557 | Bacteria | 1877 |
| 180 | Ga0495667_0003657 | 3300046559 | Bacteria | 10350 |
| 181 | Ga0495656_0226264 | 3300046615 | Bacteria | 937 |
| 182 | Ga0495634_0026745 | 3300046642 | Bacteria | 4023 |
| 183 | Ga0495625_0091058 | 3300046660 | Bacteria | 2108 |
| 184 | Ga0495635_0033967 | 3300046663 | Bacteria | 3538 |
| 185 | Ga0495635_0084242 | 3300046663 | Bacteria | 2175 |
| 186 | Ga0495657_0024226 | 3300046675 | Bacteria | 4326 |
| 187 | Ga0495657_0169978 | 3300046675 | Bacteria | 1343 |
| 188 | Ga0495599_0027709 | 3300046678 | Bacteria | 3550 |
| 189 | Ga0495599_0272071 | 3300046678 | Bacteria | 1028 |
| 190 | Ga0495623_0090575 | 3300046679 | Bacteria | 1878 |
| 191 | Ga0495646_0021636 | 3300046680 | Bacteria | 4061 |
| 192 | Ga0495646_0027215 | 3300046680 | Bacteria | 3588 |
| 193 | Ga0495647_0000963 | 3300046681 | Bacteria | 8703 |
| 194 | Ga0495658_0000520 | 3300046683 | Bacteria | 21077 |
| 195 | Ga0495613_0067948 | 3300046689 | Bacteria | 2600 |
| 196 | Ga0495624_0004648 | 3300046690 | Bacteria | 10004 |
| 197 | Ga0495600_0060316 | 3300046809 | Bacteria | 2477 |
| 198 | Ga0495581_0000022 | 3300047315 | Bacteria | 56149 |
| 199 | Ga0495604_0002314 | 3300047317 | Bacteria | 15267 |
| 200 | Ga0495674_0001816 | 3300047319 | Bacteria | 21040 |
| 201 | Ga0495674_0072123 | 3300047319 | Bacteria | 2979 |
| 202 | Ga0495676_0072675 | 3300047321 | Bacteria | 2640 |
| 203 | Ga0495680_0094099 | 3300047322 | Bacteria | 2242 |
| 204 | Ga0495675_0016386 | 3300047444 | Bacteria | 4688 |
| 205 | Ga0495673_0034158 | 3300047469 | Bacteria | 2353 |
| 206 | Ga0495684_0216175 | 3300047471 | Bacteria | 1407 |
| 207 | Ga0495686_0000337 | 3300047472 | Bacteria | 77142 |
| 208 | Ga0495593_0000016 | 3300047673 | Bacteria | 80178 |
| 209 | Ga0495593_0259361 | 3300047673 | Bacteria | 870 |
| 210 | Ga0495593_0291465 | 3300047673 | Bacteria | 816 |
| 211 | Ga0495602_0053961 | 3300048088 | Bacteria | 3553 |
| 212 | Ga0496100_0241709 | 3300048903 | Bacteria | 1332 |
| 213 | Ga0496101_0114864 | 3300048904 | Bacteria | 2030 |
| 214 | Ga0496101_0133464 | 3300048904 | Bacteria | 1887 |
| 215 | Ga0496102_0016222 | 3300048905 | Bacteria | 6509 |
| 216 | Ga0496102_0498842 | 3300048905 | Bacteria | 1139 |
| 217 | Ga0496105_0382340 | 3300048908 | Bacteria | 1120 |
| 218 | Ga0496106_0002074 | 3300048909 | Bacteria | 15012 |
| 219 | Ga0496106_0029824 | 3300048909 | Bacteria | 4066 |
| 220 | Ga0496106_0053171 | 3300048909 | Bacteria | 3058 |
| 221 | Ga0496107_0254576 | 3300048910 | Bacteria | 1306 |
| 222 | Ga0496112_0468750 | 3300048915 | Bacteria | 1197 |
| 223 | Ga0496115_0024966 | 3300048918 | Bacteria | 4650 |
| 224 | Ga0496115_0363258 | 3300048918 | Bacteria | 1179 |
