F410464

General Info

Members Datasets Scaffolds Average Seq Length
331 244 662 218

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100177926|Ga0075431_1001779262
Length 253
Sequence VRSASRGVCACPPHGGCEAGKSVDNGYPCTTPEVYARAMRYALAILDLDGTLSDSLPWFRAHVNEVADRFGFRRVAEEDIAPLRRAGTREILAYLGVPRWKLPMIARHMRRLKAAHLAEIPLFPGTAAMLRSLHAGGIRLALVSSDSDANARAQLGPANAALISDFACGASVFGKAAKFRRVLKRAGVLPASAIAIGDEVRDIEAARAAGIACGAVTWGYAASEALSALQPDLLIGRMQDIASALLPGSDGAR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
222 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
223 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
227 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
228 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
229 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
234 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
235 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
236 2643221733 Bosea sp. Root381 Isolate Unclassified
237 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
238 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
239 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
240 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
241 641522639 Methylobacterium sp. 4-46 Isolate Nodule
242 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
243 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
244 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 0
Isolates 3.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.9
Nodule 1.81
Rhizoplane 3.93
Rhizosphere 69.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100177926 3300006847 Bacteria 2184
2 JGI24751J29686_10067879 3300002459 Bacteria 734
3 JGI25406J46586_10016487 3300003203 Bacteria 3078
4 JGI25404J52841_10004730 3300003659 Bacteria 2780
5 Ga0068869_100186976 3300005334 Bacteria 1627
6 Ga0070680_100023988 3300005336 Bacteria 4870
7 Ga0070689_100097211 3300005340 Bacteria 2328
8 Ga0070689_101000642 3300005340 Bacteria 744
9 Ga0070669_100288598 3300005353 Bacteria 1316
10 Ga0070675_100256236 3300005354 Bacteria 1532
11 Ga0070688_100355369 3300005365 Bacteria 1074
12 Ga0070703_10006715 3300005406 Bacteria 3224
13 Ga0070710_10184595 3300005437 Bacteria 1308
14 Ga0070701_10015998 3300005438 Bacteria 3478
15 Ga0070711_100078586 3300005439 Bacteria 2345
16 Ga0070705_100000469 3300005440 Bacteria 23189
17 Ga0070700_100003486 3300005441 Bacteria 8114
18 Ga0070694_100009742 3300005444 Bacteria 5900
19 Ga0070708_100019293 3300005445 Bacteria 5728
20 Ga0070708_100113066 3300005445 Bacteria 2497
21 Ga0070663_100563773 3300005455 Bacteria 953
22 Ga0070681_10052098 3300005458 Bacteria 4082
23 Ga0068867_100041268 3300005459 Bacteria 3372
24 Ga0070706_100200494 3300005467 Bacteria 1864
25 Ga0070698_100045815 3300005471 Bacteria 4475
26 Ga0070698_100074285 3300005471 Bacteria 3405
27 Ga0070699_100001512 3300005518 Bacteria 21269
28 Ga0070679_100056498 3300005530 Bacteria 3911
29 Ga0070697_100010899 3300005536 Bacteria 7100
30 Ga0070695_100018365 3300005545 Bacteria 4247
31 Ga0070696_100000758 3300005546 Bacteria 20714
32 Ga0070665_100087509 3300005548 Bacteria 3121
33 Ga0070704_100000433 3300005549 Bacteria 19573
34 Ga0068859_100004727 3300005617 Bacteria 13833
35 Ga0068864_100022313 3300005618 Bacteria 5307
36 Ga0068864_100341653 3300005618 Bacteria 1411
37 Ga0068861_100040785 3300005719 Bacteria 3474
38 Ga0068870_10283204 3300005840 Bacteria 1040
39 Ga0068863_100458781 3300005841 Bacteria 1251
40 Ga0068858_100359294 3300005842 Bacteria 1396