| 225 | Ga0496117_0112441 | 3300048920 | Bacteria | 1693 |
| 226 | Ga0496118_0008043 | 3300048921 | Bacteria | 11011 |
| 227 | Ga0496119_0100007 | 3300048922 | Bacteria | 1630 |
| 228 | Ga0496120_0183055 | 3300048923 | Bacteria | 1027 |
| 229 | Ga0496121_0000864 | 3300048924 | Bacteria | 54785 |
| 230 | Ga0496121_0016867 | 3300048924 | Bacteria | 7510 |
| 231 | Ga0496121_0041882 | 3300048924 | Bacteria | 3993 |
| 232 | Ga0496121_0043878 | 3300048924 | Bacteria | 3866 |
| 233 | Ga0496121_0055366 | 3300048924 | Bacteria | 3305 |
| 234 | Ga0496121_0095000 | 3300048924 | Bacteria | 2318 |
| 235 | Ga0496124_0001167 | 3300048927 | Bacteria | 41138 |
| 236 | Ga0496125_0079143 | 3300048928 | Bacteria | 2523 |
| 237 | Ga0496125_0246252 | 3300048928 | Bacteria | 1131 |
| 238 | Ga0496126_0003918 | 3300048929 | Bacteria | 18248 |
| 239 | Ga0496126_0034187 | 3300048929 | Bacteria | 4776 |
| 240 | Ga0496126_0061233 | 3300048929 | Bacteria | 3381 |
| 241 | Ga0496126_0285199 | 3300048929 | Bacteria | 1367 |
| 242 | Ga0496126_0305043 | 3300048929 | Bacteria | 1312 |
| 243 | Ga0501033_0192372 | 3300049570 | Bacteria | 1460 |
| 244 | Ga0501036_0115806 | 3300049572 | Bacteria | 2264 |
| 245 | Ga0501038_0110417 | 3300049574 | Bacteria | 2279 |
| 246 | Ga0501039_0136099 | 3300049575 | Bacteria | 1929 |
| 247 | Ga0501040_0073539 | 3300049576 | Bacteria | 2362 |
| 248 | Ga0501040_0267588 | 3300049576 | Bacteria | 1220 |
| 249 | Ga0501041_0098104 | 3300049577 | Bacteria | 1812 |
| 250 | Ga0501046_0044033 | 3300049580 | Bacteria | 3551 |
| 251 | Ga0501046_0384187 | 3300049580 | Bacteria | 1016 |
| 252 | Ga0501048_0056314 | 3300049582 | Bacteria | 2790 |
| 253 | Ga0501048_0087569 | 3300049582 | Bacteria | 2197 |
| 254 | Ga0501048_0255029 | 3300049582 | Bacteria | 1246 |
| 255 | Ga0501072_0275635 | 3300049588 | Bacteria | 1338 |
| 256 | Ga0501073_0020692 | 3300049589 | Bacteria | 4745 |
| 257 | Ga0501073_0337282 | 3300049589 | Bacteria | 1041 |
| 258 | Ga0501075_0059980 | 3300049591 | Bacteria | 2867 |
| 259 | Ga0501075_0260431 | 3300049591 | Bacteria | 1322 |
| 260 | Ga0501077_0027357 | 3300049593 | Bacteria | 3622 |
| 261 | Ga0501079_0033382 | 3300049741 | Bacteria | 3959 |
| 262 | Ga0501080_0048630 | 3300049742 | Bacteria | 3947 |
| 263 | Ga0501081_0007379 | 3300049743 | Bacteria | 7136 |
| 264 | Ga0501081_0013569 | 3300049743 | Bacteria | 5359 |
| 265 | Ga0501081_0679393 | 3300049743 | Bacteria | 773 |
| 266 | Ga0501083_0253372 | 3300049744 | Bacteria | 1146 |
| 267 | Ga0501045_0017850 | 3300049824 | Bacteria | 5040 |
| 268 | Ga0501045_0133462 | 3300049824 | Bacteria | 1846 |
| 269 | Ga0501045_0325545 | 3300049824 | Bacteria | 1144 |