41 Ga0068858_100557147 3300005842 Bacteria 1110
42 Ga0068860_100000803 3300005843 Bacteria 35288
43 Ga0068860_100002721 3300005843 Bacteria 18394
44 Ga0081455_10025659 3300005937 Bacteria 5435
45 Ga0081455_10352341 3300005937 Bacteria 1038
46 Ga0081540_1001417 3300005983 Bacteria 20744
47 Ga0081539_10001720 3300005985 Bacteria 35012
48 Ga0070717_10221973 3300006028 Bacteria 1661
49 Ga0070717_10519285 3300006028 Bacteria 1077
50 Ga0070712_100014673 3300006175 Bacteria 5029
51 Ga0070712_100025768 3300006175 Bacteria 3912
52 Ga0097621_100693240 3300006237 Bacteria 937
53 Ga0068871_100060711 3300006358 Bacteria 3085
54 Ga0075428_100088338 3300006844 Bacteria 3380
55 Ga0075428_100199077 3300006844 Bacteria 2166
56 Ga0075431_100005060 3300006847 Bacteria 12970
57 Ga0075431_100143079 3300006847 Bacteria 2465
58 Ga0075434_100024768 3300006871 Bacteria 5868
59 Ga0075429_100050525 3300006880 Bacteria 3617
60 Ga0075429_100320022 3300006880 Bacteria 1358
61 Ga0097620_100004727 3300006931 Bacteria 13833
62 Ga0075435_100029900 3300007076 Bacteria 4279
63 Ga0099795_10013658 3300007788 Bacteria 2498
64 Ga0111539_10234751 3300009094 Bacteria 2135
65 Ga0105247_10109883 3300009101 Bacteria 1773
66 Ga0105247_10143241 3300009101 Bacteria 1568
67 Ga0114129_10228806 3300009147 Bacteria 2505
68 Ga0105237_10072199 3300009545 Bacteria 3445
69 Ga0105237_10104384 3300009545 Bacteria 2826
70 Ga0105249_10005007 3300009553 Bacteria 11429
71 Ga0105239_10152923 3300010375 Bacteria 2575
72 Ga0105239_10214468 3300010375 Bacteria 2158
73 Ga0105239_10488905 3300010375 Bacteria 1399
74 Ga0163162_10085742 3300013306 Bacteria 3227
75 Ga0157380_10201193 3300014326 Bacteria 1767
76 Ga0157379_10334800 3300014968 Bacteria 1383
77 Ga0157379_10349302 3300014968 Bacteria 1354
78 Ga0209677_101509 3300025253 Bacteria 9980
79 Ga0209148_1015375 3300025254 Bacteria 1337
80 Ga0209233_1003122 3300025261 Bacteria 5889
81 Ga0209455_1004192 3300025272 Bacteria 4819
82 Ga0209455_1006331 3300025272 Bacteria 3508
83 Ga0209455_1022963 3300025272 Bacteria 1178
84 Ga0209758_1000079 3300025297 Bacteria 262874
85 Ga0207653_10001684 3300025885 Bacteria 7077
86 Ga0207710_10055350 3300025900 Bacteria 1788
87 Ga0207688_10179736 3300025901 Bacteria 1261
88 Ga0207647_10152287 3300025904 Bacteria 1351
89 Ga0207643_10143816 3300025908 Bacteria 1426
90 Ga0207684_10129053 3300025910 Bacteria 2170
91 Ga0207654_10014902 3300025911 Bacteria 4023
92 Ga0207707_10043293 3300025912 Bacteria 3927
93 Ga0207693_10021392 3300025915 Bacteria 5140
94 Ga0207693_10051326 3300025915 Bacteria 3237
95 Ga0207663_10380340 3300025916 Bacteria 1075
96 Ga0207660_10017046 3300025917 Bacteria 4820
97 Ga0207652_10033793 3300025921 Bacteria 4308
98 Ga0207681_10312881 3300025923 Bacteria 1246
99 Ga0207650_10196878 3300025925 Bacteria 1612
100 Ga0207687_10185480 3300025927 Bacteria 1615
101 Ga0207670_10337805 3300025936 Bacteria 1189
102 Ga0207689_10290695 3300025942 Bacteria 1354
103 Ga0207712_10005811 3300025961 Bacteria 7775
104 Ga0207703_10529067 3300026035 Bacteria 1110
105 Ga0207639_10325534 3300026041 Bacteria 1366
106 Ga0207678_10010914 3300026067 Bacteria 7982
107 Ga0207708_10002051 3300026075 Bacteria 14854
108 Ga0207641_10072937 3300026088 Bacteria 2958
109 Ga0207641_10241702 3300026088 Bacteria 1683
110 Ga0207676_10006855 3300026095 Bacteria 8069
111 Ga0207674_10011187 3300026116 Bacteria 10088
112 Ga0207674_10207179 3300026116 Bacteria 1910
113 Ga0207675_100095767 3300026118 Bacteria 2794
114 Ga0207675_100349956 3300026118 Bacteria 1448