| 270 | nmdc:mga05p37_1062189_c1 | 3300050507 | Bacteria | 853 |
| 271 | nmdc:mga06r32_1309_c1 | 3300050510 | Bacteria | 22466 |
| 272 | nmdc:mga06r32_216506_c1 | 3300050510 | Bacteria | 1903 |
| 273 | nmdc:mga06r32_457935_c1 | 3300050510 | Bacteria | 1255 |
| 274 | Ga0500635_0005613 | 3300053080 | Bacteria | 3303 |
| 275 | Ga0500635_0124148 | 3300053080 | Bacteria | 968 |
| 276 | Ga0495619_0131044 | 3300053085 | Bacteria | 1723 |
| 277 | Ga0500578_0108994 | 3300053086 | Bacteria | 1747 |
| 278 | Ga0500578_0352991 | 3300053086 | Bacteria | 859 |
| 279 | Ga0500643_001425 | 3300053087 | Bacteria | 13789 |
| 280 | Ga0500566_0002429 | 3300053094 | Bacteria | 11045 |
| 281 | Ga0500640_004680 | 3300053095 | Bacteria | 4999 |
| 282 | Ga0500572_000079 | 3300053111 | Bacteria | 30298 |
| 283 | Ga0500572_000767 | 3300053111 | Bacteria | 10315 |
| 284 | Ga0500591_148559 | 3300053115 | Bacteria | 910 |
| 285 | Ga0500595_077116 | 3300053119 | Bacteria | 980 |
| 286 | Ga0500608_098402 | 3300053122 | Bacteria | 1358 |
| 287 | Ga0500614_000977 | 3300053123 | Bacteria | 7128 |
| 288 | Ga0500642_0060504 | 3300053130 | Bacteria | 1699 |
| 289 | Ga0500559_0004862 | 3300053136 | Bacteria | 6266 |
| 290 | Ga0500559_0065907 | 3300053136 | Bacteria | 1623 |
| 291 | Ga0500559_0121393 | 3300053136 | Bacteria | 1215 |
| 292 | Ga0500568_0127381 | 3300053139 | Bacteria | 947 |
| 293 | Ga0500573_0213847 | 3300053140 | Bacteria | 1015 |
| 294 | Ga0500603_000418 | 3300053150 | Bacteria | 11032 |
| 295 | Ga0500603_014922 | 3300053150 | Bacteria | 1821 |
| 296 | Ga0500603_022687 | 3300053150 | Bacteria | 1556 |
| 297 | Ga0500622_0039440 | 3300053156 | Bacteria | 2462 |
| 298 | Ga0500630_013681 | 3300053159 | Bacteria | 3995 |
| 299 | Ga0500638_008630 | 3300053162 | Bacteria | 4361 |
| 300 | Ga0500639_000087 | 3300053163 | Bacteria | 43854 |
| 301 | Ga0500636_0023375 | 3300053177 | Bacteria | 3656 |
| 302 | Ga0500636_0028519 | 3300053177 | Bacteria | 3296 |
| 303 | Ga0500636_0097408 | 3300053177 | Bacteria | 1676 |
| 304 | Ga0500636_0161836 | 3300053177 | Bacteria | 1219 |
| 305 | Ga0500636_0202316 | 3300053177 | Bacteria | 1049 |
| 306 | Ga0500637_0012203 | 3300053178 | Bacteria | 4470 |
| 307 | Ga0500637_0103955 | 3300053178 | Bacteria | 1647 |
| 308 | Ga0500637_0397507 | 3300053178 | Bacteria | 716 |
| 309 | Ga0500576_032442 | 3300053725 | Bacteria | 2369 |
| 310 | Ga0500657_059323 | 3300053728 | Bacteria | 1716 |
| 311 | Ga0500596_000941 | 3300053735 | Bacteria | 5805 |
| 312 | Ga0500596_005920 | 3300053735 | Bacteria | 2108 |
| 313 | Ga0500601_004835 | 3300053737 | Bacteria | 1473 |
| 314 | Ga0501084_0086730 | 3300054114 | Bacteria | 2628 |
| 315 | Ga0501084_0187567 | 3300054114 | Bacteria | 1745 |
| 316 | Ga0501082_0020069 | 3300060353 | Bacteria | 5760 |
| 317 | Ga0501082_0023613 | 3300060353 | Bacteria | 5304 |
| 318 | Ga0501082_0030553 | 3300060353 | Bacteria | 4642 |
| 319 | Ga0530510_0205529 | 3300061734 | Bacteria | 1463 |
| 320 | 2513675492 | 2513237098 | Bacteria | 9902361 |
| 321 | 2524470596 | 2524023210 | Bacteria | 9029266 |
| 322 | 2545673016 | 2545555834 | Bacteria | 8130841 |
| 323 | 2644731980 | 2643221733 | Bacteria | 5690728 |
| 324 | 2885388252 | 2885383462 | Bacteria | 9473874 |
| 325 | 2897809086 | 2897803580 | Bacteria | 7000062 |
| 326 | 3003668675 | 3003665799 | Bacteria | 7279786 |
| 327 | 3005714337 | 3005710791 | Bacteria | 7622528 |
| 328 | 641645959 | 641522639 | Bacteria | 7737025 |
| 329 | 643603947 | 643348564 | Bacteria | 8839022 |
| 330 | 8006927373 | 8006926726 | Bacteria | 6749210 |
| 331 | 8056683246 | 8056681323 | Bacteria | 8472857 |
| 332 | Ga0075431_100177926 | |||
| 333 | JGI24751J29686_10067879 | |||
| 334 | JGI25406J46586_10016487 | |||
| 335 | JGI25404J52841_10004730 | |||
| 336 | Ga0068869_100186976 | |||
| 337 | Ga0070680_100023988 | |||
| 338 | Ga0070689_100097211 | |||
| 339 | Ga0070689_101000642 | |||
| 340 | Ga0070669_100288598 | |||
| 341 | Ga0070675_100256236 | |||
| 342 | Ga0070688_100355369 | |||
| 343 | Ga0070703_10006715 | |||
| 344 | Ga0070710_10184595 | |||
| 345 | Ga0070701_10015998 | |||
| 346 | Ga0070711_100078586 | |||
| 347 | Ga0070705_100000469 | |||
| 348 | Ga0070700_100003486 | |||
| 349 | Ga0070694_100009742 | |||
| 350 | Ga0070708_100019293 | |||
| 351 | Ga0070708_100113066 | |||
| 352 | Ga0070663_100563773 | |||
| 353 | Ga0070681_10052098 | |||
| 354 | Ga0068867_100041268 | |||
| 355 | Ga0070706_100200494 | |||
| 356 | Ga0070698_100045815 | |||
| 357 | Ga0070698_100074285 | |||
| 358 | Ga0070699_100001512 | |||
| 359 | Ga0070679_100056498 | |||
| 360 | Ga0070697_100010899 | |||
| 361 | Ga0070695_100018365 | |||
| 362 | Ga0070696_100000758 | |||
| 363 | Ga0070665_100087509 | |||
| 364 | Ga0070704_100000433 | |||
| 365 | Ga0068859_100004727 | |||
| 366 | Ga0068864_100022313 | |||
| 367 | Ga0068864_100341653 | |||
| 368 | Ga0068861_100040785 | |||
| 369 | Ga0068870_10283204 | |||
| 370 | Ga0068863_100458781 | |||
| 371 | Ga0068858_100359294 | |||
| 372 | Ga0068858_100557147 | |||
| 373 | Ga0068860_100000803 | |||
| 374 | Ga0068860_100002721 | |||
| 375 | Ga0081455_10025659 | |||
| 376 | Ga0081455_10352341 | |||
| 377 | Ga0081540_1001417 | |||
| 378 | Ga0081539_10001720 | |||
| 379 | Ga0070717_10221973 | |||
| 380 | Ga0070717_10519285 | |||
| 381 | Ga0070712_100014673 | |||
| 382 | Ga0070712_100025768 | |||