115 Ga0207675_100352012 3300026118 Bacteria 1443
116 Ga0207683_10346873 3300026121 Bacteria 1362
117 Ga0268266_10078879 3300028379 Bacteria 2866
118 Ga0268266_10157770 3300028379 Bacteria 2051
119 Ga0268266_11117588 3300028379 Bacteria 762
120 Ga0268265_10000750 3300028380 Bacteria 31594
121 Ga0268264_10000022 3300028381 Bacteria 476624
122 Ga0268264_10001691 3300028381 Bacteria 20334
123 Ga0307517_10092949 3300028786 Bacteria 2450
124 Ga0307511_10167709 3300030521 Bacteria 1215
125 Ga0307509_10024408 3300031507 Bacteria 6770
126 Ga0307508_10193219 3300031616 Bacteria 1636
127 Ga0307516_10007250 3300031730 Bacteria 12774
128 Ga0307516_10043070 3300031730 Bacteria 4475
129 Ga0307507_10073537 3300033179 Bacteria 3072
130 Ga0307510_10005434 3300033180 Bacteria 15167
131 Ga0307510_10196395 3300033180 Bacteria 1559
132 Ga0373944_0112477 3300035089 Bacteria 931
133 Ga0373923_0077259 3300035111 Bacteria 1439
134 Ga0373932_0083093 3300035112 Bacteria 1015
135 Ga0373936_0060149 3300035113 Bacteria 1549
136 Ga0373954_0025347 3300035118 Bacteria 2710
137 Ga0373955_0071046 3300035172 Bacteria 1946
138 Ga0373924_0123900 3300035410 Bacteria 1122
139 Ga0373935_0001100 3300035692 Bacteria 14763
140 Ga0373935_0094692 3300035692 Bacteria 1960
141 Ga0373927_0000432 3300035695 Bacteria 32114
142 Ga0373927_0158102 3300035695 Bacteria 1484
143 Ga0373933_0169893 3300035724 Bacteria 1387
144 Ga0373947_0003013 3300035725 Bacteria 10042
145 Ga0373925_0022216 3300037068 Bacteria 4626
146 Ga0395905_0624853 3300037471 Bacteria 979
147 Ga0436364_1104792 3300037853 Bacteria 3362
148 Ga0436365_0626927 3300039437 Bacteria 4268
149 Ga0436363_0901801 3300039450 Bacteria 2743
150 Ga0466970_0135811 3300044765 Bacteria 1353
151 Ga0466957_0178482 3300044842 Bacteria 1386
152 Ga0466967_0039311 3300045976 Bacteria 4066
153 Ga0495592_0161776 3300046454 Bacteria 1539
154 Ga0495592_0403268 3300046454 Bacteria 865
155 Ga0495603_0000067 3300046455 Bacteria 45466
156 Ga0495629_0001667 3300046459 Bacteria 17433
157 Ga0495638_0392307 3300046460 Bacteria 722
158 Ga0495641_0007251 3300046461 Bacteria 6971
159 Ga0495651_0012681 3300046462 Bacteria 6505
160 Ga0495580_0033605 3300046472 Bacteria 3694
161 Ga0495582_0000744 3300046473 Bacteria 18014
162 Ga0495639_0004418 3300046475 Bacteria 6028
163 Ga0495639_0278401 3300046475 Bacteria 831
164 Ga0495662_0000276 3300046476 Bacteria 22020
165 Ga0495664_0017849 3300046477 Bacteria 4058
166 Ga0495664_0047002 3300046477 Bacteria 2561
167 Ga0495594_0001204 3300046499 Bacteria 13519
168 Ga0495610_0054803 3300046512 Bacteria 1925
169 Ga0495618_0294007 3300046514 Bacteria 1010
170 Ga0495628_0138383 3300046516 Bacteria 1859
171 Ga0495630_0040678 3300046517 Bacteria 3474
172 Ga0495666_0006144 3300046526 Bacteria 6043
173 Ga0495652_0015722 3300046529 Bacteria 6773
174 Ga0495652_0131748 3300046529 Bacteria 1978
175 Ga0495665_0000307 3300046531 Bacteria 24786
176 Ga0495640_0006166 3300046533 Bacteria 9503
177 Ga0495587_0167864 3300046536 Bacteria 1247
178 Ga0495645_0131014 3300046543 Bacteria 1757
179 Ga0495622_0053269 3300046557 Bacteria 1877
180 Ga0495667_0003657 3300046559 Bacteria 10350
181 Ga0495656_0226264 3300046615 Bacteria 937
182 Ga0495634_0026745 3300046642 Bacteria 4023
183 Ga0495625_0091058 3300046660 Bacteria 2108
184 Ga0495635_0033967 3300046663 Bacteria 3538
185 Ga0495635_0084242 3300046663 Bacteria 2175
186 Ga0495657_0024226 3300046675 Bacteria 4326
187 Ga0495657_0169978 3300046675 Bacteria 1343
188 Ga0495599_0027709 3300046678 Bacteria 3550
189 Ga0495599_0272071 3300046678 Bacteria 1028
190 Ga0495623_0090575 3300046679 Bacteria 1878
191 Ga0495646_0021636 3300046680 Bacteria 4061
192 Ga0495646_0027215 3300046680 Bacteria 3588
193 Ga0495647_0000963 3300046681 Bacteria 8703
194 Ga0495658_0000520 3300046683 Bacteria 21077
195 Ga0495613_0067948 3300046689 Bacteria 2600
196 Ga0495624_0004648 3300046690 Bacteria 10004
197 Ga0495600_0060316 3300046809 Bacteria 2477
198 Ga0495581_0000022 3300047315 Bacteria 56149
199 Ga0495604_0002314 3300047317 Bacteria 15267
200 Ga0495674_0001816 3300047319 Bacteria 21040
201 Ga0495674_0072123 3300047319 Bacteria 2979
202 Ga0495676_0072675 3300047321 Bacteria 2640
203 Ga0495680_0094099 3300047322 Bacteria 2242
204 Ga0495675_0016386 3300047444 Bacteria 4688
205 Ga0495673_0034158 3300047469 Bacteria 2353
206 Ga0495684_0216175 3300047471 Bacteria 1407
207 Ga0495686_0000337 3300047472 Bacteria 77142
208 Ga0495593_0000016 3300047673 Bacteria 80178
209 Ga0495593_0259361 3300047673 Bacteria 870
210 Ga0495593_0291465 3300047673 Bacteria 816
211 Ga0495602_0053961 3300048088 Bacteria 3553
212 Ga0496100_0241709 3300048903 Bacteria 1332
213 Ga0496101_0114864 3300048904 Bacteria 2030
214 Ga0496101_0133464 3300048904 Bacteria 1887
215 Ga0496102_0016222 3300048905 Bacteria 6509
216 Ga0496102_0498842 3300048905 Bacteria 1139
217 Ga0496105_0382340 3300048908 Bacteria 1120
218 Ga0496106_0002074 3300048909 Bacteria 15012
219 Ga0496106_0029824 3300048909 Bacteria 4066
220 Ga0496106_0053171 3300048909 Bacteria 3058
221 Ga0496107_0254576 3300048910 Bacteria 1306
222 Ga0496112_0468750 3300048915 Bacteria 1197
223 Ga0496115_0024966 3300048918 Bacteria 4650
224 Ga0496115_0363258 3300048918 Bacteria 1179
225 Ga0496117_0112441 3300048920 Bacteria 1693
226 Ga0496118_0008043 3300048921 Bacteria 11011
227 Ga0496119_0100007 3300048922 Bacteria 1630
228 Ga0496120_0183055 3300048923 Bacteria 1027
229 Ga0496121_0000864 3300048924 Bacteria 54785
230 Ga0496121_0016867 3300048924 Bacteria 7510
231 Ga0496121_0041882 3300048924 Bacteria 3993
232 Ga0496121_0043878 3300048924 Bacteria 3866
233 Ga0496121_0055366 3300048924 Bacteria 3305
234 Ga0496121_0095000 3300048924 Bacteria 2318
235 Ga0496124_0001167 3300048927 Bacteria 41138
236 Ga0496125_0079143 3300048928 Bacteria 2523
237 Ga0496125_0246252 3300048928 Bacteria 1131
238 Ga0496126_0003918 3300048929 Bacteria 18248
239 Ga0496126_0034187 3300048929 Bacteria 4776
240 Ga0496126_0061233 3300048929 Bacteria 3381
241 Ga0496126_0285199 3300048929 Bacteria 1367
242 Ga0496126_0305043 3300048929 Bacteria 1312
243 Ga0501033_0192372 3300049570 Bacteria 1460
244 Ga0501036_0115806 3300049572 Bacteria 2264
245 Ga0501038_0110417 3300049574 Bacteria 2279
246 Ga0501039_0136099 3300049575 Bacteria 1929
247 Ga0501040_0073539 3300049576 Bacteria 2362
248 Ga0501040_0267588 3300049576 Bacteria 1220
249 Ga0501041_0098104 3300049577 Bacteria 1812
250 Ga0501046_0044033 3300049580 Bacteria 3551
251 Ga0501046_0384187 3300049580 Bacteria 1016
252 Ga0501048_0056314 3300049582 Bacteria 2790
253 Ga0501048_0087569 3300049582 Bacteria 2197
254 Ga0501048_0255029 3300049582 Bacteria 1246
255 Ga0501072_0275635 3300049588 Bacteria 1338
256 Ga0501073_0020692 3300049589 Bacteria 4745
257 Ga0501073_0337282 3300049589 Bacteria 1041
258 Ga0501075_0059980 3300049591 Bacteria 2867
259 Ga0501075_0260431 3300049591 Bacteria 1322
260 Ga0501077_0027357 3300049593 Bacteria 3622
261 Ga0501079_0033382 3300049741 Bacteria 3959
262 Ga0501080_0048630 3300049742 Bacteria 3947
263 Ga0501081_0007379 3300049743 Bacteria 7136