| 383 | Ga0097621_100693240 | |||
| 384 | Ga0068871_100060711 | |||
| 385 | Ga0075428_100088338 | |||
| 386 | Ga0075428_100199077 | |||
| 387 | Ga0075431_100005060 | |||
| 388 | Ga0075431_100143079 | |||
| 389 | Ga0075434_100024768 | |||
| 390 | Ga0075429_100050525 | |||
| 391 | Ga0075429_100320022 | |||
| 392 | Ga0097620_100004727 | |||
| 393 | Ga0075435_100029900 | |||
| 394 | Ga0099795_10013658 | |||
| 395 | Ga0111539_10234751 | |||
| 396 | Ga0105247_10109883 | |||
| 397 | Ga0105247_10143241 | |||
| 398 | Ga0114129_10228806 | |||
| 399 | Ga0105237_10072199 | |||
| 400 | Ga0105237_10104384 | |||
| 401 | Ga0105249_10005007 | |||
| 402 | Ga0105239_10152923 | |||
| 403 | Ga0105239_10214468 | |||
| 404 | Ga0105239_10488905 | |||
| 405 | Ga0163162_10085742 | |||
| 406 | Ga0157380_10201193 | |||
| 407 | Ga0157379_10334800 | |||
| 408 | Ga0157379_10349302 | |||
| 409 | Ga0209677_101509 | |||
| 410 | Ga0209148_1015375 | |||
| 411 | Ga0209233_1003122 | |||
| 412 | Ga0209455_1004192 | |||
| 413 | Ga0209455_1006331 | |||
| 414 | Ga0209455_1022963 | |||
| 415 | Ga0209758_1000079 | |||
| 416 | Ga0207653_10001684 | |||
| 417 | Ga0207710_10055350 | |||
| 418 | Ga0207688_10179736 | |||
| 419 | Ga0207647_10152287 | |||
| 420 | Ga0207643_10143816 | |||
| 421 | Ga0207684_10129053 | |||
| 422 | Ga0207654_10014902 | |||
| 423 | Ga0207707_10043293 | |||
| 424 | Ga0207693_10021392 | |||
| 425 | Ga0207693_10051326 | |||
| 426 | Ga0207663_10380340 | |||
| 427 | Ga0207660_10017046 | |||
| 428 | Ga0207652_10033793 | |||
| 429 | Ga0207681_10312881 | |||
| 430 | Ga0207650_10196878 | |||
| 431 | Ga0207687_10185480 | |||
| 432 | Ga0207670_10337805 | |||
| 433 | Ga0207689_10290695 | |||
| 434 | Ga0207712_10005811 | |||
| 435 | Ga0207703_10529067 | |||
| 436 | Ga0207639_10325534 | |||
| 437 | Ga0207678_10010914 | |||
| 438 | Ga0207708_10002051 | |||
| 439 | Ga0207641_10072937 | |||
| 440 | Ga0207641_10241702 | |||
| 441 | Ga0207676_10006855 | |||
| 442 | Ga0207674_10011187 | |||
| 443 | Ga0207674_10207179 | |||
| 444 | Ga0207675_100095767 | |||
| 445 | Ga0207675_100349956 | |||
| 446 | Ga0207675_100352012 | |||
| 447 | Ga0207683_10346873 | |||
| 448 | Ga0268266_10078879 | |||
| 449 | Ga0268266_10157770 | |||
| 450 | Ga0268266_11117588 | |||
| 451 | Ga0268265_10000750 | |||
| 452 | Ga0268264_10000022 | |||
| 453 | Ga0268264_10001691 | |||
| 454 | Ga0307517_10092949 | |||
| 455 | Ga0307511_10167709 | |||
| 456 | Ga0307509_10024408 | |||
| 457 | Ga0307508_10193219 | |||
| 458 | Ga0307516_10007250 | |||
| 459 | Ga0307516_10043070 | |||
| 460 | Ga0307507_10073537 | |||
| 461 | Ga0307510_10005434 | |||
| 462 | Ga0307510_10196395 | |||
| 463 | Ga0373944_0112477 | |||
| 464 | Ga0373923_0077259 | |||
| 465 | Ga0373932_0083093 | |||
| 466 | Ga0373936_0060149 | |||
| 467 | Ga0373954_0025347 | |||
| 468 | Ga0373955_0071046 | |||
| 469 | Ga0373924_0123900 | |||
| 470 | Ga0373935_0001100 | |||
| 471 | Ga0373935_0094692 | |||
| 472 | Ga0373927_0000432 | |||
| 473 | Ga0373927_0158102 | |||
| 474 | Ga0373933_0169893 | |||
| 475 | Ga0373947_0003013 | |||
| 476 | Ga0373925_0022216 | |||
| 477 | Ga0395905_0624853 | |||
| 478 | Ga0436364_1104792 | |||
| 479 | Ga0436365_0626927 | |||
| 480 | Ga0436363_0901801 | |||
| 481 | Ga0466970_0135811 | |||
| 482 | Ga0466957_0178482 | |||
| 483 | Ga0466967_0039311 | |||
| 484 | Ga0495592_0161776 | |||
| 485 | Ga0495592_0403268 | |||
| 486 | Ga0495603_0000067 | |||
| 487 | Ga0495629_0001667 | |||
| 488 | Ga0495638_0392307 | |||
| 489 | Ga0495641_0007251 | |||
| 490 | Ga0495651_0012681 | |||
| 491 | Ga0495580_0033605 | |||
| 492 | Ga0495582_0000744 | |||
| 493 | Ga0495639_0004418 | |||
| 494 | Ga0495639_0278401 | |||
| 495 | Ga0495662_0000276 | |||
| 496 | Ga0495664_0017849 | |||
| 497 | Ga0495664_0047002 | |||
| 498 | Ga0495594_0001204 | |||
| 499 | Ga0495610_0054803 | |||
| 500 | Ga0495618_0294007 | |||
| 501 | Ga0495628_0138383 | |||
| 502 | Ga0495630_0040678 | |||
| 503 | Ga0495666_0006144 | |||
| 504 | Ga0495652_0015722 | |||
| 505 | Ga0495652_0131748 | |||
| 506 | Ga0495665_0000307 | |||
| 507 | Ga0495640_0006166 | |||
| 508 | Ga0495587_0167864 | |||
| 509 | Ga0495645_0131014 | |||
| 510 | Ga0495622_0053269 | |||
| 511 | Ga0495667_0003657 | |||
| 512 | Ga0495656_0226264 | |||
| 513 | Ga0495634_0026745 | |||
| 514 | Ga0495625_0091058 | |||
| 515 | Ga0495635_0033967 | |||
| 516 | Ga0495635_0084242 | |||
| 517 | Ga0495657_0024226 | |||
| 518 | Ga0495657_0169978 | |||
| 519 | Ga0495599_0027709 | |||
| 520 | Ga0495599_0272071 | |||
| 521 | Ga0495623_0090575 | |||
| 522 | Ga0495646_0021636 | |||
| 523 | Ga0495646_0027215 | |||
| 524 | Ga0495647_0000963 | |||
| 525 | Ga0495658_0000520 | |||
| 526 | Ga0495613_0067948 | |||
| 527 | Ga0495624_0004648 | |||
| 528 | Ga0495600_0060316 | |||
| 529 | Ga0495581_0000022 | |||
| 530 | Ga0495604_0002314 | |||
| 531 | Ga0495674_0001816 | |||
| 532 | Ga0495674_0072123 | |||
| 533 | Ga0495676_0072675 | |||
| 534 | Ga0495680_0094099 | |||
| 535 | Ga0495675_0016386 | |||
| 536 | Ga0495673_0034158 | |||
| 537 | Ga0495684_0216175 | |||
| 538 | Ga0495686_0000337 | |||
| 539 | Ga0495593_0000016 | |||
| 540 | Ga0495593_0259361 | |||
| 541 | Ga0495593_0291465 | |||
| 542 | Ga0495602_0053961 | |||
| 543 | Ga0496100_0241709 | |||
| 544 | Ga0496101_0114864 | |||
| 545 | Ga0496101_0133464 | |||
| 546 | Ga0496102_0016222 | |||