264 Ga0501081_0013569 3300049743 Bacteria 5359
265 Ga0501081_0679393 3300049743 Bacteria 773
266 Ga0501083_0253372 3300049744 Bacteria 1146
267 Ga0501045_0017850 3300049824 Bacteria 5040
268 Ga0501045_0133462 3300049824 Bacteria 1846
269 Ga0501045_0325545 3300049824 Bacteria 1144
270 nmdc:mga05p37_1062189_c1 3300050507 Bacteria 853
271 nmdc:mga06r32_1309_c1 3300050510 Bacteria 22466
272 nmdc:mga06r32_216506_c1 3300050510 Bacteria 1903
273 nmdc:mga06r32_457935_c1 3300050510 Bacteria 1255
274 Ga0500635_0005613 3300053080 Bacteria 3303
275 Ga0500635_0124148 3300053080 Bacteria 968
276 Ga0495619_0131044 3300053085 Bacteria 1723
277 Ga0500578_0108994 3300053086 Bacteria 1747
278 Ga0500578_0352991 3300053086 Bacteria 859
279 Ga0500643_001425 3300053087 Bacteria 13789
280 Ga0500566_0002429 3300053094 Bacteria 11045
281 Ga0500640_004680 3300053095 Bacteria 4999
282 Ga0500572_000079 3300053111 Bacteria 30298
283 Ga0500572_000767 3300053111 Bacteria 10315
284 Ga0500591_148559 3300053115 Bacteria 910
285 Ga0500595_077116 3300053119 Bacteria 980
286 Ga0500608_098402 3300053122 Bacteria 1358
287 Ga0500614_000977 3300053123 Bacteria 7128
288 Ga0500642_0060504 3300053130 Bacteria 1699
289 Ga0500559_0004862 3300053136 Bacteria 6266
290 Ga0500559_0065907 3300053136 Bacteria 1623
291 Ga0500559_0121393 3300053136 Bacteria 1215
292 Ga0500568_0127381 3300053139 Bacteria 947
293 Ga0500573_0213847 3300053140 Bacteria 1015
294 Ga0500603_000418 3300053150 Bacteria 11032
295 Ga0500603_014922 3300053150 Bacteria 1821
296 Ga0500603_022687 3300053150 Bacteria 1556
297 Ga0500622_0039440 3300053156 Bacteria 2462
298 Ga0500630_013681 3300053159 Bacteria 3995
299 Ga0500638_008630 3300053162 Bacteria 4361
300 Ga0500639_000087 3300053163 Bacteria 43854
301 Ga0500636_0023375 3300053177 Bacteria 3656
302 Ga0500636_0028519 3300053177 Bacteria 3296
303 Ga0500636_0097408 3300053177 Bacteria 1676
304 Ga0500636_0161836 3300053177 Bacteria 1219
305 Ga0500636_0202316 3300053177 Bacteria 1049
306 Ga0500637_0012203 3300053178 Bacteria 4470
307 Ga0500637_0103955 3300053178 Bacteria 1647
308 Ga0500637_0397507 3300053178 Bacteria 716
309 Ga0500576_032442 3300053725 Bacteria 2369
310 Ga0500657_059323 3300053728 Bacteria 1716
311 Ga0500596_000941 3300053735 Bacteria 5805
312 Ga0500596_005920 3300053735 Bacteria 2108
313 Ga0500601_004835 3300053737 Bacteria 1473
314 Ga0501084_0086730 3300054114 Bacteria 2628
315 Ga0501084_0187567 3300054114 Bacteria 1745
316 Ga0501082_0020069 3300060353 Bacteria 5760
317 Ga0501082_0023613 3300060353 Bacteria 5304
318 Ga0501082_0030553 3300060353 Bacteria 4642
319 Ga0530510_0205529 3300061734 Bacteria 1463
320 2513675492 2513237098 Bacteria 9902361
321 2524470596 2524023210 Bacteria 9029266
322 2545673016 2545555834 Bacteria 8130841
323 2644731980 2643221733 Bacteria 5690728
324 2885388252 2885383462 Bacteria 9473874
325 2897809086 2897803580 Bacteria 7000062
326 3003668675 3003665799 Bacteria 7279786
327 3005714337 3005710791 Bacteria 7622528
328 641645959 641522639 Bacteria 7737025
329 643603947 643348564 Bacteria 8839022
330 8006927373 8006926726 Bacteria 6749210
331 8056683246 8056681323 Bacteria 8472857
332 Ga0075431_100177926
333 JGI24751J29686_10067879
334 JGI25406J46586_10016487
335 JGI25404J52841_10004730
336 Ga0068869_100186976
337 Ga0070680_100023988
338 Ga0070689_100097211
339 Ga0070689_101000642
340 Ga0070669_100288598
341 Ga0070675_100256236
342 Ga0070688_100355369
343 Ga0070703_10006715
344 Ga0070710_10184595
345 Ga0070701_10015998
346 Ga0070711_100078586
347 Ga0070705_100000469
348 Ga0070700_100003486
349 Ga0070694_100009742
350 Ga0070708_100019293
351 Ga0070708_100113066
352 Ga0070663_100563773
353 Ga0070681_10052098
354 Ga0068867_100041268
355 Ga0070706_100200494
356 Ga0070698_100045815
357 Ga0070698_100074285
358 Ga0070699_100001512
359 Ga0070679_100056498
360 Ga0070697_100010899
361 Ga0070695_100018365
362 Ga0070696_100000758
363 Ga0070665_100087509
364 Ga0070704_100000433
365 Ga0068859_100004727
366 Ga0068864_100022313
367 Ga0068864_100341653
368 Ga0068861_100040785
369 Ga0068870_10283204
370 Ga0068863_100458781
371 Ga0068858_100359294
372 Ga0068858_100557147
373 Ga0068860_100000803
374 Ga0068860_100002721
375 Ga0081455_10025659
376 Ga0081455_10352341
377 Ga0081540_1001417
378 Ga0081539_10001720
379 Ga0070717_10221973
380 Ga0070717_10519285
381 Ga0070712_100014673
382 Ga0070712_100025768
383 Ga0097621_100693240
384 Ga0068871_100060711
385 Ga0075428_100088338
386 Ga0075428_100199077
387 Ga0075431_100005060
388 Ga0075431_100143079
389 Ga0075434_100024768
390 Ga0075429_100050525
391 Ga0075429_100320022
392 Ga0097620_100004727
393 Ga0075435_100029900
394 Ga0099795_10013658
395 Ga0111539_10234751
396 Ga0105247_10109883
397 Ga0105247_10143241
398 Ga0114129_10228806
399 Ga0105237_10072199
400 Ga0105237_10104384
401 Ga0105249_10005007
402 Ga0105239_10152923
403 Ga0105239_10214468
404 Ga0105239_10488905
405 Ga0163162_10085742
406 Ga0157380_10201193
407 Ga0157379_10334800
408 Ga0157379_10349302
409 Ga0209677_101509
410 Ga0209148_1015375
411 Ga0209233_1003122
412 Ga0209455_1004192
413 Ga0209455_1006331
414 Ga0209455_1022963
415 Ga0209758_1000079
416 Ga0207653_10001684
417 Ga0207710_10055350
418 Ga0207688_10179736
419 Ga0207647_10152287
420 Ga0207643_10143816
421 Ga0207684_10129053
422 Ga0207654_10014902
423 Ga0207707_10043293
424 Ga0207693_10021392
425 Ga0207693_10051326
426 Ga0207663_10380340
427 Ga0207660_10017046
428 Ga0207652_10033793
429 Ga0207681_10312881
430 Ga0207650_10196878
431 Ga0207687_10185480
432 Ga0207670_10337805
433 Ga0207689_10290695
434 Ga0207712_10005811
435 Ga0207703_10529067
436 Ga0207639_10325534
437 Ga0207678_10010914
438 Ga0207708_10002051
439 Ga0207641_10072937
440 Ga0207641_10241702
441 Ga0207676_10006855
442 Ga0207674_10011187
443 Ga0207674_10207179
444 Ga0207675_100095767
445 Ga0207675_100349956
446 Ga0207675_100352012
447 Ga0207683_10346873
448 Ga0268266_10078879
449 Ga0268266_10157770
450 Ga0268266_11117588
451 Ga0268265_10000750
452 Ga0268264_10000022
453 Ga0268264_10001691
454 Ga0307517_10092949
455 Ga0307511_10167709
456 Ga0307509_10024408
457 Ga0307508_10193219
458 Ga0307516_10007250
459 Ga0307516_10043070
460 Ga0307507_10073537
461 Ga0307510_10005434
462 Ga0307510_10196395
463 Ga0373944_0112477
464 Ga0373923_0077259
465 Ga0373932_0083093
466 Ga0373936_0060149
467 Ga0373954_0025347
468 Ga0373955_0071046
469 Ga0373924_0123900
470 Ga0373935_0001100
471 Ga0373935_0094692
472 Ga0373927_0000432
473 Ga0373927_0158102
474 Ga0373933_0169893
475 Ga0373947_0003013
476 Ga0373925_0022216
477 Ga0395905_0624853
478 Ga0436364_1104792
479 Ga0436365_0626927
480 Ga0436363_0901801
481 Ga0466970_0135811
482 Ga0466957_0178482
483 Ga0466967_0039311
484 Ga0495592_0161776
485 Ga0495592_0403268
486 Ga0495603_0000067
487 Ga0495629_0001667
488 Ga0495638_0392307
489 Ga0495641_0007251
490 Ga0495651_0012681
491 Ga0495580_0033605
492 Ga0495582_0000744
493 Ga0495639_0004418
494 Ga0495639_0278401
495 Ga0495662_0000276
496 Ga0495664_0017849
497 Ga0495664_0047002
498 Ga0495594_0001204
499 Ga0495610_0054803