| 547 | Ga0496102_0498842 | |||
| 548 | Ga0496105_0382340 | |||
| 549 | Ga0496106_0002074 | |||
| 550 | Ga0496106_0029824 | |||
| 551 | Ga0496106_0053171 | |||
| 552 | Ga0496107_0254576 | |||
| 553 | Ga0496112_0468750 | |||
| 554 | Ga0496115_0024966 | |||
| 555 | Ga0496115_0363258 | |||
| 556 | Ga0496117_0112441 | |||
| 557 | Ga0496118_0008043 | |||
| 558 | Ga0496119_0100007 | |||
| 559 | Ga0496120_0183055 | |||
| 560 | Ga0496121_0000864 | |||
| 561 | Ga0496121_0016867 | |||
| 562 | Ga0496121_0041882 | |||
| 563 | Ga0496121_0043878 | |||
| 564 | Ga0496121_0055366 | |||
| 565 | Ga0496121_0095000 | |||
| 566 | Ga0496124_0001167 | |||
| 567 | Ga0496125_0079143 | |||
| 568 | Ga0496125_0246252 | |||
| 569 | Ga0496126_0003918 | |||
| 570 | Ga0496126_0034187 | |||
| 571 | Ga0496126_0061233 | |||
| 572 | Ga0496126_0285199 | |||
| 573 | Ga0496126_0305043 | |||
| 574 | Ga0501033_0192372 | |||
| 575 | Ga0501036_0115806 | |||
| 576 | Ga0501038_0110417 | |||
| 577 | Ga0501039_0136099 | |||
| 578 | Ga0501040_0073539 | |||
| 579 | Ga0501040_0267588 | |||
| 580 | Ga0501041_0098104 | |||
| 581 | Ga0501046_0044033 | |||
| 582 | Ga0501046_0384187 | |||
| 583 | Ga0501048_0056314 | |||
| 584 | Ga0501048_0087569 | |||
| 585 | Ga0501048_0255029 | |||
| 586 | Ga0501072_0275635 | |||
| 587 | Ga0501073_0020692 | |||
| 588 | Ga0501073_0337282 | |||
| 589 | Ga0501075_0059980 | |||
| 590 | Ga0501075_0260431 | |||
| 591 | Ga0501077_0027357 | |||
| 592 | Ga0501079_0033382 | |||
| 593 | Ga0501080_0048630 | |||
| 594 | Ga0501081_0007379 | |||
| 595 | Ga0501081_0013569 | |||
| 596 | Ga0501081_0679393 | |||
| 597 | Ga0501083_0253372 | |||
| 598 | Ga0501045_0017850 | |||
| 599 | Ga0501045_0133462 | |||
| 600 | Ga0501045_0325545 | |||
| 601 | nmdc:mga05p37_1062189_c1 | |||
| 602 | nmdc:mga06r32_1309_c1 | |||
| 603 | nmdc:mga06r32_216506_c1 | |||
| 604 | nmdc:mga06r32_457935_c1 | |||
| 605 | Ga0500635_0005613 | |||
| 606 | Ga0500635_0124148 | |||
| 607 | Ga0495619_0131044 | |||
| 608 | Ga0500578_0108994 | |||
| 609 | Ga0500578_0352991 | |||
| 610 | Ga0500643_001425 | |||
| 611 | Ga0500566_0002429 | |||
| 612 | Ga0500640_004680 | |||
| 613 | Ga0500572_000079 | |||
| 614 | Ga0500572_000767 | |||
| 615 | Ga0500591_148559 | |||
| 616 | Ga0500595_077116 | |||
| 617 | Ga0500608_098402 | |||
| 618 | Ga0500614_000977 | |||
| 619 | Ga0500642_0060504 | |||
| 620 | Ga0500559_0004862 | |||
| 621 | Ga0500559_0065907 | |||
| 622 | Ga0500559_0121393 | |||
| 623 | Ga0500568_0127381 | |||
| 624 | Ga0500573_0213847 | |||
| 625 | Ga0500603_000418 | |||
| 626 | Ga0500603_014922 | |||
| 627 | Ga0500603_022687 | |||
| 628 | Ga0500622_0039440 | |||
| 629 | Ga0500630_013681 | |||