500 Ga0495618_0294007
501 Ga0495628_0138383
502 Ga0495630_0040678
503 Ga0495666_0006144
504 Ga0495652_0015722
505 Ga0495652_0131748
506 Ga0495665_0000307
507 Ga0495640_0006166
508 Ga0495587_0167864
509 Ga0495645_0131014
510 Ga0495622_0053269
511 Ga0495667_0003657
512 Ga0495656_0226264
513 Ga0495634_0026745
514 Ga0495625_0091058
515 Ga0495635_0033967
516 Ga0495635_0084242
517 Ga0495657_0024226
518 Ga0495657_0169978
519 Ga0495599_0027709
520 Ga0495599_0272071
521 Ga0495623_0090575
522 Ga0495646_0021636
523 Ga0495646_0027215
524 Ga0495647_0000963
525 Ga0495658_0000520
526 Ga0495613_0067948
527 Ga0495624_0004648
528 Ga0495600_0060316
529 Ga0495581_0000022
530 Ga0495604_0002314
531 Ga0495674_0001816
532 Ga0495674_0072123
533 Ga0495676_0072675
534 Ga0495680_0094099
535 Ga0495675_0016386
536 Ga0495673_0034158
537 Ga0495684_0216175
538 Ga0495686_0000337
539 Ga0495593_0000016
540 Ga0495593_0259361
541 Ga0495593_0291465
542 Ga0495602_0053961
543 Ga0496100_0241709
544 Ga0496101_0114864
545 Ga0496101_0133464
546 Ga0496102_0016222
547 Ga0496102_0498842
548 Ga0496105_0382340
549 Ga0496106_0002074
550 Ga0496106_0029824
551 Ga0496106_0053171
552 Ga0496107_0254576
553 Ga0496112_0468750
554 Ga0496115_0024966
555 Ga0496115_0363258
556 Ga0496117_0112441
557 Ga0496118_0008043
558 Ga0496119_0100007
559 Ga0496120_0183055
560 Ga0496121_0000864
561 Ga0496121_0016867
562 Ga0496121_0041882
563 Ga0496121_0043878
564 Ga0496121_0055366
565 Ga0496121_0095000
566 Ga0496124_0001167
567 Ga0496125_0079143
568 Ga0496125_0246252
569 Ga0496126_0003918
570 Ga0496126_0034187
571 Ga0496126_0061233
572 Ga0496126_0285199
573 Ga0496126_0305043
574 Ga0501033_0192372
575 Ga0501036_0115806
576 Ga0501038_0110417
577 Ga0501039_0136099
578 Ga0501040_0073539
579 Ga0501040_0267588
580 Ga0501041_0098104
581 Ga0501046_0044033
582 Ga0501046_0384187
583 Ga0501048_0056314
584 Ga0501048_0087569
585 Ga0501048_0255029
586 Ga0501072_0275635
587 Ga0501073_0020692
588 Ga0501073_0337282
589 Ga0501075_0059980
590 Ga0501075_0260431
591 Ga0501077_0027357
592 Ga0501079_0033382
593 Ga0501080_0048630
594 Ga0501081_0007379
595 Ga0501081_0013569
596 Ga0501081_0679393
597 Ga0501083_0253372
598 Ga0501045_0017850
599 Ga0501045_0133462
600 Ga0501045_0325545
601 nmdc:mga05p37_1062189_c1
602 nmdc:mga06r32_1309_c1
603 nmdc:mga06r32_216506_c1
604 nmdc:mga06r32_457935_c1
605 Ga0500635_0005613
606 Ga0500635_0124148
607 Ga0495619_0131044
608 Ga0500578_0108994
609 Ga0500578_0352991
610 Ga0500643_001425
611 Ga0500566_0002429
612 Ga0500640_004680
613 Ga0500572_000079
614 Ga0500572_000767
615 Ga0500591_148559
616 Ga0500595_077116
617 Ga0500608_098402
618 Ga0500614_000977
619 Ga0500642_0060504
620 Ga0500559_0004862
621 Ga0500559_0065907
622 Ga0500559_0121393
623 Ga0500568_0127381
624 Ga0500573_0213847
625 Ga0500603_000418
626 Ga0500603_014922
627 Ga0500603_022687
628 Ga0500622_0039440
629 Ga0500630_013681
630 Ga0500638_008630
631 Ga0500639_000087
632 Ga0500636_0023375
633 Ga0500636_0028519
634 Ga0500636_0097408
635 Ga0500636_0161836
636 Ga0500636_0202316
637 Ga0500637_0012203
638 Ga0500637_0103955
639 Ga0500637_0397507
640 Ga0500576_032442
641 Ga0500657_059323
642 Ga0500596_000941
643 Ga0500596_005920
644 Ga0500601_004835
645 Ga0501084_0086730
646 Ga0501084_0187567
647 Ga0501082_0020069
648 Ga0501082_0023613
649 Ga0501082_0030553
650 Ga0530510_0205529
651 2513675492
652 2524470596
653 2545673016
654 2644731980
655 2885388252
656 2897809086
657 3003668675
658 3005714337
659 641645959
660 643603947
661 8006927373
662 8056683246

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

44

216

0.96

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

41

210

0.88

PF13242

Hydrolase_like

HAD-hyrolase-like

172

241

0.86

PF12710

HAD

haloacid dehalogenase-like hydrolase

44

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.8472 1 201
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8457 1 205
3mc1-assembly1.cif.gz_A crystal structure of a predicted phosphatase from clostridium acetobutylicum 0.8349 1 207
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8344 1 205
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8325 2 204
ID Description Score Start End Superfamily
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8987 1 201 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8962 83 193 3.40.50.1000
af_O17773_104_249_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8926 84 201 3.40.50.1000
2ah5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.89 2 204 3.40.50.1000
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8867 1 201 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1W6ZW12-F1-model_v4 HAD family hydrolase 0.9987 3 205 GO:0005829
GO:0006281
GO:0008967
AF-A0A533IVS8-F1-model_v4 deleted 0.9963 82 208
AF-A0A3S1CHS2-F1-model_v4 HAD family hydrolase 0.995 3 205 GO:0005829
GO:0006281
GO:0008967
AF-A0A1Y6KHZ6-F1-model_v4 Putative phosphoglycolate phosphatase putative Haloacid dehalogenase-like hydrolase (EC 3.1.3.18) 0.9919 3 205 GO:0005829
GO:0006281
GO:0008967
AF-H0TF23-F1-model_v4 Putative phosphoglycolate phosphatase Haloacid dehalogenase-like hydrolase (EC 3.1.3.18) 0.9908 1 205 GO:0005829
GO:0006281
GO:0008967

Map