| 630 | Ga0500638_008630 | |||
| 631 | Ga0500639_000087 | |||
| 632 | Ga0500636_0023375 | |||
| 633 | Ga0500636_0028519 | |||
| 634 | Ga0500636_0097408 | |||
| 635 | Ga0500636_0161836 | |||
| 636 | Ga0500636_0202316 | |||
| 637 | Ga0500637_0012203 | |||
| 638 | Ga0500637_0103955 | |||
| 639 | Ga0500637_0397507 | |||
| 640 | Ga0500576_032442 | |||
| 641 | Ga0500657_059323 | |||
| 642 | Ga0500596_000941 | |||
| 643 | Ga0500596_005920 | |||
| 644 | Ga0500601_004835 | |||
| 645 | Ga0501084_0086730 | |||
| 646 | Ga0501084_0187567 | |||
| 647 | Ga0501082_0020069 | |||
| 648 | Ga0501082_0023613 | |||
| 649 | Ga0501082_0030553 | |||
| 650 | Ga0530510_0205529 | |||
| 651 | 2513675492 | |||
| 652 | 2524470596 | |||
| 653 | 2545673016 | |||
| 654 | 2644731980 | |||
| 655 | 2885388252 | |||
| 656 | 2897809086 | |||
| 657 | 3003668675 | |||
| 658 | 3005714337 | |||
| 659 | 641645959 | |||
| 660 | 643603947 | |||
| 661 | 8006927373 | |||
| 662 | 8056683246 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.8472 | 1 | 201 |
| 2hdo-assembly1.cif.gz_A | crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution | 0.8457 | 1 | 205 |
| 3mc1-assembly1.cif.gz_A | crystal structure of a predicted phosphatase from clostridium acetobutylicum | 0.8349 | 1 | 207 |
| 2hdo-assembly1.cif.gz_A | crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution | 0.8344 | 1 | 205 |
| 2ah5-assembly1.cif.gz_A | hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae | 0.8325 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d6jA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8987 | 1 | 201 | 3.40.50.1000 |
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8962 | 83 | 193 | 3.40.50.1000 |
| af_O17773_104_249_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8926 | 84 | 201 | 3.40.50.1000 |
| 2ah5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.89 | 2 | 204 | 3.40.50.1000 |
| 3d6jA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8867 | 1 | 201 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W6ZW12-F1-model_v4 | HAD family hydrolase | 0.9987 | 3 | 205 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A533IVS8-F1-model_v4 | deleted | 0.9963 | 82 | 208 |
|
| AF-A0A3S1CHS2-F1-model_v4 | HAD family hydrolase | 0.995 | 3 | 205 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A1Y6KHZ6-F1-model_v4 | Putative phosphoglycolate phosphatase putative Haloacid dehalogenase-like hydrolase (EC 3.1.3.18) | 0.9919 | 3 | 205 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-H0TF23-F1-model_v4 | Putative phosphoglycolate phosphatase Haloacid dehalogenase-like hydrolase (EC 3.1.3.18) | 0.9908 | 1 | 205 |
GO:0005829
GO:0006281 GO:0008967 |